| Basic Information | |
|---|---|
| Family ID | F065944 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGI |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.19 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.969 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.409 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.591 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.953 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 0.00% Coil/Unstructured: 84.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF01521 | Fe-S_biosyn | 4.72 |
| PF08401 | ArdcN | 3.94 |
| PF11753 | DUF3310 | 2.36 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.36 |
| PF00881 | Nitroreductase | 1.57 |
| PF08279 | HTH_11 | 0.79 |
| PF04577 | Glyco_transf_61 | 0.79 |
| PF11353 | DUF3153 | 0.79 |
| PF12800 | Fer4_4 | 0.79 |
| PF12322 | T4_baseplate | 0.79 |
| PF01832 | Glucosaminidase | 0.79 |
| PF04055 | Radical_SAM | 0.79 |
| PF00565 | SNase | 0.79 |
| PF13419 | HAD_2 | 0.79 |
| PF01467 | CTP_transf_like | 0.79 |
| PF05118 | Asp_Arg_Hydrox | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 4.72 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 4.72 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 3.94 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.97 % |
| All Organisms | root | All Organisms | 48.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10049307 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1851 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10197383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 647 | Open in IMG/M |
| 3300000137|LP_F_10_SI03_10DRAFT_c1030886 | Not Available | 801 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1019807 | Not Available | 1257 | Open in IMG/M |
| 3300001355|JGI20158J14315_10024316 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300001589|JGI24005J15628_10159753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 674 | Open in IMG/M |
| 3300005523|Ga0066865_10019964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2181 | Open in IMG/M |
| 3300005523|Ga0066865_10368141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 545 | Open in IMG/M |
| 3300005747|Ga0076924_1124603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 847 | Open in IMG/M |
| 3300005747|Ga0076924_1168734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 631 | Open in IMG/M |
| 3300005931|Ga0075119_1079861 | Not Available | 747 | Open in IMG/M |
| 3300006029|Ga0075466_1091134 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006190|Ga0075446_10111624 | Not Available | 795 | Open in IMG/M |
| 3300006191|Ga0075447_10080684 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300006191|Ga0075447_10129249 | Not Available | 858 | Open in IMG/M |
| 3300006399|Ga0075495_1561505 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 649 | Open in IMG/M |
| 3300006916|Ga0070750_10073786 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300007074|Ga0075110_1048319 | Not Available | 1014 | Open in IMG/M |
| 3300007074|Ga0075110_1054858 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 929 | Open in IMG/M |
| 3300007229|Ga0075468_10177140 | Not Available | 632 | Open in IMG/M |
| 3300007276|Ga0070747_1084372 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300007276|Ga0070747_1300071 | Not Available | 552 | Open in IMG/M |
| 3300007647|Ga0102855_1207262 | Not Available | 523 | Open in IMG/M |
| 3300007778|Ga0102954_1184315 | Not Available | 608 | Open in IMG/M |
| 3300009000|Ga0102960_1340644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 529 | Open in IMG/M |
| 3300009058|Ga0102854_1181139 | Not Available | 603 | Open in IMG/M |
| 3300009071|Ga0115566_10715670 | Not Available | 554 | Open in IMG/M |
| 3300009420|Ga0114994_10345979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 987 | Open in IMG/M |
| 3300009420|Ga0114994_11064848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 522 | Open in IMG/M |
| 3300009436|Ga0115008_10683846 | Not Available | 744 | Open in IMG/M |
| 3300009437|Ga0115556_1074643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1335 | Open in IMG/M |
| 3300009437|Ga0115556_1179094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 771 | Open in IMG/M |
| 3300009495|Ga0115571_1055187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1826 | Open in IMG/M |
| 3300009505|Ga0115564_10184404 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300009507|Ga0115572_10081775 | All Organisms → Viruses → Predicted Viral | 1967 | Open in IMG/M |
| 3300009512|Ga0115003_10825702 | Not Available | 538 | Open in IMG/M |
| 3300009526|Ga0115004_10939161 | Not Available | 517 | Open in IMG/M |
| 3300009544|Ga0115006_10471241 | Not Available | 1100 | Open in IMG/M |
| 3300009544|Ga0115006_11878797 | Not Available | 549 | Open in IMG/M |
| 3300009705|Ga0115000_10481607 | Not Available | 783 | Open in IMG/M |
| 3300009706|Ga0115002_10899715 | Not Available | 612 | Open in IMG/M |
| 3300009785|Ga0115001_10394296 | Not Available | 866 | Open in IMG/M |
| 3300009786|Ga0114999_10463693 | Not Available | 984 | Open in IMG/M |
| 3300010148|Ga0098043_1095372 | Not Available | 872 | Open in IMG/M |
| 3300010148|Ga0098043_1096801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 864 | Open in IMG/M |
| 3300011128|Ga0151669_106992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 884 | Open in IMG/M |
| 3300011252|Ga0151674_1012144 | Not Available | 712 | Open in IMG/M |
| 3300011258|Ga0151677_1043281 | Not Available | 941 | Open in IMG/M |
| 3300012953|Ga0163179_10110974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1997 | Open in IMG/M |
| 3300012953|Ga0163179_10212809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1486 | Open in IMG/M |
| 3300013010|Ga0129327_10670038 | Not Available | 578 | Open in IMG/M |
| 3300017709|Ga0181387_1000299 | Not Available | 11643 | Open in IMG/M |
| 3300017710|Ga0181403_1005105 | All Organisms → Viruses → Predicted Viral | 2870 | Open in IMG/M |
| 3300017714|Ga0181412_1016156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2150 | Open in IMG/M |
| 3300017727|Ga0181401_1029657 | Not Available | 1579 | Open in IMG/M |
| 3300017729|Ga0181396_1011941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1733 | Open in IMG/M |
| 3300017733|Ga0181426_1007667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2123 | Open in IMG/M |
| 3300017737|Ga0187218_1010540 | All Organisms → Viruses → Predicted Viral | 2492 | Open in IMG/M |
| 3300017741|Ga0181421_1201326 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 509 | Open in IMG/M |
| 3300017744|Ga0181397_1138518 | Not Available | 626 | Open in IMG/M |
| 3300017746|Ga0181389_1181687 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 549 | Open in IMG/M |
| 3300017752|Ga0181400_1006624 | All Organisms → cellular organisms → Bacteria | 4210 | Open in IMG/M |
| 3300017755|Ga0181411_1070662 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300017758|Ga0181409_1183844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 606 | Open in IMG/M |
| 3300017762|Ga0181422_1115774 | Not Available | 832 | Open in IMG/M |
| 3300017763|Ga0181410_1189557 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 567 | Open in IMG/M |
| 3300017782|Ga0181380_1258511 | Not Available | 576 | Open in IMG/M |
| 3300020175|Ga0206124_10115777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 | 1101 | Open in IMG/M |
| 3300020382|Ga0211686_10395095 | Not Available | 560 | Open in IMG/M |
| 3300020388|Ga0211678_10057405 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300020438|Ga0211576_10303421 | Not Available | 829 | Open in IMG/M |
| 3300021185|Ga0206682_10060110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2023 | Open in IMG/M |
| 3300021958|Ga0222718_10106287 | Not Available | 1646 | Open in IMG/M |
| 3300022843|Ga0222631_1001268 | Not Available | 6244 | Open in IMG/M |
| 3300022853|Ga0222652_1029462 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 870 | Open in IMG/M |
| 3300023501|Ga0222686_1034734 | Not Available | 707 | Open in IMG/M |
| 3300024235|Ga0228665_1078140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 682 | Open in IMG/M |
| 3300024248|Ga0228676_1093139 | Not Available | 659 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10067615 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300024297|Ga0228658_1124983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 625 | Open in IMG/M |
| 3300024428|Ga0233396_1047427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1200 | Open in IMG/M |
| 3300025138|Ga0209634_1106464 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300025138|Ga0209634_1170316 | Not Available | 866 | Open in IMG/M |
| 3300025138|Ga0209634_1185866 | Not Available | 810 | Open in IMG/M |
| 3300025138|Ga0209634_1187614 | Not Available | 804 | Open in IMG/M |
| 3300025138|Ga0209634_1256754 | Not Available | 629 | Open in IMG/M |
| 3300025138|Ga0209634_1273702 | Not Available | 597 | Open in IMG/M |
| 3300025168|Ga0209337_1188105 | Not Available | 853 | Open in IMG/M |
| 3300025168|Ga0209337_1220368 | Not Available | 753 | Open in IMG/M |
| 3300025168|Ga0209337_1278109 | Not Available | 622 | Open in IMG/M |
| 3300025438|Ga0208770_1069705 | Not Available | 640 | Open in IMG/M |
| 3300025645|Ga0208643_1065401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1072 | Open in IMG/M |
| 3300025685|Ga0209095_1110311 | Not Available | 850 | Open in IMG/M |
| 3300025704|Ga0209602_1116467 | Not Available | 913 | Open in IMG/M |
| 3300025822|Ga0209714_1068108 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300025849|Ga0209603_1141250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 995 | Open in IMG/M |
| 3300025897|Ga0209425_10239514 | Not Available | 942 | Open in IMG/M |
| 3300026138|Ga0209951_1052014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 877 | Open in IMG/M |
| 3300026183|Ga0209932_1010378 | Not Available | 2545 | Open in IMG/M |
| 3300026270|Ga0207993_1061712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1050 | Open in IMG/M |
| 3300027077|Ga0208941_1000159 | Not Available | 21812 | Open in IMG/M |
| 3300027298|Ga0208970_1000200 | Not Available | 21817 | Open in IMG/M |
| 3300027298|Ga0208970_1001982 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 5273 | Open in IMG/M |
| 3300027668|Ga0209482_1071988 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300027672|Ga0209383_1163267 | Not Available | 680 | Open in IMG/M |
| 3300027704|Ga0209816_1173565 | Not Available | 743 | Open in IMG/M |
| 3300027788|Ga0209711_10405905 | Not Available | 557 | Open in IMG/M |
| 3300027813|Ga0209090_10204993 | Not Available | 1015 | Open in IMG/M |
| 3300027827|Ga0209035_10579608 | Not Available | 537 | Open in IMG/M |
| 3300027847|Ga0209402_10354405 | Not Available | 898 | Open in IMG/M |
| 3300028196|Ga0257114_1204281 | Not Available | 727 | Open in IMG/M |
| 3300030723|Ga0308129_1039562 | Not Available | 517 | Open in IMG/M |
| 3300031142|Ga0308022_1049528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1310 | Open in IMG/M |
| 3300031143|Ga0308025_1097183 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300031510|Ga0308010_1256835 | Not Available | 612 | Open in IMG/M |
| 3300031519|Ga0307488_10527447 | Not Available | 699 | Open in IMG/M |
| 3300031519|Ga0307488_10533887 | Not Available | 693 | Open in IMG/M |
| 3300031519|Ga0307488_10562822 | Not Available | 668 | Open in IMG/M |
| 3300031519|Ga0307488_10571325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 661 | Open in IMG/M |
| 3300031519|Ga0307488_10572767 | Not Available | 660 | Open in IMG/M |
| 3300031644|Ga0308001_10328978 | Not Available | 567 | Open in IMG/M |
| 3300031695|Ga0308016_10075417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1395 | Open in IMG/M |
| 3300031721|Ga0308013_10350684 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 508 | Open in IMG/M |
| 3300031773|Ga0315332_10852063 | Not Available | 550 | Open in IMG/M |
| 3300031774|Ga0315331_10247621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1318 | Open in IMG/M |
| 3300032011|Ga0315316_10014646 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 5960 | Open in IMG/M |
| 3300032047|Ga0315330_10149244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1532 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.41% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.60% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.09% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.30% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.51% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.15% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.15% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 3.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.36% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.36% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.36% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.57% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.57% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.57% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.79% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300023501 | Saline water microbial communities from Ace Lake, Antarctica - #1159 | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300030723 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100493071 | 3300000116 | Marine | KFDVSIHKQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| DelMOSpr2010_101973831 | 3300000116 | Marine | NRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| LP_F_10_SI03_10DRAFT_10308861 | 3300000137 | Marine | EQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| LP_A_09_P04_10DRAFT_10198071 | 3300000265 | Marine | NLKKTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVVQ* |
| JGI20158J14315_100243168 | 3300001355 | Pelagic Marine | ANNLKKTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGL* |
| JGI24005J15628_101597534 | 3300001589 | Marine | FDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGI* |
| Ga0066865_100199645 | 3300005523 | Marine | LALQTFFDNRKKNDCVVKMSGPMGADDEYAYDFVPVVDYRLEGMGI* |
| Ga0066865_103681411 | 3300005523 | Marine | LQTFFDNRKKNDCVVKMSGPMGADDEYAYDFVPVVDFRLEGMGI* |
| Ga0076924_11246031 | 3300005747 | Marine | TLQTFFDKRKVNDCNVQMSGTLPDNEYAYDFVPVVDFRHDGIGI* |
| Ga0076924_11687341 | 3300005747 | Marine | TLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGI* |
| Ga0075119_10798611 | 3300005931 | Saline Lake | FDKRKVNDCNVQMSGTLPDNEYAYDFHPIVDFRMEGIL* |
| Ga0075466_10911341 | 3300006029 | Aqueous | FDKRKVNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0075446_101116243 | 3300006190 | Marine | TLQTFFDKRKVNDCLVEMSGTLPDNEYAYDFKPIVDFRMEGIL* |
| Ga0075447_100806841 | 3300006191 | Marine | RKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGI* |
| Ga0075447_101292492 | 3300006191 | Marine | NTLKTTLQTFFDKKKVNDCNVEMSGTLPDNEYAYDFKPIVDFRMEGII* |
| Ga0075495_15615051 | 3300006399 | Aqueous | FDNRKKNDCHVQMSGALPDNEYAYDFVPVVDFRHEGVGI* |
| Ga0070750_100737864 | 3300006916 | Aqueous | RKKNDCNVQMSGPLGTEEEYAYDFVPVVDFRLNGIGI* |
| Ga0075110_10483191 | 3300007074 | Saline Lake | KTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGI* |
| Ga0075110_10548581 | 3300007074 | Saline Lake | TLKTTLQTFFDKRKVNDCLVEMSGTLPDNEYAYDFKPIVDFRMEGIL* |
| Ga0075468_101771401 | 3300007229 | Aqueous | IHKQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0070747_10843725 | 3300007276 | Aqueous | FDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0070747_13000711 | 3300007276 | Aqueous | QTFFDNRKKNDCPVQMSGTSPDNEYSYDFMPIVDFRHNGAIL* |
| Ga0102855_12072623 | 3300007647 | Estuarine | DNRKKNDCNVQMSGPLGTEEEYAYDFVPVVDFRLDGIGI* |
| Ga0102954_11843151 | 3300007778 | Water | NNLKKTLQTFFDNRKVNDCNVQMSGTLPDNEYAYDFVAVVDYRLDGIGI* |
| Ga0102960_13406442 | 3300009000 | Pond Water | EQMATNLKKTLQTFFDKRKVNDCNVQMSGTLPDNEYAYDFVPVVDYRLDGIGI* |
| Ga0102854_11811391 | 3300009058 | Estuarine | NLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0115566_107156703 | 3300009071 | Pelagic Marine | FDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGL* |
| Ga0114994_103459791 | 3300009420 | Marine | KTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFHPIVDFRTEGVGI* |
| Ga0114994_110648481 | 3300009420 | Marine | VSIHEQMAKNLKTTLQTFFDKRKVNDCNVQMSGTLPDNEYAYDFVPVVDYRLDGIGI* |
| Ga0115008_106838461 | 3300009436 | Marine | NRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0115556_10746431 | 3300009437 | Pelagic Marine | FDKRKVNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0115556_11790941 | 3300009437 | Pelagic Marine | KNLKTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0115571_10551871 | 3300009495 | Pelagic Marine | VNDCNVQMSGTLPDNEYAYDFVPVVDFRLNGMGI* |
| Ga0115564_101844041 | 3300009505 | Pelagic Marine | RKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0115572_100817751 | 3300009507 | Pelagic Marine | KTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0115003_108257021 | 3300009512 | Marine | TLQTFFDNRKVNDCYVQMSGTLPDNEYAYDFMPIVDYRMEGIL* |
| Ga0115004_109391611 | 3300009526 | Marine | NLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVVI* |
| Ga0115006_104712411 | 3300009544 | Marine | NLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0115006_118787971 | 3300009544 | Marine | QTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0115000_104816074 | 3300009705 | Marine | LKTTLQTFFDKRKVNDCNVKMSGTLPDNEYAYDFVPVIDYRFEGVGV* |
| Ga0115002_108997152 | 3300009706 | Marine | QMAKNLKTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0115001_103942961 | 3300009785 | Marine | NLKTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFHPIVDFRTEGVGI* |
| Ga0114999_104636933 | 3300009786 | Marine | FDNRKKHDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI* |
| Ga0098043_10953722 | 3300010148 | Marine | DNRKKNDCVVKMSGPMGADDEYAYDFVPVVDYRLEGMGI* |
| Ga0098043_10968011 | 3300010148 | Marine | NRKKNDCVVKMSGPMGADDEYAYDFQPVVDFRLEGMGI* |
| Ga0151669_1069921 | 3300011128 | Marine | QTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0151674_10121443 | 3300011252 | Marine | TTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRT* |
| Ga0151677_10432814 | 3300011258 | Marine | RKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0163179_101109745 | 3300012953 | Seawater | LKLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI* |
| Ga0163179_102128092 | 3300012953 | Seawater | LKLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGI* |
| Ga0129327_106700381 | 3300013010 | Freshwater To Marine Saline Gradient | TLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV* |
| Ga0181387_100029918 | 3300017709 | Seawater | LALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0181403_10051054 | 3300017710 | Seawater | LKLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181412_10161565 | 3300017714 | Seawater | LQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0181401_10296571 | 3300017727 | Seawater | RKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0181396_10119411 | 3300017729 | Seawater | DNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0181426_10076675 | 3300017733 | Seawater | KNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0187218_10105401 | 3300017737 | Seawater | TFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181421_12013261 | 3300017741 | Seawater | DNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181397_11385182 | 3300017744 | Seawater | DNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0181389_11816871 | 3300017746 | Seawater | QTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181400_10066246 | 3300017752 | Seawater | DSLKLALQTFFDNKKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181411_10706623 | 3300017755 | Seawater | FDNRKKNDCHVQMSGALPDNEYAYDFMPIVDFRHEGIGL |
| Ga0181409_11838442 | 3300017758 | Seawater | LQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0181422_11157744 | 3300017762 | Seawater | FSVSIHEQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0181410_11895571 | 3300017763 | Seawater | HQQMADSLKLALQTFFDNKKKNDCVVKMSGPMGADEEYAYDFVPVVDFRHEGIGL |
| Ga0181380_12585113 | 3300017782 | Seawater | FDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0206124_101157774 | 3300020175 | Seawater | RKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGL |
| Ga0211686_103950951 | 3300020382 | Marine | RKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGV |
| Ga0211678_100574054 | 3300020388 | Marine | DSLKLALQTFFDNRKKNDCFVKMSGPMGADEEYAYDFVPVVDFRHEGIGI |
| Ga0211576_103034214 | 3300020438 | Marine | EQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0206682_100601101 | 3300021185 | Seawater | ALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0222718_101062871 | 3300021958 | Estuarine Water | SVHKQMADNLKTTLQTFFDNRKKNDCNVQMSGPMGEEEEYAYDFVPVIDFRHDGIGI |
| Ga0222631_100126813 | 3300022843 | Saline Water | RKVNDCNVQMSGTLPDNEYAYDFHPIVDFRMEGIL |
| Ga0222652_10294621 | 3300022853 | Saline Water | DKRKVNDCNVQMSGTLPDNEYAYDFHPIVDFRMEGIL |
| Ga0222686_10347343 | 3300023501 | Saline Water | LQTFFDNRKKNDCMVKMSGTLPDNEYAYDFHPIVDFRMEGVGI |
| Ga0228665_10781401 | 3300024235 | Seawater | KLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0228676_10931392 | 3300024248 | Seawater | QTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| (restricted) Ga0233438_100676157 | 3300024255 | Seawater | LEQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0228658_11249832 | 3300024297 | Seawater | FFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0233396_10474271 | 3300024428 | Seawater | TFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0209634_11064641 | 3300025138 | Marine | KKTLQTFFDNRKKNDCHVQMSGALPDNEYAYDFMPIVDFRHEGIGL |
| Ga0209634_11703161 | 3300025138 | Marine | NLKTTLQTFFDKRKVNDCNVKMSGTLPDNEYAYDFVPVIDYRFEGVGV |
| Ga0209634_11858664 | 3300025138 | Marine | MAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209634_11876141 | 3300025138 | Marine | SIHEQMAKNLKTTLQTFFDKRKVNDCYVQMSGRLPDNEYAYDFHPIVDFRTEGVGI |
| Ga0209634_12567543 | 3300025138 | Marine | FFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRTEGVGI |
| Ga0209634_12737023 | 3300025138 | Marine | NRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209337_11881051 | 3300025168 | Marine | TTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209337_12203684 | 3300025168 | Marine | AFFDKKKVNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209337_12781094 | 3300025168 | Marine | KRKVNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0208770_10697053 | 3300025438 | Saline Lake | KRKVNDCLVKMSGTLPDNEYAYDFHPIVDFRTEGVGI |
| Ga0208643_10654015 | 3300025645 | Aqueous | FFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209095_11103114 | 3300025685 | Pelagic Marine | IHEQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209602_11164676 | 3300025704 | Pelagic Marine | FDKRKVNDCNVQMSGTLPDNEYAYDFVPVVDYRLDGIGI |
| Ga0209714_10681081 | 3300025822 | Pelagic Marine | TTLQTFFDNRKKNDCHVQMSGALPDNEYAYDFVPVVDFRHEGVGI |
| Ga0209603_11412505 | 3300025849 | Pelagic Marine | LQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209425_102395141 | 3300025897 | Pelagic Marine | KTLQTFFDNRKKNDCHVQMSGALPDNEYAYDFMPIVDYRHYGVGV |
| Ga0209951_10520141 | 3300026138 | Pond Water | QMADSLKLALQTFFDNRKKNDCVVKMSGPMGEDEEYAYDFVPVVDFRLEGMGI |
| Ga0209932_10103786 | 3300026183 | Pond Water | TFFYKRKKNDCNVKMSGPLGKEQEYAYDFVPVVDFRLNGMGI |
| Ga0207993_10617121 | 3300026270 | Marine | LALQTFFDNRKKNDCVVKMSGPMGADDEYAYDFVPVVDYRLEGMGI |
| Ga0208941_100015929 | 3300027077 | Marine | KKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0208970_10002001 | 3300027298 | Marine | NRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLEGMGI |
| Ga0208970_10019821 | 3300027298 | Marine | NRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0209482_10719881 | 3300027668 | Marine | LKTTLQTFFDKRKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGI |
| Ga0209383_11632671 | 3300027672 | Marine | MANTLKTTLQTFFDKKKVNDCNVEMSGTLPDNEYAYDFKPIVDFRMEGII |
| Ga0209816_11735652 | 3300027704 | Marine | NTLKTTLQTFFDKKKVNDCNVEMSGTLPDNEYAYDFKPIVDFRMEGII |
| Ga0209711_104059053 | 3300027788 | Marine | TLQTFFDKRKVNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0209090_102049932 | 3300027813 | Marine | MAKNLKTTLQTFFDKRKVNDCHVQMSGTLPDNEYAYDFMPIVDYRMEGIL |
| Ga0209035_105796081 | 3300027827 | Marine | VSIHEQMAKNLKTTLQTFFDKRKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGV |
| Ga0209402_103544051 | 3300027847 | Marine | TLQTFFDKRKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHNGVGV |
| Ga0257114_12042811 | 3300028196 | Marine | SIHEQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0308129_10395621 | 3300030723 | Marine | LKTSLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0308022_10495281 | 3300031142 | Marine | KNLKTTLQTFFDNKKKNDCHVQMSGTLPDNEYAYDFHPIVDFRHEGVGI |
| Ga0308025_10971831 | 3300031143 | Marine | NLKTTLQTFFDKRKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGI |
| Ga0308010_12568351 | 3300031510 | Marine | TLQTFFDKRKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGV |
| Ga0307488_105274471 | 3300031519 | Sackhole Brine | LKTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0307488_105338874 | 3300031519 | Sackhole Brine | IHEQMAKNLKTTLQTFFDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0307488_105628224 | 3300031519 | Sackhole Brine | KKNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0307488_105713251 | 3300031519 | Sackhole Brine | NLKKTLQTFFDKRKVNDCNVQMSGTLPDNEYAYDFVPVVDYRLDGIGI |
| Ga0307488_105727671 | 3300031519 | Sackhole Brine | FDKRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0308001_103289782 | 3300031644 | Marine | RKVNDCYVKMSGTLPDNEYAYDFHPIVDFRHEGVGI |
| Ga0308016_100754176 | 3300031695 | Marine | VSIHEQMATNLKKTLQTFFDNAKPNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0308013_103506841 | 3300031721 | Marine | SIHEQMATNLKKTLQTFFDNRKVNDCYVQMSGTLPDNEYAYDFMPIVDFRHNGVGV |
| Ga0315332_108520631 | 3300031773 | Seawater | RKVNDCIVKMSGPMGADEEYAYDFVPVVDFRLDGIGI |
| Ga0315331_102476211 | 3300031774 | Seawater | KLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0315316_1001464611 | 3300032011 | Seawater | LALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI |
| Ga0315330_101492441 | 3300032047 | Seawater | QTFFDNRKKNDCNVQMSGPLGTEEEYAYDFVPVVDFRLDGIGI |
| ⦗Top⦘ |