Basic Information | |
---|---|
Family ID | F065961 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 40 residues |
Representative Sequence | NAAEVRAAINGLFQQLENPSAYNADQFASALRRIRAMLR |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.64 % |
% of genes from short scaffolds (< 2000 bps) | 93.70 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.701 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.197 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.134 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.181 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF08241 | Methyltransf_11 | 44.09 |
PF04255 | DUF433 | 9.45 |
PF13649 | Methyltransf_25 | 9.45 |
PF00067 | p450 | 6.30 |
PF00398 | RrnaAD | 3.94 |
PF00149 | Metallophos | 3.15 |
PF00571 | CBS | 2.36 |
PF01381 | HTH_3 | 1.57 |
PF00487 | FA_desaturase | 0.79 |
PF01145 | Band_7 | 0.79 |
PF03928 | HbpS-like | 0.79 |
PF04464 | Glyphos_transf | 0.79 |
PF01066 | CDP-OH_P_transf | 0.79 |
PF12698 | ABC2_membrane_3 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 9.45 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 6.30 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 3.94 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.79 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.79 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.79 |
COG1887 | CDP-glycerol glycerophosphotransferase, TagB/SpsB family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.79 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.70 % |
Unclassified | root | N/A | 6.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002914|JGI25617J43924_10340280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300004156|Ga0062589_100004790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4836 | Open in IMG/M |
3300004479|Ga0062595_102707698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300004635|Ga0062388_100986306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300004635|Ga0062388_101138100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300004635|Ga0062388_102169160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300005166|Ga0066674_10298368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300005332|Ga0066388_101425828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
3300005434|Ga0070709_11271117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300005436|Ga0070713_101075799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300005467|Ga0070706_102004851 | Not Available | 524 | Open in IMG/M |
3300005531|Ga0070738_10444661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300005548|Ga0070665_100922905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300005556|Ga0066707_10888213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300005610|Ga0070763_10977205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 506 | Open in IMG/M |
3300006034|Ga0066656_10408844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300006052|Ga0075029_101011093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300006102|Ga0075015_100392420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300006176|Ga0070765_101311125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300006796|Ga0066665_10416158 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300006806|Ga0079220_10728644 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300006852|Ga0075433_10753137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300006854|Ga0075425_100917881 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300006954|Ga0079219_11830332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300007255|Ga0099791_10041638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
3300007788|Ga0099795_10237097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300009012|Ga0066710_104390188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300009088|Ga0099830_10503065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
3300009143|Ga0099792_10220791 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300010048|Ga0126373_12554849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 569 | Open in IMG/M |
3300010358|Ga0126370_11362807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300010361|Ga0126378_13325857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
3300010398|Ga0126383_10901054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
3300010860|Ga0126351_1238188 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300011269|Ga0137392_11198398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300012096|Ga0137389_11538778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300012189|Ga0137388_10545793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
3300012189|Ga0137388_11516525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300012189|Ga0137388_11928350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300012203|Ga0137399_11237714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300012205|Ga0137362_10875857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300012205|Ga0137362_11184328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300012210|Ga0137378_10749114 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300012211|Ga0137377_11632611 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300012361|Ga0137360_10824490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
3300012362|Ga0137361_10339992 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300012362|Ga0137361_11560295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300012363|Ga0137390_11299179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300012582|Ga0137358_10484932 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300012685|Ga0137397_10333069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300012918|Ga0137396_10187005 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300012922|Ga0137394_11480333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300012924|Ga0137413_10586097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300012929|Ga0137404_10701794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300012929|Ga0137404_11272750 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300012929|Ga0137404_11841067 | Not Available | 563 | Open in IMG/M |
3300012929|Ga0137404_11952828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300012930|Ga0137407_11783976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300012961|Ga0164302_11121860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300012971|Ga0126369_12891991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300012977|Ga0134087_10030612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2032 | Open in IMG/M |
3300014654|Ga0181525_10732218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300014969|Ga0157376_10000008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 351192 | Open in IMG/M |
3300015054|Ga0137420_1304600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300015372|Ga0132256_103517309 | Not Available | 527 | Open in IMG/M |
3300016294|Ga0182041_11621084 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300016404|Ga0182037_11699473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300017656|Ga0134112_10065012 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300017823|Ga0187818_10188250 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300017932|Ga0187814_10121343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300017955|Ga0187817_10420145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300017973|Ga0187780_11402257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 515 | Open in IMG/M |
3300018006|Ga0187804_10143393 | Not Available | 1003 | Open in IMG/M |
3300018006|Ga0187804_10582060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 508 | Open in IMG/M |
3300018047|Ga0187859_10155297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
3300018060|Ga0187765_10314892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 942 | Open in IMG/M |
3300018088|Ga0187771_11885291 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018468|Ga0066662_12796672 | Not Available | 517 | Open in IMG/M |
3300020579|Ga0210407_10387010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300020580|Ga0210403_10523275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300020581|Ga0210399_10734114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300020581|Ga0210399_10832240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300021086|Ga0179596_10696173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300021088|Ga0210404_10298138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 886 | Open in IMG/M |
3300021168|Ga0210406_10432434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
3300021168|Ga0210406_10957920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300021178|Ga0210408_10436865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
3300021181|Ga0210388_10253610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1544 | Open in IMG/M |
3300021403|Ga0210397_10182285 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300021433|Ga0210391_10387368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
3300021433|Ga0210391_10435552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300021477|Ga0210398_10429112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1077 | Open in IMG/M |
3300021479|Ga0210410_10858407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300021560|Ga0126371_10149839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2393 | Open in IMG/M |
3300021560|Ga0126371_10360773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
3300024179|Ga0247695_1010093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
3300024290|Ga0247667_1049993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300024310|Ga0247681_1070390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300025928|Ga0207700_10908800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300026217|Ga0209871_1125198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300026314|Ga0209268_1190394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 508 | Open in IMG/M |
3300026319|Ga0209647_1189044 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300026374|Ga0257146_1038954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300026537|Ga0209157_1359533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300027266|Ga0209215_1055604 | Not Available | 550 | Open in IMG/M |
3300027645|Ga0209117_1045160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
3300027671|Ga0209588_1021471 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300027671|Ga0209588_1095645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300027857|Ga0209166_10156730 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300027884|Ga0209275_10121203 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300028138|Ga0247684_1042422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300028381|Ga0268264_11382493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300031231|Ga0170824_109745044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300031231|Ga0170824_110606804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1698 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1091404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300031549|Ga0318571_10079457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
3300031754|Ga0307475_10496162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
3300031820|Ga0307473_11034572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300031823|Ga0307478_11062677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300031910|Ga0306923_10771235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
3300032059|Ga0318533_11447973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300032160|Ga0311301_12280350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300032174|Ga0307470_10212579 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300032180|Ga0307471_102491667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300032205|Ga0307472_102410904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.15% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.36% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.57% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.57% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.57% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.57% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.57% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.79% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25617J43924_103402802 | 3300002914 | Grasslands Soil | PANAAEVRDAINGLFQQLENPSSYNADQFASSLRRIRTLLH* |
Ga0062589_1000047901 | 3300004156 | Soil | GNPANAAEVRAAINGLFQQMENPSAYDADRFAAALRRIGDLLH* |
Ga0062595_1027076982 | 3300004479 | Soil | PSNAAEVRNNINGLFQQLENPSAYNADRFRAALKRIGELLR* |
Ga0062388_1009863061 | 3300004635 | Bog Forest Soil | KPANAPEVRAAINGLFQQLENPSSYNADQFASALRRMRPFFN* |
Ga0062388_1011381002 | 3300004635 | Bog Forest Soil | NAAEVRSSINGLFQQLENQSAYNADLFAESLRRIRPQLQ* |
Ga0062388_1021691602 | 3300004635 | Bog Forest Soil | NDAEIRATINALFQQLENPSAYNADQFAASLRRLRSLFP* |
Ga0066674_102983683 | 3300005166 | Soil | NAAEVRTAINGLFQQLENPSAYNADQFASALRRIRPLLQ* |
Ga0066388_1014258283 | 3300005332 | Tropical Forest Soil | AKPANDAEVRAAINGLFQQLENPSAYNADHFASALRRLRPLLR* |
Ga0070709_112711171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NATGVRDAINGLFQQMENPSAYNADRFASALKRIGDLIR* |
Ga0070713_1010757991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KPANAAEVRAAINGLFQQLELPSSYNADQFAIALRKIHELLR* |
Ga0070706_1020048512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DAMPSNAAEVRAAINGLFQQLENPSAYNANQFAAALRKIRSML* |
Ga0070738_104446611 | 3300005531 | Surface Soil | VRAAINGLFQQLQNPSSYNADQFASALRKLRSLLQ* |
Ga0070665_1009229051 | 3300005548 | Switchgrass Rhizosphere | RAAINGLFQQMENPSAYNADRFAAALKRIGDLLH* |
Ga0066707_108882132 | 3300005556 | Soil | EVRDAINGLFQQLENPSGYNADQFASSLRRIRALLH* |
Ga0070763_109772052 | 3300005610 | Soil | DAAEVRAAINALFQQLENPSAYNADQFASALRRIRPLLH* |
Ga0066656_104088442 | 3300006034 | Soil | EVRAAINQLFQQLENPSAYNADEFAFSLRRIHTLLH* |
Ga0075029_1010110932 | 3300006052 | Watersheds | SKDSKPSDAAETRAAINALFQQLENPSAYNADQFASALRRIRPLLH* |
Ga0075015_1003924201 | 3300006102 | Watersheds | NAAEVRAAINALFQQLENPSSYNADQFASALRRIRPML* |
Ga0070765_1013111252 | 3300006176 | Soil | NANEVRAAINELFQQLENPSAYNADQFASSLRKIRVLLR* |
Ga0066665_104161581 | 3300006796 | Soil | NATEVRAAINGLFQQLEMPSNYNADQFAIALRRIHELLR* |
Ga0079220_107286443 | 3300006806 | Agricultural Soil | EVKPANAAEVRAAINGLFQQLENPSAYNANQFGAALHKIRSLLQ* |
Ga0075433_107531372 | 3300006852 | Populus Rhizosphere | AEVRAAINGLFQQLENPSAYNADRFAGALKRIGELLR* |
Ga0075425_1009178813 | 3300006854 | Populus Rhizosphere | VKPANAAEVRAAINGLFQQLENPSAYNANQFGAAHHKIRSLLQ* |
Ga0079219_118303322 | 3300006954 | Agricultural Soil | RAAINELFQLLHNPSAYDADKFAAALRRLRAQLR* |
Ga0099791_100416382 | 3300007255 | Vadose Zone Soil | DAKPANAAEVRAAINGLFQQLENPSAYNADQFASALRRIRTMLR* |
Ga0099795_102370971 | 3300007788 | Vadose Zone Soil | PEVRPAINGLFQQLENPSSYNADQFASALRRIRTLLQ* |
Ga0066710_1043901883 | 3300009012 | Grasslands Soil | ANTAEVRTAINGLFQQLENPSAYNADQFASALRRIRPLLQ |
Ga0099830_105030651 | 3300009088 | Vadose Zone Soil | PANAPEVRAAINALFQQLENPSAYNADQFASSLRRIRTLLQ* |
Ga0099792_102207911 | 3300009143 | Vadose Zone Soil | DVRAAINGIFQQLENPSAYNADQFASALRKVGALIH* |
Ga0126373_125548492 | 3300010048 | Tropical Forest Soil | AEIRAAINVLFQQLEYPSAYNADQFASALRRIRPMLH* |
Ga0126370_113628072 | 3300010358 | Tropical Forest Soil | VRAAINGLFQQLENPSVYNADQFVSALRRIRPMLQ* |
Ga0126378_133258572 | 3300010361 | Tropical Forest Soil | PNDAEIRGAINQLFQQLENPSAYNADQFAAALRRIRPMLH* |
Ga0126377_132755172 | 3300010362 | Tropical Forest Soil | PNQEVKQAINALFQQLENPSAYNGRKFAAQLKRIGAVIQ* |
Ga0126383_109010541 | 3300010398 | Tropical Forest Soil | SRETKPANAAEVRTAINGLFQQLENPSAYNADQFASALRRIRALLQ* |
Ga0126351_12381881 | 3300010860 | Boreal Forest Soil | KPSNAAEVRAAINALFQQLENPSAYNADAFAAALRRLQPMLR* |
Ga0126344_13899563 | 3300010866 | Boreal Forest Soil | RAAINALFQQLENPSAYNADAFAAALRRLQPMLR* |
Ga0137392_111983982 | 3300011269 | Vadose Zone Soil | NAAEVRAAINGLFQRLENPSSYNADQFASALRRIRTVLQ* |
Ga0137389_115387782 | 3300012096 | Vadose Zone Soil | PSNAPEVRAAINRLFQQLENPSAYNEDQFASALKRIRDLLH* |
Ga0137388_105457931 | 3300012189 | Vadose Zone Soil | EVRAAINGLFQQLENPSAYNADQFASALRRIRTMVR* |
Ga0137388_115165252 | 3300012189 | Vadose Zone Soil | NVAEVRAAINALFQQLENPSSYNADQFASSLRGIRTLLH* |
Ga0137388_119283502 | 3300012189 | Vadose Zone Soil | RVAINELFQQLENPSAYNADQFASSLRRIRTLLH* |
Ga0137399_112377141 | 3300012203 | Vadose Zone Soil | NAAEVRAAINGLFQQLENPSAYNADQFASALRRIRAMLR* |
Ga0137362_108758571 | 3300012205 | Vadose Zone Soil | KPANAAEVRAAINELFQQLENPSAYNADQFASSLRRIHTLLH* |
Ga0137362_111843281 | 3300012205 | Vadose Zone Soil | NDAEVRGAINILFQQLENPSAYNADQFAAALRRIRPMLH* |
Ga0137378_107491143 | 3300012210 | Vadose Zone Soil | VEVRAAINGLFQQLENPSSYNADQFASALRRLRPLLQ* |
Ga0137377_116326112 | 3300012211 | Vadose Zone Soil | DVKPGNAADVRAAINGLFQQLEYPSAYNADQFASSLHRIGEMLR* |
Ga0137360_108244902 | 3300012361 | Vadose Zone Soil | ANPSNAAEVRAAINGLFQQLENPSAYNADQFASFLKRIKDLLH* |
Ga0137361_103399921 | 3300012362 | Vadose Zone Soil | KDAKPANAAEVRPAINGLFQQLENPSSYNADQFASALRRIRVMLQ* |
Ga0137361_115602951 | 3300012362 | Vadose Zone Soil | KDAKPANAAEVRPAINGLFQQLENPSSYNADQFASALRRIRTLLQ* |
Ga0137390_112991791 | 3300012363 | Vadose Zone Soil | RETKPANAAEVRAAINALFQQLENPSSYNADQFASSLRRIRTMLQ* |
Ga0137358_104849322 | 3300012582 | Vadose Zone Soil | KEAKPANATEVRAAINGLFQQLEMPSNYNADQFAIALRRIHELLR* |
Ga0137397_103330694 | 3300012685 | Vadose Zone Soil | ANAAEVRAAINGLFQQLENPSAYNADQFASALHRVRTMLR* |
Ga0137396_101870053 | 3300012918 | Vadose Zone Soil | VRAAINALFQQLENPSAYNADQFASALRRIRTLLQ* |
Ga0137394_114803332 | 3300012922 | Vadose Zone Soil | EVRAAINGLFQQLEVPSTYDADQFSASLRRIHDLLR* |
Ga0137413_105860971 | 3300012924 | Vadose Zone Soil | QANPPNAPEVRSAINGLFQQLENPSAYKADQFAAALKRIHDLLH* |
Ga0137404_107017942 | 3300012929 | Vadose Zone Soil | AEVRAAINGLFQQLENPSAYNADQFASALKRIHDLLH* |
Ga0137404_112727501 | 3300012929 | Vadose Zone Soil | KDTKPGNDAEIRGAINVLFQQVENPSSYNADQFAAALRRIRPMLR* |
Ga0137404_118410673 | 3300012929 | Vadose Zone Soil | AKPGNAAEVRAAINGLFQQLENPSAYNANQFTAALRKIRGMLQ* |
Ga0137404_119528281 | 3300012929 | Vadose Zone Soil | SKRANPSNAPEVRVAINGLFQQLEDPSVYNADQFAAALRRIHDLLH* |
Ga0137407_117839761 | 3300012930 | Vadose Zone Soil | EVRAAINGLFQQLENPSAYNADQFASALHRIRTMLR* |
Ga0164302_111218601 | 3300012961 | Soil | ARAAINGLFQQLENPSAYNANQFAAALRKIRGLLQ* |
Ga0126369_128919911 | 3300012971 | Tropical Forest Soil | NATEVRAAINSLFQQLEIPSSYNADQFAGSLRKIHELLR* |
Ga0134087_100306121 | 3300012977 | Grasslands Soil | AEVRAAINGLFKQLENPSAYNADQFASALRRIRSLL* |
Ga0181525_107322182 | 3300014654 | Bog | KEAQPANAAEMRSAINGLFQQLENPSAYNADVFAGALRHMRPMLQ* |
Ga0157376_10000008133 | 3300014969 | Miscanthus Rhizosphere | VRNAINGLFQQLENPSAYNADRFALALKRIGELLR* |
Ga0137420_13046001 | 3300015054 | Vadose Zone Soil | LRTPREVRAAINALFQQLENPSSYNADQFASALRRIRTLLQ* |
Ga0132256_1035173092 | 3300015372 | Arabidopsis Rhizosphere | AEVRTAINGLFQQLENPSAYNANQFAAALRKIRALLQ* |
Ga0182041_116210842 | 3300016294 | Soil | EVRAAINLLFQQLENPSAYNADQFAAGLRRIRPLLH |
Ga0182037_116994732 | 3300016404 | Soil | EVRAAINTLFQQLENSSAYNADQFASALRRIRPMLQ |
Ga0134112_100650123 | 3300017656 | Grasslands Soil | ANASEVRAAINALFQQLENPSAYNADQFASALRRIRTLLQ |
Ga0187818_101882503 | 3300017823 | Freshwater Sediment | AEVRAAINGLFQQLENPSSYNADQFASALRRIRPMLN |
Ga0187814_101213431 | 3300017932 | Freshwater Sediment | AEIRAAINGLFQQLENPSAYSADQFASALRRIRPLLQQK |
Ga0187817_104201452 | 3300017955 | Freshwater Sediment | VRAAINGLFQQLENPSSYNADQFASALRRIRPMLQ |
Ga0187780_114022571 | 3300017973 | Tropical Peatland | PANDAEVRAAINQLFQQLENPSAYNADQFAAALRRIRPMLH |
Ga0187804_101433933 | 3300018006 | Freshwater Sediment | AAEVRAAINGLFQQLENPSSYNADQFASALRRIRTMIQ |
Ga0187804_105820601 | 3300018006 | Freshwater Sediment | IRAAINGLFQQLENPSAYSADQFASALRRIRPLLQQK |
Ga0187859_101552973 | 3300018047 | Peatland | PADAAEVRAAINALFQQLENPSAYNADQFAAALRRIRPLLH |
Ga0187765_103148921 | 3300018060 | Tropical Peatland | EVRGAINGLFQQLENPSAYNADQFAAALRRIRPMLR |
Ga0187771_118852911 | 3300018088 | Tropical Peatland | NDAEIRGAINTLFQQLENPSAYNADQFAAALRRLRPLLP |
Ga0066662_127966723 | 3300018468 | Grasslands Soil | AEVRSAINLLFQQLENPSSYNANQFAGSLRRIHGILQ |
Ga0210407_103870103 | 3300020579 | Soil | KPSNADEVRAAINELFRQLENPSAYNADQFASSLRRIGPTLR |
Ga0210403_105232753 | 3300020580 | Soil | AKPANAADVRAAINALFQQLENPSSYNADQFASALRRIRTLLQ |
Ga0210399_107341142 | 3300020581 | Soil | KNAEEVRSAINGLFHQLENPSSYNADQFAAALRRLHGML |
Ga0210399_108322402 | 3300020581 | Soil | EVRAAINALFQQLENPSAYNADQFASALRRLRPLLQ |
Ga0179596_106961732 | 3300021086 | Vadose Zone Soil | EVRPAINGLFQQLENPSSYNADQFASALRRIRTLLQ |
Ga0210404_102981382 | 3300021088 | Soil | NDAEVRGAINVLFQQLENPSSYNADQFAAALRRIRPMLH |
Ga0210406_104324342 | 3300021168 | Soil | AEVRGAINALFQQLENPSSYNADQFAAALRRIRPMLR |
Ga0210406_109579201 | 3300021168 | Soil | KQAKPANSAEVRAAINALFQQLENPSAYNADQFASALRRLRPLLP |
Ga0210408_104368653 | 3300021178 | Soil | DAKPGNAAEVRGAINGLFQQVENPSSYNADQFASALRRIRVLLQ |
Ga0210388_102536103 | 3300021181 | Soil | FSKNSKPANDVEIRSAINALFQQLENPSIYNADQFAASLHRLRPLLN |
Ga0210397_101822851 | 3300021403 | Soil | PEVRAAINALFQQLENPSAYNADQFASSLRRIRTLLN |
Ga0210391_103873681 | 3300021433 | Soil | AKPGNADEVRAAINELFRQLENPSAYNADQFSVSLRRIRPMLQ |
Ga0210391_104355521 | 3300021433 | Soil | AEEVRAAINELFRQLENPSAYNADQFAASLRRIRPMLR |
Ga0210398_104291121 | 3300021477 | Soil | EIRSAINALFQQLENPSIYNADQFAASLHRLRPLLN |
Ga0210410_108584072 | 3300021479 | Soil | KPANAAEVRAAINGLFQQLENPSAYNADQFASALRKIRPLLN |
Ga0126371_101498391 | 3300021560 | Tropical Forest Soil | AEIRAPIKQLFQQLENPSAYNAGQFAAALRRIRPMLH |
Ga0126371_103607731 | 3300021560 | Tropical Forest Soil | EAEIRAAINALFQQLENPSAYNADQFAAALRRLRSLLP |
Ga0247695_10100932 | 3300024179 | Soil | AKDTKPANDAEVRGAINALFQQLENPSSYNADQFASALRRIRPMLH |
Ga0247667_10499931 | 3300024290 | Soil | NAAEVRAAINGLFQQLELPSSYNADQFAAALRRIHELLR |
Ga0247681_10703902 | 3300024310 | Soil | EVRNAINGLFQQLENPSAYHADRFATALKRIGDLF |
Ga0207700_109088001 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CKEAKPANAAEVRAAINGLFQQLELPSSYNADQFAIALRKIHELLR |
Ga0209871_11251981 | 3300026217 | Permafrost Soil | KEAKPKNADELHAAINGLFQQLENPSSYNADQFAAALRRIHGML |
Ga0209268_11903942 | 3300026314 | Soil | AEVRAAINELFQQLENPSAYNADEFASLLRRIHTLLH |
Ga0209647_11890441 | 3300026319 | Grasslands Soil | KPANATGVRAAINGLFQQLELPSNYNADQFATALRKIHELLR |
Ga0257146_10389542 | 3300026374 | Soil | NPQNAPEVRAAINGLFQQLESPSAYNADQFASALKRIHDLLH |
Ga0209157_13595331 | 3300026537 | Soil | SKQGSPGNANEVRAAINALFQQLENPSVYNADQFASALKRIRDLLH |
Ga0209215_10556042 | 3300027266 | Forest Soil | YSRETKPANAAEVRAAINGLFQQLENPSAYNADQFASALRRIRPMLQ |
Ga0209117_10451603 | 3300027645 | Forest Soil | DAKPANAAEVRAAINGLFQQLENPSAYNADQFAVALRKIRPMLQ |
Ga0209588_10214713 | 3300027671 | Vadose Zone Soil | SRDAKPANAAEVRAAINGLFQQLENPSAYNADQFASALRRIRTMVR |
Ga0209588_10956451 | 3300027671 | Vadose Zone Soil | PANAPDVRAAINALFQQLENPSAYNADQFASALRRIRTLLQ |
Ga0209166_101567303 | 3300027857 | Surface Soil | APEVRAAINGLFQQLENPSAYNADQFASALRRIHDLLH |
Ga0209275_101212033 | 3300027884 | Soil | DEVRAGINELFRQLENPSAYNADHFAASLQRIGPMLR |
Ga0247684_10424221 | 3300028138 | Soil | ANAAEVRAAINGLFQQLENPSAYNADRFAAALRRIRPMLQ |
Ga0268264_113824931 | 3300028381 | Switchgrass Rhizosphere | AEVRAAINGLFQQMENPSAYNADRFAAALKRIGDLLH |
Ga0170824_1097450442 | 3300031231 | Forest Soil | ATEVRSAINGLFQQLESPSAYHADQFASGMRRIHDLLH |
Ga0170824_1106068041 | 3300031231 | Forest Soil | VRGVINALFQQLENPSSYNADQFAVALRRIRPMLH |
(restricted) Ga0255312_10914041 | 3300031248 | Sandy Soil | EARAAINELFRQLENPSSYNADQFAAALRRIRQLLH |
Ga0318571_100794573 | 3300031549 | Soil | VRTAINGLFQQLENPSAYNANQFASALRRIRPLLQ |
Ga0307475_104961621 | 3300031754 | Hardwood Forest Soil | ADAAEVRAAINALFQQLENPSAYNADQFASALRRIRPLLH |
Ga0307473_110345721 | 3300031820 | Hardwood Forest Soil | QADPPNASQVRTAINGLFQQLENPSSYHADQFASSLKRIRDLLH |
Ga0307478_110626771 | 3300031823 | Hardwood Forest Soil | AEARSAINGLFQQLENPSAYNADEFAAALHRIRPLLP |
Ga0306923_107712352 | 3300031910 | Soil | AKEAKPPNDAEIRAVINVLFQQVENPSAYNADQFAAALRRIRPMLH |
Ga0318533_114479732 | 3300032059 | Soil | RKQGMPANDAEIRAGINRLFQQLENPSAYNADQFAAALGRLQELLR |
Ga0311301_122803501 | 3300032160 | Peatlands Soil | AKPSNAEEVRAAINELFRQLENPSSYNADQFAAALRRIRPMLR |
Ga0307470_102125791 | 3300032174 | Hardwood Forest Soil | KQANPTNAAEVREAINGLFQQMENPSAYNADRFASALKRIGDLIR |
Ga0307471_1024916671 | 3300032180 | Hardwood Forest Soil | NAAEVRAAINGLFQQLENPSAYNADQFATALRRIRTMLR |
Ga0307472_1024109042 | 3300032205 | Hardwood Forest Soil | PANAPEVRTAINGLFQQLENPSAYNADQFASALRHIRTMLR |
⦗Top⦘ |