Metagenome / Metatranscriptome Family F065916

Basic Information
Family ID	F065916
Family Type	Metagenome / Metatranscriptome
Number of Sequences	127
Average Sequence Length	40 residues
Representative Sequence	MLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF
Number of Associated Samples	93
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	52.76 %
% of genes near scaffold ends (potentially truncated)	38.58 %
% of genes from short scaffolds (< 2000 bps)	77.17 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (58.268 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.961 % of family members)
Environment Ontology (ENVO)	Unclassified (36.220 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (66.929 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF00196	GerE	5.51
PF00034	Cytochrom_C	3.15
PF00668	Condensation	3.15
PF03237	Terminase_6N	2.36
PF12850	Metallophos_2	2.36
PF13193	AMP-binding_C	2.36
PF11391	DUF2798	1.57
PF17201	Cache_3-Cache_2	1.57
PF13515	FUSC_2	1.57
PF07486	Hydrolase_2	1.57
PF13545	HTH_Crp_2	1.57
PF12833	HTH_18	0.79
PF03466	LysR_substrate	0.79
PF02148	zf-UBP	0.79
PF00171	Aldedh	0.79
PF13442	Cytochrome_CBB3	0.79
PF02518	HATPase_c	0.79
PF13683	rve_3	0.79
PF14342	DUF4396	0.79
PF03707	MHYT	0.79
PF04298	Zn_peptidase_2	0.79
PF12576	DUF3754	0.79
PF10503	Esterase_PHB	0.79
PF09361	Phasin_2	0.79
PF05227	CHASE3	0.79
PF01361	Tautomerase	0.79
PF06078	DUF937	0.79
PF07386	DUF1499	0.79
PF13493	DUF4118	0.79
PF00501	AMP-binding	0.79
PF00106	adh_short	0.79

COG ID	Name	Functional Category	% Frequency in 127 Family Scaffolds
COG1020	EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase	Secondary metabolites biosynthesis, transport and catabolism [Q]	3.15
COG3773	Cell wall hydrolase CwlJ, involved in spore germination	Cell cycle control, cell division, chromosome partitioning [D]	1.57
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.79
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.79
COG1942	Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.79
COG2738	Zn-dependent membrane protease YugP	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG3300	MHYT domain, NO-binding membrane sensor	Signal transduction mechanisms [T]	0.79
COG3753	Uncharacterized conserved protein YidB, DUF937 family	Function unknown [S]	0.79
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.79
COG4446	Uncharacterized conserved protein, DUF1499 family	Function unknown [S]	0.79
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.79
COG5207	Uncharacterized Zn-finger protein, UBP-type	General function prediction only [R]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.27 %
Unclassified	root	N/A	41.73 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.27 %
Unclassified	root	N/A	41.73 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.27 %
Unclassified	root	N/A	41.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.22 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	3.15 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	3.94 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.79 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	31.50 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.15 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1.57 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16.54 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	3.15 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	1.57 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1.57 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	3.15 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.36 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	2.36 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1.57 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	1.57 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.57 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Boseaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae	0.79 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	3.15 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.36 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	1.57 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.57 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1.57 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.79 %
Clostridiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae	0.79 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	0.79 %
Bosea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	3.15 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.36 %
Singulisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	1.57 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1.57 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Clostridium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium	0.79 %
unclassified Bosea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea	0.79 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.79 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.79 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	3.15 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.36 %
unclassified Singulisphaera	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera	1.57 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1.57 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Bosea sp. BK604	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	0.79 %
Clostridium drakei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium drakei	0.79 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.79 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.79 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.73 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	3.15 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	2.36 %
Singulisphaera sp. GP187	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	1.57 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1.57 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.57 %
Bosea sp. BK604	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	0.79 %
Clostridium drakei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium drakei	0.79 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.79 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.79 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459010\|GIO7OMY01DKYO3	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	527	Open in IMG/M
3300002070\|JGI24750J21931_1013102	Not Available	1106	Open in IMG/M
3300004463\|Ga0063356_101739889	All Organisms → cellular organisms → Bacteria	934	Open in IMG/M
3300004785\|Ga0058858_1411625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	789	Open in IMG/M
3300004799\|Ga0058863_11808773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1198	Open in IMG/M
3300005327\|Ga0070658_10754964	Not Available	845	Open in IMG/M
3300005329\|Ga0070683_101069455	Not Available	775	Open in IMG/M
3300005331\|Ga0070670_100058933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3296	Open in IMG/M
3300005332\|Ga0066388_102182614	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300005339\|Ga0070660_100107965	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2212	Open in IMG/M
3300005354\|Ga0070675_100486679	Not Available	1110	Open in IMG/M
3300005356\|Ga0070674_100227980	All Organisms → cellular organisms → Bacteria	1452	Open in IMG/M
3300005435\|Ga0070714_100291616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1518	Open in IMG/M
3300005444\|Ga0070694_101064547	Not Available	673	Open in IMG/M
3300005457\|Ga0070662_100087876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2328	Open in IMG/M
3300005457\|Ga0070662_100771048	Not Available	816	Open in IMG/M
3300005544\|Ga0070686_101804633	Not Available	521	Open in IMG/M
3300005546\|Ga0070696_100792308	Not Available	779	Open in IMG/M
3300005547\|Ga0070693_101266720	Not Available	569	Open in IMG/M
3300005548\|Ga0070665_100099218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2916	Open in IMG/M
3300005548\|Ga0070665_100800297	Not Available	956	Open in IMG/M
3300005548\|Ga0070665_102273934	Not Available	545	Open in IMG/M
3300005549\|Ga0070704_100785921	Not Available	850	Open in IMG/M
3300005563\|Ga0068855_101122594	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	821	Open in IMG/M
3300005564\|Ga0070664_100062505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3174	Open in IMG/M
3300005564\|Ga0070664_100583379	All Organisms → cellular organisms → Bacteria	1036	Open in IMG/M
3300005577\|Ga0068857_100013551	All Organisms → cellular organisms → Bacteria	7102	Open in IMG/M
3300005615\|Ga0070702_100046446	Not Available	2461	Open in IMG/M
3300005615\|Ga0070702_100212444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1289	Open in IMG/M
3300005713\|Ga0066905_100127823	All Organisms → cellular organisms → Bacteria → Proteobacteria	1787	Open in IMG/M
3300005718\|Ga0068866_10071043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1840	Open in IMG/M
3300005764\|Ga0066903_103605711	Not Available	834	Open in IMG/M
3300005764\|Ga0066903_108052179	Not Available	540	Open in IMG/M
3300005841\|Ga0068863_102333104	Not Available	545	Open in IMG/M
3300005844\|Ga0068862_100571743	All Organisms → cellular organisms → Bacteria	1082	Open in IMG/M
3300006196\|Ga0075422_10282593	Not Available	706	Open in IMG/M
3300006804\|Ga0079221_10457550	Not Available	813	Open in IMG/M
3300006806\|Ga0079220_11650073	Not Available	558	Open in IMG/M
3300006844\|Ga0075428_100397662	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1477	Open in IMG/M
3300006844\|Ga0075428_100631559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1143	Open in IMG/M
3300006845\|Ga0075421_102338874	Not Available	561	Open in IMG/M
3300006846\|Ga0075430_100441672	Not Available	1074	Open in IMG/M
3300006847\|Ga0075431_100525456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1172	Open in IMG/M
3300006852\|Ga0075433_10417326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1183	Open in IMG/M
3300006852\|Ga0075433_10675009	Not Available	905	Open in IMG/M
3300006871\|Ga0075434_100658252	Not Available	1065	Open in IMG/M
3300006914\|Ga0075436_100657046	Not Available	775	Open in IMG/M
3300006954\|Ga0079219_10134575	Not Available	1288	Open in IMG/M
3300007076\|Ga0075435_100060335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	3075	Open in IMG/M
3300007076\|Ga0075435_100346204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1274	Open in IMG/M
3300007076\|Ga0075435_100958648	Not Available	747	Open in IMG/M
3300007076\|Ga0075435_101568217	Not Available	578	Open in IMG/M
3300007076\|Ga0075435_101949889	Not Available	516	Open in IMG/M
3300009011\|Ga0105251_10053072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1928	Open in IMG/M
3300009094\|Ga0111539_11310221	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	841	Open in IMG/M
3300009148\|Ga0105243_10179361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1841	Open in IMG/M
3300009148\|Ga0105243_11341984	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300009156\|Ga0111538_11018736	Not Available	1047	Open in IMG/M
3300009156\|Ga0111538_11522360	Not Available	843	Open in IMG/M
3300009162\|Ga0075423_11134856	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300009167\|Ga0113563_12553933	Not Available	617	Open in IMG/M
3300009553\|Ga0105249_10362664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1471	Open in IMG/M
3300009553\|Ga0105249_10782510	Not Available	1017	Open in IMG/M
3300010375\|Ga0105239_12190483	Not Available	643	Open in IMG/M
3300010396\|Ga0134126_10363834	All Organisms → cellular organisms → Bacteria	1685	Open in IMG/M
3300011119\|Ga0105246_10003183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9975	Open in IMG/M
3300011119\|Ga0105246_10018371	All Organisms → cellular organisms → Bacteria	4456	Open in IMG/M
3300011119\|Ga0105246_11099523	Not Available	726	Open in IMG/M
3300012489\|Ga0157349_1030348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	561	Open in IMG/M
3300012899\|Ga0157299_10012638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1465	Open in IMG/M
3300012909\|Ga0157290_10186181	Not Available	694	Open in IMG/M
3300012911\|Ga0157301_10113262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	815	Open in IMG/M
3300012951\|Ga0164300_10013227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2670	Open in IMG/M
3300012951\|Ga0164300_10506451	Not Available	691	Open in IMG/M
3300012957\|Ga0164303_10005015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4153	Open in IMG/M
3300012957\|Ga0164303_10014895	All Organisms → cellular organisms → Bacteria	2834	Open in IMG/M
3300012957\|Ga0164303_10016017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2766	Open in IMG/M
3300012957\|Ga0164303_11232845	Not Available	549	Open in IMG/M
3300012958\|Ga0164299_10091960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1553	Open in IMG/M
3300012958\|Ga0164299_10186918	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium drakei	1184	Open in IMG/M
3300012958\|Ga0164299_11302645	Not Available	556	Open in IMG/M
3300012960\|Ga0164301_10773550	Not Available	731	Open in IMG/M
3300012960\|Ga0164301_11145216	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	621	Open in IMG/M
3300012984\|Ga0164309_10048746	All Organisms → cellular organisms → Bacteria	2440	Open in IMG/M
3300012985\|Ga0164308_10873536	Not Available	790	Open in IMG/M
3300012985\|Ga0164308_11733567	Not Available	580	Open in IMG/M
3300012988\|Ga0164306_11206698	Not Available	635	Open in IMG/M
3300013297\|Ga0157378_11741786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	671	Open in IMG/M
3300013306\|Ga0163162_10030224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5368	Open in IMG/M
3300013306\|Ga0163162_10069206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3581	Open in IMG/M
3300013306\|Ga0163162_12298945	All Organisms → cellular organisms → Bacteria → Proteobacteria	619	Open in IMG/M
3300013307\|Ga0157372_12934481	Not Available	546	Open in IMG/M
3300015371\|Ga0132258_10073131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7958	Open in IMG/M
3300015371\|Ga0132258_12218030	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187	1378	Open in IMG/M
3300015373\|Ga0132257_100119089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	3065	Open in IMG/M
3300015373\|Ga0132257_100146618	All Organisms → cellular organisms → Bacteria	2761	Open in IMG/M
3300015373\|Ga0132257_102231785	Not Available	709	Open in IMG/M
3300015374\|Ga0132255_101864377	All Organisms → cellular organisms → Bacteria	914	Open in IMG/M
3300015374\|Ga0132255_104899059	Not Available	567	Open in IMG/M
3300017943\|Ga0187819_10017311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4154	Open in IMG/M
3300017955\|Ga0187817_10077173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2080	Open in IMG/M
3300018028\|Ga0184608_10192734	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	891	Open in IMG/M
3300018081\|Ga0184625_10428474	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	680	Open in IMG/M
3300022694\|Ga0222623_10067249	All Organisms → cellular organisms → Bacteria	1386	Open in IMG/M
3300024055\|Ga0247794_10105189	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300025903\|Ga0207680_10200783	Not Available	1359	Open in IMG/M
3300025908\|Ga0207643_10050019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2369	Open in IMG/M
3300025908\|Ga0207643_10584500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	718	Open in IMG/M
3300025911\|Ga0207654_10018001	All Organisms → cellular organisms → Bacteria → Proteobacteria	3704	Open in IMG/M
3300025916\|Ga0207663_10023143	All Organisms → cellular organisms → Bacteria → Proteobacteria	3561	Open in IMG/M
3300025919\|Ga0207657_10000470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	42653	Open in IMG/M
3300025933\|Ga0207706_10882720	Not Available	756	Open in IMG/M
3300025936\|Ga0207670_10457295	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1030	Open in IMG/M
3300025938\|Ga0207704_10678268	Not Available	851	Open in IMG/M
3300025949\|Ga0207667_10095101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3076	Open in IMG/M
3300025972\|Ga0207668_11237050	Not Available	671	Open in IMG/M
3300026035\|Ga0207703_10669640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	985	Open in IMG/M
3300026067\|Ga0207678_10285733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1416	Open in IMG/M
3300027703\|Ga0207862_1018327	Not Available	2084	Open in IMG/M
3300028379\|Ga0268266_10148957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2107	Open in IMG/M
3300031944\|Ga0310884_10579305	Not Available	668	Open in IMG/M
3300032180\|Ga0307471_100942522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1031	Open in IMG/M
3300032180\|Ga0307471_103218793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	579	Open in IMG/M
3300032205\|Ga0307472_100975442	Not Available	792	Open in IMG/M
3300032205\|Ga0307472_101154872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	737	Open in IMG/M
3300032829\|Ga0335070_10252035	All Organisms → cellular organisms → Bacteria	1730	Open in IMG/M
3300033551\|Ga0247830_11711743	Not Available	504	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	57.48%
Environmental	Environmental	42.52%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.91%
Terrestrial	Environmental → Terrestrial	37.80%
Aquatic	Environmental → Aquatic	4.72%
Human	Host-Associated → Human	1.57%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	38.58%
Soil	Environmental → Terrestrial → Soil	37.80%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.32%
Freshwater	Environmental → Aquatic → Freshwater	2.36%
Sediment	Environmental → Aquatic → Sediment	2.36%
Digestive System	Host-Associated → Human → Digestive System	1.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.41%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	24.41%
Soil	Host-Associated → Plants → Rhizosphere → Soil	14.17%
Loam	Environmental → Terrestrial → Soil → Loam	12.60%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.51%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.36%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.36%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.57%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	24.41%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	14.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.51%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.15%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.15%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.36%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.57%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.79%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	14.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.17%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	7.09%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.51%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.51%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.15%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.15%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.36%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.36%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.57%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.57%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.57%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.57%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.57%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.79%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.79%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.79%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.79%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.79%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.79%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.79%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Host-Associated	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004785	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012489	Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F065916

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F62_00489180	2170459010	Grass Soil	GVPKRMENQKMLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF
JGI24750J21931_10131022	3300002070	Corn, Switchgrass And Miscanthus Rhizosphere	MENKKMLKRXFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0063356_1017398892	3300004463	Arabidopsis Thaliana Rhizosphere	MLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILFGAALLHWLAQF*
Ga0058858_14116252	3300004785	Host-Associated	MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0058863_118087734	3300004799	Host-Associated	MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0070658_107549642	3300005327	Corn Rhizosphere	MENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0070683_1010694552	3300005329	Corn Rhizosphere	MENQKMLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0070670_1000589334	3300005331	Switchgrass Rhizosphere	MENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0066388_1021826141	3300005332	Tropical Forest Soil	MGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAVFLNWVAHL*
Ga0070660_1001079652	3300005339	Corn Rhizosphere	MLDGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070675_1004866792	3300005354	Miscanthus Rhizosphere	MENQKMLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0070674_1002279803	3300005356	Miscanthus Rhizosphere	MENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAHF*
Ga0070714_1002916161	3300005435	Agricultural Soil	KKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0070694_1010645471	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVALSNQLKFAF
Ga0070662_1000878761	3300005457	Corn Rhizosphere	RDAWMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070662_1007710482	3300005457	Corn Rhizosphere	TSAKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070686_1018046331	3300005544	Switchgrass Rhizosphere	KKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070696_1007923081	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	KKMFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070693_1012667201	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MKQDQCDAWIGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070665_1000992182	3300005548	Switchgrass Rhizosphere	MFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF*
Ga0070665_1008002972	3300005548	Switchgrass Rhizosphere	MLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0070665_1022739341	3300005548	Switchgrass Rhizosphere	MLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF*
Ga0070704_1007859212	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	QGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0068855_1011225941	3300005563	Corn Rhizosphere	DGESKMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070664_1000625059	3300005564	Corn Rhizosphere	MLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070664_1005833792	3300005564	Corn Rhizosphere	MLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF*
Ga0068857_1000135512	3300005577	Corn Rhizosphere	MLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070702_1000464461	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	AKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070702_1002124441	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	ENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0066905_1001278231	3300005713	Tropical Forest Soil	MEKKMLRRIVPYLKRPDVDFALDCVSFILFSVVFLYWVAHL*
Ga0068866_100710434	3300005718	Miscanthus Rhizosphere	MLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0066903_1036057111	3300005764	Tropical Forest Soil	PPMGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAAFLNWVAHL*
Ga0066903_1080521791	3300005764	Tropical Forest Soil	MLRGVFPSLKRPDVEFALECASFIFFCAVFLHWIA
Ga0068863_1023331042	3300005841	Switchgrass Rhizosphere	MEDQKMLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF*
Ga0068862_1005717433	3300005844	Switchgrass Rhizosphere	MLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0075422_102825932	3300006196	Populus Rhizosphere	MLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF*
Ga0079221_104575501	3300006804	Agricultural Soil	MENQKMLKRIFPYLNRPDVEFVFSAIFLNWVAHF*
Ga0079220_116500731	3300006806	Agricultural Soil	MENKKMLRRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0075428_1003976621	3300006844	Populus Rhizosphere	MLRRVFPYFKRPDVEFVLECVSFILFSVVFMHWVAHF*
Ga0075428_1006315594	3300006844	Populus Rhizosphere	LTQGAKQMLKRVFPFLKRSDVEFTLECTSFILFCAAALRWVAQF*
Ga0075421_1023388741	3300006845	Populus Rhizosphere	KQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF*
Ga0075430_1004416722	3300006846	Populus Rhizosphere	MFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL*
Ga0075431_1005254561	3300006847	Populus Rhizosphere	KMFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL*
Ga0075433_104173262	3300006852	Populus Rhizosphere	MENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF*
Ga0075433_106750094	3300006852	Populus Rhizosphere	RDAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVFLNWVAHF*
Ga0075434_1006582522	3300006871	Populus Rhizosphere	MLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0075436_1006570461	3300006914	Populus Rhizosphere	KMLKRIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF*
Ga0079219_101345751	3300006954	Agricultural Soil	MENQKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0075435_1000603354	3300007076	Populus Rhizosphere	MFRHMFPFLMRPDLEFALDCASFIFFCAALLHWIAQL*
Ga0075435_1003462043	3300007076	Populus Rhizosphere	DAWMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0075435_1009586481	3300007076	Populus Rhizosphere	MENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0075435_1015682171	3300007076	Populus Rhizosphere	KMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0075435_1019498892	3300007076	Populus Rhizosphere	RVKQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF*
Ga0105251_100530721	3300009011	Switchgrass Rhizosphere	NKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0111539_113102212	3300009094	Populus Rhizosphere	MLAQARSQGEKQMLRRVFPLLKRPDVEFMLDCASFILFGAALLHWVAQF*
Ga0105243_101793611	3300009148	Miscanthus Rhizosphere	MENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWV
Ga0105243_113419842	3300009148	Miscanthus Rhizosphere	MLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0111538_110187361	3300009156	Populus Rhizosphere	NQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF*
Ga0111538_115223601	3300009156	Populus Rhizosphere	MFRHMFPFLMRPDVEFALHCASFIFFCAALLHWIAQL
Ga0075423_111348562	3300009162	Populus Rhizosphere	MLRRVFPYLKRPDVEFTLECASFILFCAAFLRWIAQF*
Ga0113563_125539332	3300009167	Freshwater Wetlands	MLRRVFPLLKRPDVEFTLECASFVLFCAALLHWIAQF*
Ga0105249_103626644	3300009553	Switchgrass Rhizosphere	DAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0105249_107825103	3300009553	Switchgrass Rhizosphere	RIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF*
Ga0105239_121904832	3300010375	Corn Rhizosphere	GLPKSTENQKMLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF*
Ga0134126_103638342	3300010396	Terrestrial Soil	MLRRIFPYFKRPDVEFVLEYVSFILFSVVFVHWVAHF*
Ga0105246_100031831	3300011119	Miscanthus Rhizosphere	MLKRIFPYLNRPNVEFVLEYVSFILFCGVFLHWVAHF*
Ga0105246_100183717	3300011119	Miscanthus Rhizosphere	MLKRIFPYLNRPDVEFALECASSILFSAVFLNWVAQF*
Ga0105246_110995231	3300011119	Miscanthus Rhizosphere	MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVF
Ga0157349_10303481	3300012489	Unplanted Soil	MLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF*
Ga0157299_100126381	3300012899	Soil	ASLIELRDAGMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0157290_101861811	3300012909	Soil	QKMLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0157301_101132623	3300012911	Soil	AWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVVLNWVAHF*
Ga0164300_100132274	3300012951	Soil	MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164300_105064512	3300012951	Soil	MLRRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF*
Ga0164303_100050156	3300012957	Soil	MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHL*
Ga0164303_100148953	3300012957	Soil	MLSRVFPFLKKPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164303_100160172	3300012957	Soil	MLRRTFPYLKRPDVEFVLERTSFIFFSVIFLHWVAHF*
Ga0164303_112328451	3300012957	Soil	KQMLRRMFPLLKRPDVEFMLDCASFILFGAALLHWVAQF*
Ga0164299_100919603	3300012958	Soil	MLRRMFPYLNRPDVEIVLDCTSFIFFSVVFLRWVAHF*
Ga0164299_101869183	3300012958	Soil	MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164299_113026452	3300012958	Soil	MVRPVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF*
Ga0164301_107735501	3300012960	Soil	MLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF*
Ga0164301_111452162	3300012960	Soil	RRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF*
Ga0164309_100487461	3300012984	Soil	LSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164308_108735361	3300012985	Soil	KRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0164308_117335671	3300012985	Soil	RVLTQGVKQMLRRVFPFLKRPDIEFTLECASFILFSAAFLHWVAQL*
Ga0164306_112066982	3300012988	Soil	MVRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF*
Ga0157378_117417861	3300013297	Miscanthus Rhizosphere	KMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0163162_100302241	3300013306	Switchgrass Rhizosphere	GVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0163162_100692067	3300013306	Switchgrass Rhizosphere	MLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0163162_122989452	3300013306	Switchgrass Rhizosphere	RVFPLLKRPGVEFMLECASFVLFCAALLHWVAQF*
Ga0157372_129344811	3300013307	Corn Rhizosphere	MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWGAQL*
Ga0132258_100731314	3300015371	Arabidopsis Rhizosphere	MFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF*
Ga0132258_122180302	3300015371	Arabidopsis Rhizosphere	MLRRVFPLLKRPDVEFMLECASFILFCTALLHWVARF*
Ga0132257_1001190892	3300015373	Arabidopsis Rhizosphere	MLRRVFPYLKRPDVEFMLECASFILFCAAFLRWIAQF*
Ga0132257_1001466182	3300015373	Arabidopsis Rhizosphere	MLRRVFPFLKRPDIEFTLECASFILFCAAFLHWVAQF*
Ga0132257_1022317852	3300015373	Arabidopsis Rhizosphere	MSAQASSQGEKQMLRRVFPLLKRPDVEFMLECASFVLFCAALLHWIAQF*
Ga0132255_1018643772	3300015374	Arabidopsis Rhizosphere	MLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF*
Ga0132255_1048990592	3300015374	Arabidopsis Rhizosphere	MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHF*
Ga0187819_100173112	3300017943	Freshwater Sediment	MLRRAFPLLKRSDVEFTLECASFVLFCAAFLHWVAQI
Ga0187817_100771732	3300017955	Freshwater Sediment	MLKRAFPPLKRPDVEFTLECASFILFCAAFLHWVAQI
Ga0184608_101927342	3300018028	Groundwater Sediment	MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQ
Ga0184625_104284742	3300018081	Groundwater Sediment	MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL
Ga0222623_100672491	3300022694	Groundwater Sediment	MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF
Ga0247794_101051893	3300024055	Soil	MLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAH
Ga0207680_102007833	3300025903	Switchgrass Rhizosphere	QRKRAMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF
Ga0207643_100500193	3300025908	Miscanthus Rhizosphere	MLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF
Ga0207643_105845002	3300025908	Miscanthus Rhizosphere	MLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF
Ga0207654_100180012	3300025911	Corn Rhizosphere	MFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF
Ga0207663_100231434	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MLRRIFPYFKRPDVEFVLECVSFILFSAVFVHWVAHF
Ga0207657_1000047050	3300025919	Corn Rhizosphere	WMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207706_108827202	3300025933	Corn Rhizosphere	MLKRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF
Ga0207670_104572952	3300025936	Switchgrass Rhizosphere	MFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL
Ga0207704_106782682	3300025938	Miscanthus Rhizosphere	ENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207667_100951014	3300025949	Corn Rhizosphere	MFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF
Ga0207668_112370502	3300025972	Switchgrass Rhizosphere	MLRRLFPYLKRPDIEIFLDCAAFIFFIVAFLHWVARF
Ga0207703_106696402	3300026035	Switchgrass Rhizosphere	KKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207678_102857333	3300026067	Corn Rhizosphere	MLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF
Ga0207862_10183272	3300027703	Tropical Forest Soil	MVKRMFPFLKWPNVEFTLECASFVFFCVAFLHWVAHF
Ga0268266_101489571	3300028379	Switchgrass Rhizosphere	MLKRIFPYLNRPDVEFVLEYVSFILFCGVFLHWVAHF
Ga0310884_105793052	3300031944	Soil	KQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL
Ga0307471_1009425222	3300032180	Hardwood Forest Soil	MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL
Ga0307471_1032187932	3300032180	Hardwood Forest Soil	MLRRVFPLLKRPDVEFMLECTSFILFCAAFLRWIAQF
Ga0307472_1009754422	3300032205	Hardwood Forest Soil	MLRRLFPYLKRPDVEIFLDCVSFIFFSVAFLHWVAHF
Ga0307472_1011548723	3300032205	Hardwood Forest Soil	QGVKQMLRRVFPLLKRPDVEFMLECASFILFCAALLHWVAQF
Ga0335070_102520352	3300032829	Soil	MLRHVFPILKRRDVELTLECTSFLLLCAAFLHWVAVG
Ga0247830_117117431	3300033551	Soil	MLRRTFPYLKRPDVEFALDCTSLIIFSVIFLHWVVHF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign