NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065984

Metagenome / Metatranscriptome Family F065984

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065984
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 41 residues
Representative Sequence TEFKSERIYDFHWSFDGKQLAMVRGHTDSDVVLIRDGQQ
Number of Associated Samples 109
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.79 %
% of genes near scaffold ends (potentially truncated) 96.06 %
% of genes from short scaffolds (< 2000 bps) 86.61 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.213 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.472 % of family members)
Environment Ontology (ENVO) Unclassified
(25.197 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.417 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.97%    Coil/Unstructured: 94.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00313CSD 37.80
PF10282Lactonase 12.60
PF00578AhpC-TSA 3.94
PF12867DinB_2 3.15
PF13432TPR_16 2.36
PF14257DUF4349 1.57
PF12631MnmE_helical 1.57
PF07722Peptidase_C26 1.57
PF04397LytTR 1.57
PF12833HTH_18 0.79
PF13442Cytochrome_CBB3 0.79
PF13932GIDA_C 0.79
PF12704MacB_PCD 0.79
PF02518HATPase_c 0.79
PF00484Pro_CA 0.79
PF14329DUF4386 0.79
PF03951Gln-synt_N 0.79
PF13180PDZ_2 0.79
PF04055Radical_SAM 0.79
PF01979Amidohydro_1 0.79
PF03551PadR 0.79
PF06441EHN 0.79
PF14520HHH_5 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.79
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.79
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.79
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.79
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.79
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.21 %
UnclassifiedrootN/A0.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001546|JGI12659J15293_10069689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter778Open in IMG/M
3300002245|JGIcombinedJ26739_100136031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2320Open in IMG/M
3300005176|Ga0066679_10696284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter659Open in IMG/M
3300005434|Ga0070709_11630551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter526Open in IMG/M
3300005591|Ga0070761_10217390All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300005602|Ga0070762_10523649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae779Open in IMG/M
3300005712|Ga0070764_10598813All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005764|Ga0066903_107030935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter583Open in IMG/M
3300006041|Ga0075023_100310558All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300006059|Ga0075017_100690495All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300006059|Ga0075017_100816090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300006086|Ga0075019_11112397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae513Open in IMG/M
3300006102|Ga0075015_100362249All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300006176|Ga0070765_100022350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4761Open in IMG/M
3300006176|Ga0070765_100209332All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300006893|Ga0073928_11048036All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300007265|Ga0099794_10459545All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300007265|Ga0099794_10752335All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300009137|Ga0066709_103273014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300009520|Ga0116214_1408905All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300009524|Ga0116225_1168180All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300009628|Ga0116125_1040325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1176Open in IMG/M
3300009628|Ga0116125_1162286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300009635|Ga0116117_1057819All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300009700|Ga0116217_10915303All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300009839|Ga0116223_10222679All Organisms → cellular organisms → Bacteria → Acidobacteria1146Open in IMG/M
3300010046|Ga0126384_10079893All Organisms → cellular organisms → Bacteria2352Open in IMG/M
3300010048|Ga0126373_11111867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300010376|Ga0126381_100423458All Organisms → cellular organisms → Bacteria → Acidobacteria1861Open in IMG/M
3300010379|Ga0136449_100069293All Organisms → cellular organisms → Bacteria7590Open in IMG/M
3300010379|Ga0136449_100124729All Organisms → cellular organisms → Bacteria5155Open in IMG/M
3300010397|Ga0134124_13087638All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300011269|Ga0137392_10830263All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300011269|Ga0137392_11491086All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300011270|Ga0137391_10003450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis11973Open in IMG/M
3300012189|Ga0137388_10880398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium828Open in IMG/M
3300012202|Ga0137363_11250494All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300012925|Ga0137419_10627395All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300012929|Ga0137404_10726029All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300014199|Ga0181535_10712918All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300014657|Ga0181522_10887186All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300015264|Ga0137403_10405755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1242Open in IMG/M
3300017822|Ga0187802_10138266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300017943|Ga0187819_10297180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300017972|Ga0187781_10638702All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300017993|Ga0187823_10383155All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300017995|Ga0187816_10275162All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300018017|Ga0187872_10444351All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus lacunae543Open in IMG/M
3300018037|Ga0187883_10522969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica612Open in IMG/M
3300018042|Ga0187871_10164005All Organisms → cellular organisms → Bacteria → Acidobacteria1252Open in IMG/M
3300018042|Ga0187871_10720557All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300018047|Ga0187859_10636556All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300018085|Ga0187772_10400785All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300018086|Ga0187769_10857987All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300018086|Ga0187769_11202387All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300018086|Ga0187769_11496044All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300018088|Ga0187771_10547586All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300018088|Ga0187771_10760553All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300018433|Ga0066667_10063211Not Available2302Open in IMG/M
3300020579|Ga0210407_10990053All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300020580|Ga0210403_11251410All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300020581|Ga0210399_10032476All Organisms → cellular organisms → Bacteria → Acidobacteria4169Open in IMG/M
3300020581|Ga0210399_11492075All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300020582|Ga0210395_10856540All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300020583|Ga0210401_11379410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300021170|Ga0210400_11133055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300021170|Ga0210400_11483804All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300021171|Ga0210405_11333643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300021178|Ga0210408_11339186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300021180|Ga0210396_11159388All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300021401|Ga0210393_11246962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300021402|Ga0210385_10071671All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300021406|Ga0210386_10520820All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300021420|Ga0210394_10274938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1475Open in IMG/M
3300021420|Ga0210394_10654579All Organisms → cellular organisms → Bacteria → Acidobacteria922Open in IMG/M
3300021420|Ga0210394_11133679All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300021420|Ga0210394_11516323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300021432|Ga0210384_10185242All Organisms → cellular organisms → Bacteria → Acidobacteria1871Open in IMG/M
3300021432|Ga0210384_10962503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300021474|Ga0210390_11658491All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021478|Ga0210402_11467127All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300021478|Ga0210402_11686518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300022513|Ga0242667_1059589All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300022721|Ga0242666_1058062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300022727|Ga0224567_103608All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300022728|Ga0224566_105056All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300022756|Ga0222622_10917723All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300024295|Ga0224556_1013908All Organisms → cellular organisms → Bacteria → Acidobacteria2074Open in IMG/M
3300025414|Ga0208935_1009131All Organisms → cellular organisms → Bacteria → Acidobacteria1368Open in IMG/M
3300026499|Ga0257181_1038390All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300026552|Ga0209577_10251900All Organisms → cellular organisms → Bacteria → Acidobacteria1332Open in IMG/M
3300027605|Ga0209329_1107902All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300027635|Ga0209625_1031657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1180Open in IMG/M
3300027674|Ga0209118_1184743All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300027684|Ga0209626_1049406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1052Open in IMG/M
3300027767|Ga0209655_10125148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300027795|Ga0209139_10032831All Organisms → cellular organisms → Bacteria → Acidobacteria1840Open in IMG/M
3300027842|Ga0209580_10595337All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027853|Ga0209274_10282873All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300027867|Ga0209167_10444856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300028775|Ga0302231_10510165All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300028780|Ga0302225_10366753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300028798|Ga0302222_10033380All Organisms → cellular organisms → Bacteria2106Open in IMG/M
3300028906|Ga0308309_10077284All Organisms → cellular organisms → Bacteria2504Open in IMG/M
3300029943|Ga0311340_11142180All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300030007|Ga0311338_10056549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5175Open in IMG/M
3300030020|Ga0311344_10237962All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300030399|Ga0311353_11623078All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300030503|Ga0311370_11420959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300030706|Ga0310039_10315477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300031027|Ga0302308_10453726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300031233|Ga0302307_10460495All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300031236|Ga0302324_100171926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3509Open in IMG/M
3300031718|Ga0307474_10274703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1294Open in IMG/M
3300031719|Ga0306917_11403328All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031720|Ga0307469_10365772All Organisms → cellular organisms → Bacteria → Acidobacteria1217Open in IMG/M
3300031869|Ga0316030_112086All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300032076|Ga0306924_11938192All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300032261|Ga0306920_100166639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3284Open in IMG/M
3300032515|Ga0348332_12202951All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300032783|Ga0335079_10012884All Organisms → cellular organisms → Bacteria → Acidobacteria9544Open in IMG/M
3300032783|Ga0335079_12211451All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300032805|Ga0335078_10344664All Organisms → cellular organisms → Bacteria → Acidobacteria1981Open in IMG/M
3300032892|Ga0335081_10262647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2319Open in IMG/M
3300032895|Ga0335074_10287258All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300032954|Ga0335083_10212123All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300033158|Ga0335077_11049044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.51%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.15%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.57%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.57%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.57%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.79%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.79%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022727Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3EnvironmentalOpen in IMG/M
3300022728Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031869Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12659J15293_1006968933300001546Forest SoilDGSPGKYLTSFKSEHIWDFHWSWDGSKLAVVRGHDESDVVLMRDMRQ*
JGIcombinedJ26739_10013603113300002245Forest SoilSERIYDFHWSFDGKQLALVRGHTDSDVVLIKDQGSGIRGQ*
Ga0066679_1069628423300005176SoilKGQAITDFKAERIRDFHWSFDGKQLAMVRGHTDSDIVLIRDALQSDSP*
Ga0070709_1163055123300005434Corn, Switchgrass And Miscanthus RhizosphereLTSFKSEHIWDYHWSPDGSKVGIVRGHTDSDVVLIRSEQM*
Ga0070761_1021739033300005591SoilPLDGSAGKYLTSFKAEHIWDFHWSWDGSRLAIARGHDDSDVVLMRDMRQ*
Ga0070762_1052364913300005602SoilLTSFTSERILDFHWSFDGSKLAMVRGHNDSDVVLIHDRQP*
Ga0070764_1059881313300005712SoilGKQITDFPAEHILEFRWSFDGKQLGLIRGHTDSDVVLIRDAQQ*
Ga0066903_10703093523300005764Tropical Forest SoilSKGHYLTDFKSERIYDFHWSFDGKQLALVRGHNDSDVVLIRDMQQQ*
Ga0075023_10031055823300006041WatershedsKSEHIWDYHWSPDGSKIGIVRGHNDSDVVLMRDMQRP*
Ga0075017_10069049513300006059WatershedsDGSKGKALTNFNAEHIYDFHWSFDGKQLAIVRGHTESDVVLMRSTQP*
Ga0075017_10081609013300006059WatershedsKQITDFKSEHIIDFHWSVDGAQLALIRGHVDSDVVLIRDSQP*
Ga0075019_1111239723300006086WatershedsKQLTSFKAEHIWDFHWSSDGSRLAVVRGHTDSDVVLMRDMQQ*
Ga0075015_10036224933300006102WatershedsFNAEHIYDFHWSFDGKQLAIVRGHTESDVVLMRSTQP*
Ga0070765_10002235013300006176SoilGSSGKQITDFKSEHIRDFRWSFDGSRMAIIRGHTDSDVVLIRDMQP*
Ga0070765_10020933243300006176SoilFKSEHINDFHWSFDGSKLGVIRGHTDSDVVLIRDAQP*
Ga0073928_1104803623300006893Iron-Sulfur Acid SpringKQITDFTSEHIFDFHWSFDGKQLALVRGHTDADVVLIREGRQ*
Ga0099794_1045954523300007265Vadose Zone SoilLDGSKGHAITDFKAERIRDLHWSFDGKQLAMVRGHTDSDVVLIRDAQQSDSH*
Ga0099794_1075233523300007265Vadose Zone SoilERIWDFHWSFDGSKLALVRGHTDADVVLIRDAQQ*
Ga0066709_10327301413300009137Grasslands SoilGSPGKQITDFKSEEISDFHWSLDGRKLGLIRGHTESDVVLTRDSQP*
Ga0116214_140890513300009520Peatlands SoilAITDFKSERIRDFHWSIDGKQLALVRGHTDSDVVLIKDQGPGAGNAGARD*
Ga0116225_116818013300009524Peatlands SoilEHIIDFHWSPDGKQLGLIRGHTDSDVVLIHDQQQ*
Ga0116125_104032523300009628PeatlandGKQITDFKSEHINDFHWSFDGSKLGVIRGHTDSDVVLIRDMQP*
Ga0116125_116228623300009628PeatlandSEHIIDFHWSFDGSKLGVIRGHTDSDVVLIRDMQP*
Ga0116117_105781913300009635PeatlandLTSFKSEHIWDFHWSWDGSKLAVVRGHDDSDVVLMRDMRQ*
Ga0116217_1091530323300009700Peatlands SoilDRILDFHWSFDGSKLGVIRGHTDSDVVLIRDSQS*
Ga0116223_1022267913300009839Peatlands SoilSEHIYDFHWSFDGKQLALVRGHTDSDVVLIRDARNN*
Ga0126384_1007989343300010046Tropical Forest SoilLDGSKGHSVTDFKSERIYDFHWSFDGKQLALVRGHTDSDVVLIRDTQQ*
Ga0126373_1111186713300010048Tropical Forest SoilGPGKTLTAFKGEHIYDYHWSADGNRLALVQGHTDSDVVLMRNHEQ*
Ga0126381_10042345813300010376Tropical Forest SoilNFTSEHIYDFHWSFDGKQLAIVRGHNDSDVVLIRDNQP*
Ga0136449_10006929313300010379Peatlands SoilVTSFKAEHIWDYHWSPDGSKLAIVRGHTDSDVVLMRDVQQ*
Ga0136449_10012472923300010379Peatlands SoilLTSFKAERIWDFHWSEDGSKLAMARGHNDSDVVLLKDQGK*
Ga0134124_1308763813300010397Terrestrial SoilITNFKSENIGDDFRWSPDGSKLAVVRGHVDSDVVLIRDQQQ*
Ga0137392_1083026323300011269Vadose Zone SoilFKYEEISDFHWSFDGSKLALIRGHTDSDVVLINDSQP*
Ga0137392_1149108623300011269Vadose Zone SoilGSKGRQITDFTAEHIYDFHWSFDGKQLAMVRGHTDADVVLIRDTRP*
Ga0137391_1000345093300011270Vadose Zone SoilLSKQITDFTSEHIYDFHWSFDGSKLALVRGHTDADVVLIRNSQ*
Ga0137388_1088039823300012189Vadose Zone SoilKTEHIWDFHWSWDGSKLAMVRGHTDSDVVLMRDVQQ*
Ga0137363_1125049413300012202Vadose Zone SoilTSFKAEHIWDYHWSPDGSRLAMVRGHTDSDVVLMRDMQP*
Ga0137419_1062739523300012925Vadose Zone SoilSEHIYDFHWSFDGRKLALIRGHTDADVVLIRDSQP*
Ga0137404_1072602933300012929Vadose Zone SoilEQIGNGFHWSPDGGKLAIIRGHLDSDVVLIRDAQQ*
Ga0181535_1071291813300014199BogKGKQITDFTSEHIFDFHWSFDGKQLALVRGHTDADVVLIRDARP*
Ga0181522_1088718623300014657BogFKSERISDFHWSFDGTKLGVIRGHTDSDVVLIRDIQP*
Ga0137403_1040575513300015264Vadose Zone SoilAEHILDFHWSFDGSKLGLIRGHVDSDVVLIHDMK*
Ga0187802_1013826623300017822Freshwater SedimentGSPGKQITDFKAERILDFHWSFDGSKLGVIRGHTDSDVVLIRDSQS
Ga0187819_1029718033300017943Freshwater SedimentVISGSPGKQITNFKSELIGDFHWSFDGSKLGSIRGHTDSDVVLIRDSEK
Ga0187781_1063870223300017972Tropical PeatlandFTSEHIYDFHWSFDGKQLAMVRGHDDSDVVLIRDVRQ
Ga0187823_1038315513300017993Freshwater SedimentPLTSFKAEHIWDYHWSPDGSRLGLVRGHTDSDVVLLRDMQQ
Ga0187816_1027516223300017995Freshwater SedimentITDFTSERIYDFHWSFDGKQLAIVRGHTDSDAVLIRDAKN
Ga0187872_1044435113300018017PeatlandTNFTAEHIFDFHWSFDGKQLALVRGHTDSDVVLIRQNK
Ga0187883_1052296923300018037PeatlandFKAEHIWDYHWSPDGSKLALVRGHTDSDVVLMRDMQP
Ga0187871_1016400513300018042PeatlandTDFPAEHILEFRWSFDGKQLGLIRGHTDSDVVLIHNIQQ
Ga0187871_1072055723300018042PeatlandTSFKAEHIWDYHWSPDGSKLALVRGHTDSDVVLIRDMQQQ
Ga0187859_1063655613300018047PeatlandKSERISDFHWSFDGTKLGVIRGHTDSDVVLIRDIQP
Ga0187772_1040078513300018085Tropical PeatlandDFNSERIFDFHWSFDGKQLALVRGHTDSDVVLIRDQGH
Ga0187769_1085798723300018086Tropical PeatlandSFKSEHIWDFHWSWDGSKLALVRGHTDSDVVLMREQGR
Ga0187769_1120238723300018086Tropical PeatlandSERIYDFHWSFDGKQLALVRGHNDSDVVLIRDTGK
Ga0187769_1149604423300018086Tropical PeatlandHYITDFKAEHIYDFHWSFDGKQLAMVRGHTDSDVVLIKEQGPAARD
Ga0187771_1054758643300018088Tropical PeatlandPGKQITNFPSERIMDFHWSFDGKQLGLIRGHTDSDVVLIRDLGK
Ga0187771_1076055313300018088Tropical PeatlandKSEHIWDFHWSWDGSKLALVRGHTDSDVVLMREQHR
Ga0066667_1006321113300018433Grasslands SoilKQITDFKSEEISDFHWSLDGRKLGLIRGHTESDVVLIRDSQP
Ga0210407_1099005323300020579SoilTSEHIYDFHWSFDGKQLALVRGHTDADVVLIQESKSSGQ
Ga0210403_1125141023300020580SoilTSEHIYDFHWSFDGKQLAMVRGHTDADVVLIRDSQN
Ga0210399_1003247613300020581SoilTSFQAEHIWDFHWSPDGSKLAMVRGHTDSDVVLMRDAQP
Ga0210399_1149207523300020581SoilHIYDFHWSFDGKQLALVRGHTDADVVLIQESKSSGQ
Ga0210395_1085654023300020582SoilDFPAEHILEFRWSFDGKQLALIRGHTDSDVVLIRDMQQ
Ga0210401_1137941023300020583SoilGKLITAFSSEHIIDFHWSFDGSKLGLIHGHTDSDVVLIRDAQP
Ga0210400_1113305523300021170SoilKSEHINDFRWSFDGSQLGVIRGHTDSDVVLIRDTQP
Ga0210400_1148380413300021170SoilSFKSEQIYDFHWSFDGSKLALVQGHTDADVVLMREQRQ
Ga0210405_1133364323300021171SoilLTSFKAEHIWGYDWSPDGSRLAVTQGHNDSDVVLMSDMQP
Ga0210408_1133918623300021178SoilSERIRDFHWSFDGKQLAMVRGHTDSDVVLLRNQQP
Ga0210396_1115938813300021180SoilDGSPGKQITDFPAEHILEFRWSFDGKQLALIRGHTDSDVVLIRDMQQ
Ga0210393_1124696223300021401SoilDGSPGKQITDFKSEHINDFRWSFDGSQLGVIRGHTDSDVVLIRDTQP
Ga0210385_1007167113300021402SoilLDESKGHYITEFKSERIYDFHWSFDGKQLAMVRGHTDSDVVLIRDGQQ
Ga0210386_1052082033300021406SoilDFPAEHIVDFRWSFDGKQLGLIRGHTDSDVVLIRDLQQ
Ga0210394_1027493813300021420SoilKQLTDFKSEHIIDFHWSFDGSQLGLVRGHTDSDVVLIRDSQS
Ga0210394_1065457923300021420SoilTSERIQDFHFSFDGTKLAMVRGHNDSDVVLIRNAQP
Ga0210394_1113367923300021420SoilLTNFTSEHIYDFHWSFDGKQLALVRGHTDADVVLIQESKSSGQ
Ga0210394_1151632313300021420SoilITDFPAEHIVDFRWSFDGKQLGLIRGHTDSDVVLIRDLQQ
Ga0210384_1018524243300021432SoilAEHIYDFHWSFDGKQLAMVRGHTDADVVLIRDTRQ
Ga0210384_1096250323300021432SoilLSGKQITDFKSERIIDFHWSFDGSKLGVIRGHTDSDVVVIRDAQP
Ga0210390_1165849123300021474SoilKLITAFSSEHIIDFHWSFGGSKLGLIHGHTDSDVVLIRDAQP
Ga0210402_1146712713300021478SoilRQVTDFTSEHLYDFHWSFDGKQLALVRGHTDADVVLIRDMQK
Ga0210402_1168651813300021478SoilPLDGLPGKQITDFNSELINDFHWSLDGSKLAIVRAHTDSDVVLIRDSQQP
Ga0242667_105958913300022513SoilTEFKSERIYDFHWSFDGKQLAMVRGHTDSDVVLIRDGQQ
Ga0242666_105806223300022721SoilDFKSEHINDFHWSFDGSKLGVIRRHTDSDVVLIRDTQP
Ga0224567_10360813300022727Plant LitterDGSPGKQLTAFKSEQIKDFHWSFDGKQLALVRGHTDADVVLMRSQQP
Ga0224566_10505613300022728Plant LitterNFTSERIYDFHWSFDGKQLALVRGHTDSDVVLIRENH
Ga0222622_1091772323300022756Groundwater SedimentENIGDDFRWSPDGSKLALIRGHVDSDVVLIRDQQQ
Ga0224556_101390833300024295SoilNFSSEHIFDFHWSFDGKQLALVRGHTDADVVLIRDAKN
Ga0208935_100913133300025414PeatlandGSKGRQITNFDSEHIFDFHWSFDGKQLALVRGHTDSDVVLIRDQK
Ga0257181_103839013300026499SoilKGKQLTDFTSERIWDFHWSFDGSKLALVRGHTDADVVLIRDAQQLKK
Ga0209577_1025190033300026552SoilKAERIRDFHWSFDGKQLAMVRGHTDSDIVLIRDALQSDSP
Ga0209329_110790223300027605Forest SoilSEHIFDFHWSFDGKQLALVRGHTDADVVLIRDAQQ
Ga0209625_103165733300027635Forest SoilDGSKGKALTNFKAEHIYDFHWSFDGKQLAIVRGHTESDVVLMRSTQP
Ga0209118_118474313300027674Forest SoilDFKAEHIYDFHWSFDGKQLAIVRGHTESDVVLMRSTQP
Ga0209626_104940633300027684Forest SoilGKQITDFTSEHIYDFHWSFDGKQLAMGRGHTDSDVVLIRDMRP
Ga0209655_1012514823300027767Bog Forest SoilTDFKSEHINDFHWSFDGSKLGVVRGHTDSDVVLIRDAQP
Ga0209139_1003283113300027795Bog Forest SoilSERIYDFHWSPDGSRLALVRGHNDSDVVLMRNERP
Ga0209580_1059533713300027842Surface SoilGTPGKMLTAFKAEHIWDYHWSPDGSRLGLVRGHTDSDVVLMRNAPQ
Ga0209274_1028287333300027853SoilPLDGSAGKYLTSFKAEHIWDFHWSWDGSRLAIARGHDDSDVVLMRDMRQ
Ga0209167_1044485623300027867Surface SoilAEHIIDFHWSFDGSQLGLVRGHTDSDVVLIRDSQS
Ga0302231_1051016523300028775PalsaKGKQITYFPSEHIYDFHWSFDGKQSAIVRGHNDADVVLIRDMQK
Ga0302225_1036675313300028780PalsaSEHIFDFHWSFDGKQLALVRGHTDADVVLMRDMQP
Ga0302222_1003338013300028798PalsaSEHIFDFHWSFDGKQLALVRGHTDADVVLIRDTRQ
Ga0308309_1007728413300028906SoilFKSEHIWDYHWSPDGSKLALVRGHTDSDVVLMRDAQP
Ga0311340_1114218023300029943PalsaTSEHIYDFHWSFDGKQLAMVRGHTDADVVLIRDAHGISK
Ga0311338_1005654983300030007PalsaKQITSFTSEHIYDFHSSFDGKQLAMVRGHNDADVVLIRDND
Ga0311344_1023796243300030020BogDGSKGRQITDFTSERIYDFHSSLDRKQLAIVRGHTDSDVVLIRDMQK
Ga0311353_1162307823300030399PalsaGKYLTAFKSEHIWDFHWSWDGSRLAITRGHDDSDVVLMRDMRQ
Ga0311370_1142095923300030503PalsaKQLTDFISEHIYDFHWSFDGKQLAMVRGHTDADVVLIRDARQQ
Ga0310039_1031547723300030706Peatlands SoilKAEHLWDYHWSPDGSKLAVVRGHTDSDVVLMRDMQQQ
Ga0302308_1045372613300031027PalsaNQLTDFVSEHIFDFHWSFDGKQLALVRGHTDADVVLMRDMQP
Ga0302307_1046049523300031233PalsaQITSFTSEHIYDFHSSFDGKQLAMVRGHNDADVVLIRDND
Ga0302324_10017192613300031236PalsaKGKLITNFTAERIFDFHWSFDGKQLALVRGHTDADVVLMRDQKN
Ga0307474_1027470333300031718Hardwood Forest SoilGKQITDFTSEHIFDFHWSFDGKQLALVRGHTDADVVLIRDVRQ
Ga0306917_1140332813300031719SoilLTDFKSERIYDFHWSFDGKQLALVRGHNDSDVVLIRDMQQQ
Ga0307469_1036577213300031720Hardwood Forest SoilLDGSKGRQITDFTSERIYDFHWSFDGKQLAIVRGHTDSDVVLIRDMQK
Ga0316030_11208623300031869SoilFKSEQILAFHWSFDGSKLALVQGHQDSDAVLMRNQQQPRQ
Ga0306924_1193819223300032076SoilGHSITEFTSERIYDFHWSFDGKQLALVRGHNDSDVVLIRDTQQ
Ga0306920_10016663913300032261SoilSERIYDFHWSFDGKQLALVRGHNDSDVVLIRDMQQQ
Ga0348332_1220295113300032515Plant LitterQITDFKSERIWDFHWSFEGNQLALVRGHTDSDVVLIRDMKN
Ga0335079_1001288433300032783SoilVAAEEIWSYRWSPEGKQLALVRGHTDSDVVLLRDSQQ
Ga0335079_1221145123300032783SoilNFYSEHFGDSGSSFAWSPDGKRLAVIRGHTDSDVVLIQDTQQ
Ga0335078_1034466433300032805SoilITDFKAERIYDFRWSFDGKQLVVLRGHTDADVVLVREAKQ
Ga0335081_1026264753300032892SoilVAAEEIWSYRWSPDGKQLALVRGHTDSDVVLLRDSQQ
Ga0335074_1028725823300032895SoilAGRFVTDFKAERIYDFHWSFDGRQLALVRGHADSDVVLIRDQGQ
Ga0335083_1021212313300032954SoilSPGKQLTHFTSEHITDFHWSVDGKQVGFIRGHSESDVVLIRDTQQ
Ga0335077_1104904413300033158SoilNFKSEHIGDSFGWSPDGSKLALIRGHTDSDVVLIRDAQQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.