NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065926

Metagenome / Metatranscriptome Family F065926

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065926
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 53 residues
Representative Sequence WSGRRLVLFVDVANVLNRTNLRNASYSVDRFGRVFETTESLMPIVPSGGFVFEF
Number of Associated Samples 103
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.79 %
% of genes near scaffold ends (potentially truncated) 99.21 %
% of genes from short scaffolds (< 2000 bps) 95.28 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.976 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.598 % of family members)
Environment Ontology (ENVO) Unclassified
(39.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.630 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.95%    Coil/Unstructured: 78.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF13740ACT_6 6.30
PF07690MFS_1 3.94
PF01028Topoisom_I 3.15
PF00903Glyoxalase 2.36
PF13620CarboxypepD_reg 2.36
PF03972MmgE_PrpD 1.57
PF02738MoCoBD_1 1.57
PF00593TonB_dep_Rec 1.57
PF00076RRM_1 1.57
PF12543DUF3738 1.57
PF01842ACT 1.57
PF104171-cysPrx_C 0.79
PF12034DUF3520 0.79
PF02874ATP-synt_ab_N 0.79
PF13291ACT_4 0.79
PF02687FtsX 0.79
PF01699Na_Ca_ex 0.79
PF00753Lactamase_B 0.79
PF01345DUF11 0.79
PF12681Glyoxalase_2 0.79
PF14013MT0933_antitox 0.79
PF00005ABC_tran 0.79
PF00375SDF 0.79
PF13602ADH_zinc_N_2 0.79
PF04055Radical_SAM 0.79
PF01979Amidohydro_1 0.79
PF03795YCII 0.79
PF13637Ank_4 0.79
PF01436NHL 0.79
PF02627CMD 0.79
PF08811DUF1800 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 3.15
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 1.57
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.79
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.79
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.79
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.79
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.79
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.76 %
UnclassifiedrootN/A10.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_125951765Not Available645Open in IMG/M
3300002459|JGI24751J29686_10127565All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300003267|soilL1_10218802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1109Open in IMG/M
3300004156|Ga0062589_100867210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300004156|Ga0062589_101460861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300004479|Ga0062595_102358263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300004480|Ga0062592_101079569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium741Open in IMG/M
3300005093|Ga0062594_101423210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300005093|Ga0062594_101761915All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300005294|Ga0065705_10543618All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300005329|Ga0070683_100891159Not Available853Open in IMG/M
3300005330|Ga0070690_100289754All Organisms → cellular organisms → Bacteria → Proteobacteria1170Open in IMG/M
3300005333|Ga0070677_10108134All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1237Open in IMG/M
3300005333|Ga0070677_10918407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae507Open in IMG/M
3300005335|Ga0070666_10441010All Organisms → cellular organisms → Bacteria → Proteobacteria939Open in IMG/M
3300005338|Ga0068868_100666106All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300005338|Ga0068868_100672912All Organisms → cellular organisms → Bacteria → Proteobacteria923Open in IMG/M
3300005344|Ga0070661_100137449All Organisms → cellular organisms → Bacteria → Proteobacteria1840Open in IMG/M
3300005347|Ga0070668_100418550All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300005347|Ga0070668_101513571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300005364|Ga0070673_101665464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300005441|Ga0070700_100243788All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300005444|Ga0070694_100416391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300005544|Ga0070686_100164750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis1563Open in IMG/M
3300005544|Ga0070686_101607695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300005563|Ga0068855_101903991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300005578|Ga0068854_101182238All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300005713|Ga0066905_102102247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300005719|Ga0068861_100488022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1111Open in IMG/M
3300005719|Ga0068861_101838327Not Available601Open in IMG/M
3300005840|Ga0068870_11290820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300005843|Ga0068860_100842305All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300005843|Ga0068860_101169711All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300006058|Ga0075432_10020748All Organisms → cellular organisms → Bacteria → Proteobacteria2246Open in IMG/M
3300006196|Ga0075422_10004723All Organisms → cellular organisms → Bacteria → Proteobacteria4249Open in IMG/M
3300006755|Ga0079222_10512180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300006845|Ga0075421_100577581All Organisms → cellular organisms → Bacteria → Acidobacteria1324Open in IMG/M
3300006846|Ga0075430_100658915Not Available863Open in IMG/M
3300006853|Ga0075420_101387117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300006880|Ga0075429_100253545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1541Open in IMG/M
3300006880|Ga0075429_101192816All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300006881|Ga0068865_100900326All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300006894|Ga0079215_11024263All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300006918|Ga0079216_11536131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300006954|Ga0079219_10753297All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium754Open in IMG/M
3300007004|Ga0079218_10257847Not Available1382Open in IMG/M
3300007004|Ga0079218_10504170All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300009094|Ga0111539_10572626All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300009094|Ga0111539_12938067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300009100|Ga0075418_10763800All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300009100|Ga0075418_11444995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300009156|Ga0111538_10779596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1211Open in IMG/M
3300009156|Ga0111538_13509810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300009176|Ga0105242_12358477All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300009807|Ga0105061_1068103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300010362|Ga0126377_12041973All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300010397|Ga0134124_12996170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300010400|Ga0134122_12502319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300010403|Ga0134123_10818071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300011332|Ga0126317_10888194All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300011332|Ga0126317_10907648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300011333|Ga0127502_11122262All Organisms → cellular organisms → Bacteria → Proteobacteria2202Open in IMG/M
3300011423|Ga0137436_1099249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis767Open in IMG/M
3300011432|Ga0137428_1254873All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300011445|Ga0137427_10172766All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300012231|Ga0137465_1096683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis885Open in IMG/M
3300012509|Ga0157334_1008185All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300012899|Ga0157299_10157446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300012902|Ga0157291_10105633All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium774Open in IMG/M
3300012903|Ga0157289_10335793All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300012913|Ga0157298_10170876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis670Open in IMG/M
3300012948|Ga0126375_11130012Not Available647Open in IMG/M
3300012960|Ga0164301_10886666All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300013308|Ga0157375_10389379Not Available1561Open in IMG/M
3300013308|Ga0157375_13516032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300014326|Ga0157380_10410774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis1287Open in IMG/M
3300014326|Ga0157380_12350726Not Available598Open in IMG/M
3300014745|Ga0157377_10888205All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300015077|Ga0173483_10670300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300015371|Ga0132258_10265972All Organisms → cellular organisms → Bacteria4200Open in IMG/M
3300015372|Ga0132256_100101534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2802Open in IMG/M
3300015372|Ga0132256_102990365Not Available568Open in IMG/M
3300015373|Ga0132257_100342171All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.1806Open in IMG/M
3300018469|Ga0190270_10740327All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300018469|Ga0190270_11268395Not Available778Open in IMG/M
3300018476|Ga0190274_13703960All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300018481|Ga0190271_10199296All Organisms → cellular organisms → Bacteria → Acidobacteria1991Open in IMG/M
3300018481|Ga0190271_10810885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1060Open in IMG/M
3300025893|Ga0207682_10392849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium655Open in IMG/M
3300025893|Ga0207682_10527907All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300025920|Ga0207649_10293406All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300025930|Ga0207701_10499120All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300025930|Ga0207701_11332605All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300025933|Ga0207706_10235796All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300025934|Ga0207686_11780327All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300025937|Ga0207669_11540257All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300025940|Ga0207691_10227346Not Available1616Open in IMG/M
3300025949|Ga0207667_11614138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300025960|Ga0207651_12012039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300025961|Ga0207712_11089892All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300026075|Ga0207708_10228612All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300026075|Ga0207708_11800278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300026088|Ga0207641_10075407All Organisms → cellular organisms → Bacteria2912Open in IMG/M
3300026118|Ga0207675_101760775All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300026121|Ga0207683_11338028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis663Open in IMG/M
3300026121|Ga0207683_11652113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300027462|Ga0210000_1084880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300027526|Ga0209968_1025647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300027614|Ga0209970_1019933Not Available1131Open in IMG/M
3300027639|Ga0209387_1152726All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300028380|Ga0268265_11551562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300028381|Ga0268264_10926433All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300031170|Ga0307498_10096850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis901Open in IMG/M
3300031740|Ga0307468_101852880All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031824|Ga0307413_11962465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis527Open in IMG/M
3300031858|Ga0310892_11116703All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031940|Ga0310901_10389117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300031995|Ga0307409_102495418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis546Open in IMG/M
3300032000|Ga0310903_10740252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300032003|Ga0310897_10525589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis577Open in IMG/M
3300032017|Ga0310899_10352675All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300032075|Ga0310890_10158158All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300032157|Ga0315912_10138937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1904Open in IMG/M
3300032157|Ga0315912_10467977All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300032179|Ga0310889_10173635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes nipponensis980Open in IMG/M
3300032421|Ga0310812_10302992Not Available710Open in IMG/M
3300034690|Ga0364923_0025780All Organisms → cellular organisms → Bacteria → Proteobacteria1336Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.30%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.72%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.36%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.79%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.79%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_12595176513300000956SoilADRVFHWSGTRLILFAEVANVLNRRNLRSTPYGVDRLGRVVDTTESLMPIVPSAGFVVEF
JGI24751J29686_1012756513300002459Corn, Switchgrass And Miscanthus RhizosphereAYSRLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNASYSVDRFGRVFETTESLMPIVPSGGFVFEF*
soilL1_1021880213300003267Sugarcane Root And Bulk SoilNWSGRRLVAFVEVANILNRSNLRNTSYFVDRAGRVFETTESLMPIVPSGGLVIEF*
Ga0062589_10086721023300004156SoilADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSVDRAGRVFETTESLMPIVPSGGLVFEF
Ga0062589_10146086113300004156SoilRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0062595_10235826323300004479SoilAYARLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0062592_10107956913300004480SoilLNHENLRNTSPGIDRAGRVFDATESLLPIVPSGGLVIEF*
Ga0062594_10142321023300005093SoilLDVRADRAFTWSGRRFVLFLDVANVLNRTNERNASYSVDRAGRVFETTESLMPIVPSGGFVVEF*
Ga0062594_10176191513300005093SoilAYSRLDVRADRAFTWSGRRLVVFVDVANVLNQTNLRNAGYSVDRAGRIFETTESLMPIVPSGGLVIEF*
Ga0065705_1054361813300005294Switchgrass RhizosphereLPAYSRLDVRADRAFNWSGRRLVLFIDVANVLNHTNERNASYFVDRGGRVFETTESLLPIVPSGGFVIEF*
Ga0070683_10089115913300005329Corn RhizosphereLRADRAFNWSSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0070690_10028975433300005330Switchgrass RhizosphereFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0070677_1010813423300005333Miscanthus RhizosphereVLNHENLRNTSPGIDRAGRVFDATESLLPIVPSGGLVIEF*
Ga0070677_1091840723300005333Miscanthus RhizosphereADRAFNWSSRRLVVFVDVANVLNRQNVRNTSYTIDRAGRVFDTTGSLLPIVPSGGVVVEF
Ga0070666_1044101033300005335Switchgrass RhizosphereVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0068868_10066610623300005338Miscanthus RhizosphereTERNILRLPPYARLDVRADRAFNWSSRRLVVFVDVANVLNRQNLRNTSYSIDRAGRVFDTTGSLLPIVPSGGLVVEF*
Ga0068868_10067291213300005338Miscanthus RhizosphereNIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0070661_10013744933300005344Corn RhizosphereFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0070668_10041855013300005347Switchgrass RhizosphereRLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNASYSIDRFGRVFETTESLMPIVPSGGFVFEF*
Ga0070668_10151357113300005347Switchgrass RhizosphereIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0070673_10166546413300005364Switchgrass RhizosphereLLRLPPYSRLDVRADRAFTWSSRRLVAFVDIANVLNRRNVRNTSYAIDGAGRVLGRGGSLLPFIPSGGLVVEF*
Ga0070700_10024378813300005441Corn, Switchgrass And Miscanthus RhizosphereVLFVEVANVLNRSNLRNTNYSVDRAGRVFDTTESMIPIVPSGGFVIEF*
Ga0070694_10041639113300005444Corn, Switchgrass And Miscanthus RhizosphereDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0070686_10016475023300005544Switchgrass RhizosphereDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNASYSIDRFGRVFETTESLMPIVPSGGFVFEF*
Ga0070686_10160769523300005544Switchgrass RhizosphereFVDVANVLNHTNVRNASYSVDRAGRVFETTESLIPIVPSGGFVIEF*
Ga0068855_10190399113300005563Corn RhizosphereYARLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSFSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0068854_10118223823300005578Corn RhizosphereTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0066905_10210224723300005713Tropical Forest SoilVLFVDVANVLNHTNLRNSSYSIDRAGRVFETTESLMPIVPSGGFVFEF*
Ga0068861_10048802223300005719Switchgrass RhizosphereLRNQEYGVDRAGRVFGATESLMPIVPSGGFVIEF*
Ga0068861_10183832713300005719Switchgrass RhizosphereDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0068870_1129082023300005840Miscanthus RhizosphereLNRTNLRNSSFSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0068860_10084230513300005843Switchgrass RhizosphereANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0068860_10116971113300005843Switchgrass RhizosphereNWSGRRMVLFVEVANVLNRSNLRNTNYSVDRAGRVFETTESMIPIVPSGGFMIEF*
Ga0075432_1002074813300006058Populus RhizosphereNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0075422_1000472313300006196Populus RhizosphereRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0079222_1051218013300006755Agricultural SoilSRLDVRADHAFNWWGRRLVLFVDVANVLNRTNVRNANYFVDRTGRVLETTESLMPIVPSGGLMIEF*
Ga0075421_10057758113300006845Populus RhizosphereTNLRNASYSVDRAGRVFETTESLLPIVPSGGLTVEF*
Ga0075430_10065891523300006846Populus RhizosphereRRRLVLFVDVANILNRTNLRNTHYGIDSAGRVFETTESLMPIVPSGGFVIEF*
Ga0075420_10138711713300006853Populus RhizosphereWSRRRLVLFVDVANILNRTNLRNTHYGIDSAGRVFETTESLMPIVPSGGFVIEF*
Ga0075429_10025354513300006880Populus RhizosphereADRAFNVSRRRLLVFVEVANVFNHKNLRNAAYSVDRAGRVFETTESLLPIVPSGGVVFEF
Ga0075429_10119281623300006880Populus RhizosphereDVANVLNHTNLRNASYSVDRAGRVFETTESLLPIVPSGGLTVEF*
Ga0068865_10090032613300006881Miscanthus RhizosphereRLPAYSRLDVRADRAFTWSGRRLVVFVDVANVLNHENFRNASYSIDRAGRVFETTESLMPIVPSGGLVIEF*
Ga0079215_1102426323300006894Agricultural SoilAFNWSGRRLVVFVDVANVLNHTNARNSAYSVDRRGRVFGTMESLMPIVPSGGLVVEF*
Ga0079216_1153613123300006918Agricultural SoilGRRLVLIVDVANILNRTNLPNSSYFVDRVGRVFETTESLMLIVPSGGLVVEF*
Ga0079219_1075329713300006954Agricultural SoilNVLNRTNVRNANYFVDRTGRVLETTESLMPIVPSGGLMIEF*
Ga0079218_1025784713300007004Agricultural SoilNVRNSAYSVDRRGRVFETMESLMPIVPSGGLVVEF*
Ga0079218_1050417023300007004Agricultural SoilVVFVDVANILNQENLRNAGYSVDRAGRVFETMESLMPIVPSGGLVIEF*
Ga0111539_1057262633300009094Populus RhizosphereNRTNLRNVPFSVDRRGRVSGATDSLMPIVPSVGCVVEF*
Ga0111539_1293806723300009094Populus RhizosphereWSRRRLVLFVDVGNVLNRENLRNSSYSIDQRGRVFETTESLLPIVPSGGLVVEF*
Ga0075418_1076380033300009100Populus RhizosphereRADRAFTWSGGRLVLFLDVANVLNRTNVRNSSYSVDRVGRVFETTESLMPIVPSGGFVIEF*
Ga0075418_1144499513300009100Populus RhizosphereLDLRADRAFNWSSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0111538_1077959613300009156Populus RhizosphereRLPAYSRLDVRADRAFNWSGRRLVVFVDVANVVNHTNERNASYFVDRAGRVFETTESLMPIVPSGGFVIEF*
Ga0111538_1350981023300009156Populus RhizosphereLDVRADRAFTWSSRRLVAFVDIANVLNQQNLRNTSYAVDGSGRVLGRPGSLLPFVPSGGLVVEF*
Ga0105242_1235847723300009176Miscanthus RhizosphereVFVDVANITNRRNLRNTSYSVDRAGRVFDTTGSLLPIVPSGGLVVEF*
Ga0105061_106810313300009807Groundwater SandPVYSRLDVRADRAFNWSGRRLVVFVDVANILNRTNLRNSSYSLDRAGRVFEVTESLMPIVPSGGLVIEF*
Ga0126377_1204197313300010362Tropical Forest SoilAFNWWGRRLVLFIDVANMLNRTNVRNANYFVDRAGRVLETTESLMPIVPSGGLMIEF*
Ga0134124_1299617023300010397Terrestrial SoilRLPAYSRFDVRADRAFNWSKRRLLVFVEVANVLSHTNLRNASYSVDRAGRVFETTESLLPIVPSGGVVFEF*
Ga0134122_1250231913300010400Terrestrial SoilEVANVLNHTNLRNASYSVDRAGRVFETTESLLPIVPSDGVVFEF*
Ga0134123_1081807113300010403Terrestrial SoilNWSGRRLTVFVDVANILNRTNLRNASYSVDRAGRVFETTESTMPIVPSGGLVIEF*
Ga0126317_1088819423300011332SoilFASLVGERNTLRLPGYARLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNTSYSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0126317_1090764823300011332SoilLFVDVANVLNRTNLRNTSYSLDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0127502_1112226233300011333SoilFVDVANVANRTNLRNIPGFVDRAGRVFGTTESLMPIVPSGGFVIEF*
Ga0137436_109924913300011423SoilNVLNRTNLRNSSYSVDRFGRVFETTESLMPIVPSGGFVFEF*
Ga0137428_125487323300011432SoilLRNASYSVERTGRVFDTTESLMPIVPSGGLVIEF*
Ga0137427_1017276613300011445SoilRENLRNIPPFVDRAGRVFGTTESLMPIVPSGGFVIEF*
Ga0137465_109668313300012231SoilLRNSSYSVDRFGRVFETTESLMPIVPSGGFVFEF*
Ga0157334_100818523300012509SoilRFDVRADRAFNWSGRRLVLFVDVGNVLNRTNLRNSSYSIDQRGRVFETTESLLPIVPSGGLVVEF*
Ga0157299_1015744613300012899SoilRRLVVFVDVANVLNHENLRNTSPGIDRAGRVFDATESLLPIVPSGGLVIEF*
Ga0157291_1010563313300012902SoilLDVRADRAFTWASRRLVVFVDVANVLNHENLRNTSPGIDRAGRVFDATESLLPIVPSGGLVIEF*
Ga0157289_1033579323300012903SoilNLRNTSYSVDRAGRVFDTTGSLLPIVPSGGLVVEF*
Ga0157298_1017087613300012913SoilNLRNASYSVDRFGRVFETTESLMPIVPSGGFVFEF*
Ga0126375_1113001223300012948Tropical Forest SoilDLRADRAFNWSSRRMVLFVDVANIFNRTNLRNTPYFVDRVGRVVGTTESLMPIVPSGGFVIEF*
Ga0164301_1088666613300012960SoilVEPRADHAFNWWGQRLVVFVDVANVLNRTNVRNSNYFVDRAGRVMETTESLMPIVPSGGLMIEF*
Ga0157375_1038937913300013308Miscanthus RhizosphereLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0157375_1351603223300013308Miscanthus RhizosphereLFVDVANVLNHTNVRNASYSVDRAGRVFETTESLIPIVPSGGFVIEF*
Ga0157380_1041077413300014326Switchgrass RhizosphereGRRLVLFVDIANVLNHTNLRNASYSLDRVGRVFETTESLMPIVPSGGLVFEF*
Ga0157380_1235072623300014326Switchgrass RhizosphereFTWSSRRLVLFVDVANIFNRTNLRNTPYLVDGAGRVLNVTESLMPIVPSGGFVIEF*
Ga0157377_1088820523300014745Miscanthus RhizosphereFVDVANITNRENLRNTPPFVDRAGRVFGTTESLMPIVPSGGFVIEF*
Ga0173483_1067030013300015077SoilWSSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF*
Ga0132258_1026597213300015371Arabidopsis RhizosphereVASHTNLRNASYVVDRAGRVFGATESLMPIVPSGGFTMEF*
Ga0132256_10010153413300015372Arabidopsis RhizosphereFVDVANVLNRTNLRNSSFSVDRAGRVFETTESLMPIVPSGGLVFEF*
Ga0132256_10299036513300015372Arabidopsis RhizosphereKNLRNTPYSVDRTGRAFGVTETMMPIVPSAGFVVEF*
Ga0132257_10034217123300015373Arabidopsis RhizosphereNWSGRRLVAFVEVANVLNRTNLRNTSYSIDRAGRVFETTESTLPIVPSGGLVIEF*
Ga0190270_1074032713300018469SoilANVLNRQNLRNSSYSIDRAGRVFDITDSLLPIVPSGGLVIEF
Ga0190270_1126839523300018469SoilDRAFNWSSRRLVLFVEVANILNRDNRRNTPYGVNGAGRVFGATESLMPIVPSAGFVVEF
Ga0190274_1370396023300018476SoilVANVLNHENLRNTSYSIDRAGRVFDATESLLPIVPSGGLIVEF
Ga0190271_1019929633300018481SoilRAFTWSGRRLVVFVDIANVLNQTNLRNAGYSVDRVGRVFETTESLMPIVPSGGLVIEF
Ga0190271_1081088513300018481SoilHENLRNTSYGVDRAGRVFAATESLLPIVPSGGLVIEF
Ga0207682_1039284923300025893Miscanthus RhizosphereFNWSGRRLVLFVDVANVLNHTNLRNTSYSVDRAGRVFEATESLMPIVPSGGFVIEF
Ga0207682_1052790713300025893Miscanthus RhizosphereLVVFVDVANVTNRRNLRNTSYSVDRAGRVFDTTGSLLPIVPSGGLVVEF
Ga0207649_1029340613300025920Corn RhizosphereIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0207701_1049912033300025930Corn, Switchgrass And Miscanthus RhizosphereNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0207701_1133260523300025930Corn, Switchgrass And Miscanthus RhizosphereLRADRAFTWSSRRLVAFVDVANVLNRQNLRNTSYSIDRAGRVFDTTGSLLPIVPSGGLVVEF
Ga0207706_1023579623300025933Corn RhizosphereAFNWSGRRLVLFVDVANITNRENLRNVPPFVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0207686_1178032713300025934Miscanthus RhizosphereITNRRNLRNTSYSVDRAGRVFDTTGSLLPIVPSGGLVVEF
Ga0207669_1154025723300025937Miscanthus RhizosphereVDVANITNRRNLRNTSYSVDRAGRVFDTTGSLLPIVPSGGLVVEF
Ga0207691_1022734643300025940Miscanthus RhizosphereFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0207667_1161413823300025949Corn RhizosphereYARLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSFSVDRAGRVFETTESLMPIVPSGGLVFEF
Ga0207651_1201203923300025960Switchgrass RhizosphereLLRLPPYSRLDVRADRAFTWSSRRLVAFVDIANVLNRRNVRNTSYAIDGAGRVLGRGGSLLPFIPSGGLVVEF
Ga0207712_1108989213300025961Switchgrass RhizosphereRRLVLFLDVANVLNRTNVRNSSYSADRAGRVFETTESLMPIVPSGGFVIEF
Ga0207708_1022861233300026075Corn, Switchgrass And Miscanthus RhizosphereVLFVEVANVLNRSNLRNTNYSVDRAGRVFDTTESMIPIVPSGGFVIEF
Ga0207708_1180027813300026075Corn, Switchgrass And Miscanthus RhizosphereRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSVDRVGRVFETTESLMPIVPSGGFVFE
Ga0207641_1007540713300026088Switchgrass RhizosphereDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0207675_10176077513300026118Switchgrass RhizosphereVVFVDVANIFNRTNLRNQEYAVDRAGRVFGTTESLMPIVPSGGFVIEF
Ga0207683_1133802813300026121Miscanthus RhizosphereWSGRRLVLFVDVANVLNRTNLRNASYSVDRFGRVFETTESLMPIVPSGGFVFEF
Ga0207683_1165211323300026121Miscanthus RhizosphereRQNLRNTSYSIDRAGRVFETTESLLPIVPSGGLVIEF
Ga0210000_108488013300027462Arabidopsis Thaliana RhizosphereMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0209968_102564733300027526Arabidopsis Thaliana RhizosphereSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0209970_101993333300027614Arabidopsis Thaliana RhizosphereFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0209387_115272613300027639Agricultural SoilFNWSGRRLVVFVDVANVLNHTNARNSAYSVDRRGRVFGTMESLMPIVPSGGLVVEF
Ga0268265_1155156213300028380Switchgrass RhizosphereRLPAYSRLDLRADRAFNWSSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0268264_1092643313300028381Switchgrass RhizosphereNWSGRRMVLFVEVANVLNRSNLRNTNYSVDRAGRVFETTESMIPIVPSGGFMIEF
Ga0307498_1009685023300031170SoilDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNASYSVDRFGRVFETTESLMPIVPSGGFVFEF
Ga0307468_10185288023300031740Hardwood Forest SoilWSGRRFVVFVDVANIANRTNLRNQEYGVDRAGRVFGATESLMPIVPSGGFVIEF
Ga0307413_1196246513300031824RhizosphereIDVANVLNRTNLRNGSYSLDRAGRVFEATESLMPIVSSGGLVFEF
Ga0310892_1111670313300031858SoilSSRRLVLFVDVANIFNRTNLRNTPYGIDRAGRVFNPTESLLPIVPSGGLVIEF
Ga0310901_1038911723300031940SoilVANVLNRTNVRNASYSVDRAGRVFETTESLMPIVPSGGFVIEF
Ga0307409_10249541823300031995RhizosphereARLDVRADRAFNWSGRRLVLFIDVANVLNRTNLRNGSYSLDRAGRVFEATESLMPIVPSGGLVFEF
Ga0310903_1074025223300032000SoilPAYSRLDVRADRAFTWSGGRLVLFLDVANVLNRTNVRNSSYSVDRVGRVFETTESLMPIVPSGGFVIEF
Ga0310897_1052558913300032003SoilANVLNRTNLRNSSYSVDRFGRVFETTESLMPIVPSGGFVFEF
Ga0310899_1035267513300032017SoilVLFVDVANITNRENLRNIPPFVDRAGRVFGTTESLMPIVPSGGFVIEF
Ga0310890_1015815823300032075SoilDRAFNWSGRRLVLFVDVANITNRENLRNIPPFVDRAGRVFGTTESLMPIVPSGGFVIEF
Ga0315912_1013893713300032157SoilDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSIDRVGRVFDTMESLMPIVPSGGFVFEF
Ga0315912_1046797713300032157SoilAYARLDVRADRAFNWSSRRLVVFVDVANVLNRRNLRNTSYTIDRAGRVFDTMGSLLPIVPSGGLVIEF
Ga0310889_1017363513300032179SoilAYSRLDVRADRAFNWSGRRLVLFVDVANVLNRTNLRNSSYSVDRFGRVFETTESLMPIVPSGGFVFEF
Ga0310812_1030299233300032421SoilDLRADRAFNWSSRRMVLFVDVANIFNRTNLRNTPYGVDRVGRVFGTTESLMPIVPSGGFVIEF
Ga0364923_0025780_3_2033300034690SedimentSRLDVRADRGFTWSGKRLVVFVEVANVLNRQNLRNTSYSIDGAGRVLGRKGTLLPIVPSGGFVIEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.