| Basic Information | |
|---|---|
| Family ID | F065900 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GGTADVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 98.43 % |
| % of genes from short scaffolds (< 2000 bps) | 97.64 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.055 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (7.087 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.795 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF03951 | Gln-synt_N | 57.48 |
| PF00581 | Rhodanese | 18.90 |
| PF12625 | Arabinose_bd | 0.79 |
| PF13188 | PAS_8 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 57.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.42 % |
| Unclassified | root | N/A | 38.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_157842 | Not Available | 643 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10133256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100305246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109575163 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300001664|P5cmW16_1072325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 562 | Open in IMG/M |
| 3300003859|Ga0031653_10019860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1903 | Open in IMG/M |
| 3300004000|Ga0055458_10263946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus | 537 | Open in IMG/M |
| 3300004643|Ga0062591_100134296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1688 | Open in IMG/M |
| 3300005167|Ga0066672_10711086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 642 | Open in IMG/M |
| 3300005180|Ga0066685_10307946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1097 | Open in IMG/M |
| 3300005337|Ga0070682_100390339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1050 | Open in IMG/M |
| 3300005340|Ga0070689_100874495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 794 | Open in IMG/M |
| 3300005344|Ga0070661_100511100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 962 | Open in IMG/M |
| 3300005344|Ga0070661_100735226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 806 | Open in IMG/M |
| 3300005434|Ga0070709_11411289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 564 | Open in IMG/M |
| 3300005458|Ga0070681_11522333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
| 3300005467|Ga0070706_101329068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005543|Ga0070672_100587787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 969 | Open in IMG/M |
| 3300005563|Ga0068855_101265397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
| 3300005719|Ga0068861_101843504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300005844|Ga0068862_102021820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C | 587 | Open in IMG/M |
| 3300005844|Ga0068862_102645822 | Not Available | 513 | Open in IMG/M |
| 3300005921|Ga0070766_11293748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 505 | Open in IMG/M |
| 3300006224|Ga0079037_102458281 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006237|Ga0097621_101746054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 593 | Open in IMG/M |
| 3300006755|Ga0079222_10095959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1543 | Open in IMG/M |
| 3300006796|Ga0066665_10802501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 742 | Open in IMG/M |
| 3300006800|Ga0066660_10142280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1766 | Open in IMG/M |
| 3300006871|Ga0075434_101691118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
| 3300006904|Ga0075424_101072027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 859 | Open in IMG/M |
| 3300006954|Ga0079219_10137640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1279 | Open in IMG/M |
| 3300009101|Ga0105247_11144501 | Not Available | 616 | Open in IMG/M |
| 3300009131|Ga0115027_10908055 | Not Available | 682 | Open in IMG/M |
| 3300009162|Ga0075423_11963373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300009167|Ga0113563_11009570 | Not Available | 958 | Open in IMG/M |
| 3300009174|Ga0105241_10231564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1558 | Open in IMG/M |
| 3300009553|Ga0105249_11843518 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 677 | Open in IMG/M |
| 3300009553|Ga0105249_12047045 | Not Available | 645 | Open in IMG/M |
| 3300010043|Ga0126380_10433902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 987 | Open in IMG/M |
| 3300010358|Ga0126370_10178794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1580 | Open in IMG/M |
| 3300010360|Ga0126372_11503904 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010398|Ga0126383_13175564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 537 | Open in IMG/M |
| 3300010400|Ga0134122_12525959 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012198|Ga0137364_11014628 | Not Available | 627 | Open in IMG/M |
| 3300012206|Ga0137380_11070321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 688 | Open in IMG/M |
| 3300012227|Ga0137449_1032517 | Not Available | 1037 | Open in IMG/M |
| 3300012349|Ga0137387_11131727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300012906|Ga0157295_10130121 | Not Available | 730 | Open in IMG/M |
| 3300012961|Ga0164302_11678076 | Not Available | 532 | Open in IMG/M |
| 3300012986|Ga0164304_11106209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 634 | Open in IMG/M |
| 3300013100|Ga0157373_10920272 | Not Available | 649 | Open in IMG/M |
| 3300013104|Ga0157370_11688762 | Not Available | 568 | Open in IMG/M |
| 3300013232|Ga0170573_11088651 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300013296|Ga0157374_12681776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 526 | Open in IMG/M |
| 3300013297|Ga0157378_11960051 | Not Available | 635 | Open in IMG/M |
| 3300013306|Ga0163162_11102513 | Not Available | 899 | Open in IMG/M |
| 3300014320|Ga0075342_1123815 | Not Available | 689 | Open in IMG/M |
| 3300015203|Ga0167650_1063643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300015372|Ga0132256_103826287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis | 506 | Open in IMG/M |
| 3300015374|Ga0132255_105511813 | Not Available | 535 | Open in IMG/M |
| 3300016445|Ga0182038_10348453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1226 | Open in IMG/M |
| 3300017787|Ga0183260_10622461 | Not Available | 691 | Open in IMG/M |
| 3300017792|Ga0163161_10988144 | Not Available | 718 | Open in IMG/M |
| 3300018075|Ga0184632_10406061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 571 | Open in IMG/M |
| 3300018075|Ga0184632_10441002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
| 3300018476|Ga0190274_10258188 | Not Available | 1586 | Open in IMG/M |
| 3300018482|Ga0066669_10317216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1275 | Open in IMG/M |
| 3300019361|Ga0173482_10508635 | Not Available | 586 | Open in IMG/M |
| 3300020583|Ga0210401_10647468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 918 | Open in IMG/M |
| 3300021432|Ga0210384_10885940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 792 | Open in IMG/M |
| 3300022756|Ga0222622_11024066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 607 | Open in IMG/M |
| 3300025898|Ga0207692_10836458 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 603 | Open in IMG/M |
| 3300025899|Ga0207642_10037653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2086 | Open in IMG/M |
| 3300025900|Ga0207710_10690147 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025906|Ga0207699_11070574 | Not Available | 597 | Open in IMG/M |
| 3300025910|Ga0207684_11449732 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300025916|Ga0207663_10693352 | Not Available | 806 | Open in IMG/M |
| 3300025920|Ga0207649_10820970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 726 | Open in IMG/M |
| 3300025921|Ga0207652_11023325 | Not Available | 725 | Open in IMG/M |
| 3300025928|Ga0207700_11788425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 540 | Open in IMG/M |
| 3300025930|Ga0207701_10500421 | Not Available | 1040 | Open in IMG/M |
| 3300025932|Ga0207690_10024736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3763 | Open in IMG/M |
| 3300025932|Ga0207690_10744341 | Not Available | 808 | Open in IMG/M |
| 3300025949|Ga0207667_11941036 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025960|Ga0207651_11981863 | Not Available | 523 | Open in IMG/M |
| 3300025966|Ga0210105_1005533 | Not Available | 1815 | Open in IMG/M |
| 3300026041|Ga0207639_11023276 | Not Available | 774 | Open in IMG/M |
| 3300026041|Ga0207639_11793692 | All Organisms → cellular organisms → Eukaryota | 574 | Open in IMG/M |
| 3300026088|Ga0207641_10216040 | Not Available | 1775 | Open in IMG/M |
| 3300026088|Ga0207641_10658655 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300027462|Ga0210000_1080633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis | 534 | Open in IMG/M |
| 3300027683|Ga0209392_1261535 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027877|Ga0209293_10106431 | Not Available | 1278 | Open in IMG/M |
| 3300027886|Ga0209486_10253690 | Not Available | 1018 | Open in IMG/M |
| 3300027899|Ga0209668_10313597 | Not Available | 1010 | Open in IMG/M |
| 3300028380|Ga0268265_10372836 | Not Available | 1310 | Open in IMG/M |
| 3300030002|Ga0311350_10819404 | Not Available | 834 | Open in IMG/M |
| 3300030294|Ga0311349_10181038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1982 | Open in IMG/M |
| 3300031713|Ga0318496_10789409 | Not Available | 523 | Open in IMG/M |
| 3300031726|Ga0302321_100388679 | Not Available | 1516 | Open in IMG/M |
| 3300031824|Ga0307413_11293194 | Not Available | 638 | Open in IMG/M |
| 3300031896|Ga0318551_10828771 | Not Available | 538 | Open in IMG/M |
| 3300031939|Ga0308174_10590031 | Not Available | 918 | Open in IMG/M |
| 3300031996|Ga0308176_10828621 | Not Available | 968 | Open in IMG/M |
| 3300032053|Ga0315284_12101135 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300032067|Ga0318524_10337039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 782 | Open in IMG/M |
| 3300032090|Ga0318518_10373959 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032163|Ga0315281_10629351 | Not Available | 1126 | Open in IMG/M |
| 3300032164|Ga0315283_11653267 | Not Available | 650 | Open in IMG/M |
| 3300032173|Ga0315268_12134453 | Not Available | 574 | Open in IMG/M |
| 3300032174|Ga0307470_10145435 | Not Available | 1441 | Open in IMG/M |
| 3300032180|Ga0307471_103503399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 555 | Open in IMG/M |
| 3300032205|Ga0307472_101408938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 676 | Open in IMG/M |
| 3300032421|Ga0310812_10247724 | Not Available | 783 | Open in IMG/M |
| 3300032516|Ga0315273_11761781 | Not Available | 747 | Open in IMG/M |
| 3300032516|Ga0315273_13229443 | Not Available | 504 | Open in IMG/M |
| 3300032783|Ga0335079_10024801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6869 | Open in IMG/M |
| 3300032828|Ga0335080_12314103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 514 | Open in IMG/M |
| 3300033406|Ga0316604_10677965 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300033413|Ga0316603_11860618 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300033413|Ga0316603_12104584 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300033418|Ga0316625_102320493 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300033433|Ga0326726_10653976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1013 | Open in IMG/M |
| 3300033483|Ga0316629_10233720 | Not Available | 1194 | Open in IMG/M |
| 3300033521|Ga0316616_101358003 | Not Available | 913 | Open in IMG/M |
| 3300033521|Ga0316616_104527656 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300033803|Ga0314862_0033644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.36% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.36% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.57% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.79% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.79% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_02611620 | 2199352025 | Soil | DLSKGIPGGGEVPIKLFIDASATIQAGYTLYMFYP |
| BS_KBA_SWE12_21mDRAFT_101332561 | 3300000124 | Marine | ADYASGIADTAKGIPANAEVPVKLFIDASATTQAGYRLYLFFP* |
| INPhiseqgaiiFebDRAFT_1003052462 | 3300000364 | Soil | LQNGIAANGEAVVRLFIDASATSQAGYRLYLFYP* |
| JGIcombinedJ13530_1095751632 | 3300001213 | Wetland | ADIAAGIPANGEVAVKLFIDASATTQAGYRLYLFYP* |
| P5cmW16_10723252 | 3300001664 | Permafrost | DLDSGIAGNTELAVKLFIDASTTSQAGYQVYLFYP* |
| Ga0031653_100198601 | 3300003859 | Freshwater Lake Sediment | ADYAGGTADVQQGIPPNGEVAVKVFIDASATTQAGYRLYMFYP* |
| Ga0055458_102639461 | 3300004000 | Natural And Restored Wetlands | REYAGGTADLARGIPANADVAIKLFIDASATAQAGYRLYLFYG* |
| Ga0062591_1001342962 | 3300004643 | Soil | YAGGTTDLSRGIAANGEVALKVFIDASATSQAGYRLYMFYP* |
| Ga0066672_107110862 | 3300005167 | Soil | EYISGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP* |
| Ga0066685_103079461 | 3300005180 | Soil | SGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP* |
| Ga0070682_1003903391 | 3300005337 | Corn Rhizosphere | AGGTADIGGGIPANGESVVRLFIDASATQQAGYRLYLFYP* |
| Ga0070689_1008744951 | 3300005340 | Switchgrass Rhizosphere | PADYAGGTADLQKGIASNAEVAVKIFIDASATTQAGYRLYMFYP* |
| Ga0070661_1005111001 | 3300005344 | Corn Rhizosphere | PAEYASGSADLAAGIPPNGEHVVRMFLDASATQQAGYRVYLFYP* |
| Ga0070661_1007352262 | 3300005344 | Corn Rhizosphere | GEYAAAGADPARGIPANGENVVTLFVDASETSQAGYRLYLFYP* |
| Ga0070709_114112891 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEPGDYAAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP* |
| Ga0070681_115223331 | 3300005458 | Corn Rhizosphere | AEYASGSADLAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP* |
| Ga0070706_1013290681 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGTADTAAGIGRNGEVPVKLFIDASATSQAGYRLYLFFP* |
| Ga0070672_1005877872 | 3300005543 | Miscanthus Rhizosphere | SGTADITNGIPANGEVLVKLFIDASATNQAGYRLYLFYP* |
| Ga0068855_1012653971 | 3300005563 | Corn Rhizosphere | VEYAGGTADLGAGIAANSEVLIKMFLDASATSQAGYRLYLFYL* |
| Ga0068861_1018435041 | 3300005719 | Switchgrass Rhizosphere | PSEYAGGTADFAHGIAANGEAVVRLFIDASATTQAGYRLYLFYP* |
| Ga0068862_1020218201 | 3300005844 | Switchgrass Rhizosphere | DRVVVRRALGPTDYAAGTADIARGIAGQAEISLKVFIDASATTQAGYRLYMFYP* |
| Ga0068862_1026458222 | 3300005844 | Switchgrass Rhizosphere | GGTADLQRGIGPNAEASIKMFIDASASAQAGYRLYMFYP* |
| Ga0070766_112937481 | 3300005921 | Soil | VNGAADLGNGIAGGGELNVKLFIDASATTQAGYQVYLFYP* |
| Ga0079037_1024582812 | 3300006224 | Freshwater Wetlands | GTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP* |
| Ga0097621_1017460542 | 3300006237 | Miscanthus Rhizosphere | AGGTANLGAGIQANSEVLVKMFIDASATTQAGYRLYLFYP* |
| Ga0079222_100959591 | 3300006755 | Agricultural Soil | ARGTSELAAGIPANGEVLVKLFIDASATSQAGYRLSFFYP* |
| Ga0066665_108025012 | 3300006796 | Soil | RRVLTPSEYAGGTLDLSKGIPANGEVPIKLFIDASATTQAGYTVYMFYP* |
| Ga0066660_101422803 | 3300006800 | Soil | APGEYISGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP* |
| Ga0075434_1016911181 | 3300006871 | Populus Rhizosphere | YASGSLNFATGFPANSEVLVKTFIDASATTQAGYRLYLYYP* |
| Ga0075424_1010720272 | 3300006904 | Populus Rhizosphere | NEYASGTAEIAGGIPANGEVLVKLFIDASATMQAGYRLYLFYP* |
| Ga0079219_101376401 | 3300006954 | Agricultural Soil | TADIAGGIPANGEAVVRLFIDASATQQAGYRLYLFYP* |
| Ga0105247_111445011 | 3300009101 | Switchgrass Rhizosphere | TTNTGAGIGANGEVPVKLFIDASATSQAGYRLYLFFP* |
| Ga0115027_109080551 | 3300009131 | Wetland | YIGATLDPGRGIPANGEVAVRVFVDASATVQSGYRVYLFYP* |
| Ga0075423_119633732 | 3300009162 | Populus Rhizosphere | GGTVDFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP* |
| Ga0113563_110095702 | 3300009167 | Freshwater Wetlands | ALAPPEYAGGTVDVASGIARNGEVAVKLFVDASATSQAGYRVYLFYP* |
| Ga0105241_102315643 | 3300009174 | Corn Rhizosphere | GEYLSGAANLDGGIAGNAELTVKLFIDASTTSQAGYQVYLFYP* |
| Ga0105249_118435181 | 3300009553 | Switchgrass Rhizosphere | ADLGAGIAANSEVLIKMFLDASATSQAGYRLYLFYL* |
| Ga0105249_120470451 | 3300009553 | Switchgrass Rhizosphere | APTDYAGGTTDLSRGIAANGEVALKVFIDASTTSQAGYRLYMFYP* |
| Ga0126380_104339021 | 3300010043 | Tropical Forest Soil | LESGIRGNAELSIKLFIDASATTQAGYQVYLFYP* |
| Ga0126370_101787941 | 3300010358 | Tropical Forest Soil | SPQEYVGGTVDLDSGIPANGELNVKLFIDASATTQAGYQVYLFYP* |
| Ga0126372_115039041 | 3300010360 | Tropical Forest Soil | DYAGGTSDLQRGIAPNAEVAVKMFIDASATTQAGYRLYMFYP* |
| Ga0126383_131755642 | 3300010398 | Tropical Forest Soil | VDLASGMPGNGELNVKLFIDASATTQAGYQVYLFYP* |
| Ga0134122_125259592 | 3300010400 | Terrestrial Soil | YVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP* |
| Ga0137364_110146282 | 3300012198 | Vadose Zone Soil | IANGIPANGEVLVKLFVDASATTQAGYRLYLFYP* |
| Ga0137380_110703212 | 3300012206 | Vadose Zone Soil | VSGAADIDSGLPPNAELNVKLFIDASATTQAGYQVYLFYP* |
| Ga0137449_10325171 | 3300012227 | Soil | ADLEGGIAPNGEIAFKVFIDASATTQAGYRLYMFYP* |
| Ga0137387_111317271 | 3300012349 | Vadose Zone Soil | DEYASGAADISSGISANSELAVKVFIDASATTQAGYQVYLFYP* |
| Ga0157295_101301212 | 3300012906 | Soil | DFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP* |
| Ga0164302_116780761 | 3300012961 | Soil | PREGIPANGERLVKLFIDASATQQAGYQLYLFYP* |
| Ga0164304_111062092 | 3300012986 | Soil | GEYLSGAANLDSGIAGNAELTVKLFIDASTTSQAGYQVYLFYP* |
| Ga0157373_109202722 | 3300013100 | Corn Rhizosphere | YAPARAGGIAGNGEFVVTLFLDASATSQAGYRLYLFYP* |
| Ga0157370_116887621 | 3300013104 | Corn Rhizosphere | IRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP* |
| Ga0170573_110886512 | 3300013232 | Sediment | MCLSPQVDVVAGIAPNTEAPIKLFIDASATTQAGYRLYAFYP* |
| Ga0157374_126817761 | 3300013296 | Miscanthus Rhizosphere | ADAAGGIAGNGELAVKLFIDASATTQAGYQVYLFYP* |
| Ga0157378_119600511 | 3300013297 | Miscanthus Rhizosphere | ADYAGGTADLQRGIASNGEAAVKVFIDASATAQAGYRLYMFYP* |
| Ga0163162_111025132 | 3300013306 | Switchgrass Rhizosphere | VRLALAPTEYAGGTTDLASGIPGNSEFAIKLFIDASATSQAGYTVVLFYP* |
| Ga0075342_11238151 | 3300014320 | Natural And Restored Wetlands | YAGGTADVAGGIPANAEVVVRLFVDASATRQAGYRLFLFYP* |
| Ga0167650_10636431 | 3300015203 | Glacier Forefield Soil | IWVRGHARRVDYPGAVATLLRGISANGEMLVKLFIDASATTQAGYRLYLFYP* |
| Ga0132256_1038262871 | 3300015372 | Arabidopsis Rhizosphere | SGTVNTVTGIPANGEIPVKLFIDASATVQAGYRLYLFFP* |
| Ga0132255_1055118131 | 3300015374 | Arabidopsis Rhizosphere | LQRGIASNGEASIKVFIDASATAQAGYRLYMFYP* |
| Ga0182038_103484531 | 3300016445 | Soil | PQEYVGGTVDLASGIPGNGELNVKLFIDASATTQAGYQVYVFYP |
| Ga0183260_106224611 | 3300017787 | Polar Desert Sand | RALAPPDYMRGIVDLTHGIPGNGEAQVKLFVDASATTQAGYRLYLFFP |
| Ga0163161_109881442 | 3300017792 | Switchgrass Rhizosphere | SPTDYVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP |
| Ga0184632_104060611 | 3300018075 | Groundwater Sediment | SEYISGAADPALGIAGNTELPVKLFIDASATTQAGYQVYLFYP |
| Ga0184632_104410021 | 3300018075 | Groundwater Sediment | GAADLGSGLAGNAELNVKLFIDASATTQAGYQVYLFYP |
| Ga0190274_102581881 | 3300018476 | Soil | NAAVGIPGNGEVPVRLFIDASATSQAGYRLYLFFP |
| Ga0066669_103172163 | 3300018482 | Grasslands Soil | SGAANLDSGVAGNAELTVKLFIDASTTSQAGYQVYLFYP |
| Ga0173482_105086352 | 3300019361 | Soil | ASGSADIAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP |
| Ga0210401_106474683 | 3300020583 | Soil | PQEYVSGAANLDNGIPGNGELNVKLFIDASATSQAGYQVYLFYP |
| Ga0210384_108859401 | 3300021432 | Soil | DLESGIPGNAELSVKLFIDASATTQAGYQVYLFYP |
| Ga0222622_110240661 | 3300022756 | Groundwater Sediment | GTADLATGIAGNAEVGIKLFIDASATTQAGYQVYLFYP |
| Ga0207692_108364581 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DPAAGIPGNGENVVKLFLDASTTAQAGYRLYLFYP |
| Ga0207642_100376531 | 3300025899 | Miscanthus Rhizosphere | NLDAGIAGNAELTVKLFIDASTTSQAGYQVYLFYP |
| Ga0207710_106901471 | 3300025900 | Switchgrass Rhizosphere | TTNTGAGIGANGEVPVKLFIDASATSQAGYRLYLFFP |
| Ga0207699_110705741 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEPGDYAAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP |
| Ga0207684_114497321 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGTADTAAGIGRNGEVPVKLFIDASATSQAGYRLYLFFP |
| Ga0207663_106933521 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRLYAGGTADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP |
| Ga0207649_108209702 | 3300025920 | Corn Rhizosphere | LSGAANLDSGIAGNAELTVKLFIDASTTSQAGYQVYLFYP |
| Ga0207652_110233252 | 3300025921 | Corn Rhizosphere | RASDPAAGIPGNGENVVKLFLDASTTAQAGYRLYLFYP |
| Ga0207700_117884252 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP |
| Ga0207701_105004212 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGTADPHQGIPPNGERIIRMFLDASATQQAGYRLYLFYP |
| Ga0207690_100247365 | 3300025932 | Corn Rhizosphere | TADIGGGIPANGESVVRLFIDASATQQAGYRLYLFYP |
| Ga0207690_107443411 | 3300025932 | Corn Rhizosphere | YAAAGADPARGIPANGENVVTLFVDASETSQAGYRLYLFYP |
| Ga0207667_119410362 | 3300025949 | Corn Rhizosphere | LAPTEYARGTSELAAGIPANGEVLVKLFIDASATSQAGYRLSFFYP |
| Ga0207651_119818632 | 3300025960 | Switchgrass Rhizosphere | ALAPADYAGGTADLQRGIAPNAEASIKVFIDASASTQAGYRLYMFYP |
| Ga0210105_10055332 | 3300025966 | Natural And Restored Wetlands | GGTVDVGAGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0207639_110232762 | 3300026041 | Corn Rhizosphere | ADFHAGIAVNGERLVKLFIDASATQQAGYQLYLFYP |
| Ga0207639_117936922 | 3300026041 | Corn Rhizosphere | DIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP |
| Ga0207641_102160402 | 3300026088 | Switchgrass Rhizosphere | TADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP |
| Ga0207641_106586553 | 3300026088 | Switchgrass Rhizosphere | YASGTVDVSRGILGGSEMPIKMFVDASATSQAGYRLYLFYP |
| Ga0210000_10806332 | 3300027462 | Arabidopsis Thaliana Rhizosphere | EYASGSADLAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP |
| Ga0209392_12615351 | 3300027683 | Freshwater Sediment | ALAPPEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0209293_101064311 | 3300027877 | Wetland | PEYAGGTVDVESGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0209486_102536901 | 3300027886 | Agricultural Soil | PAEYAGGTANVRAGIAGNGELAVKLFIDASATTQSGYRVYLFYP |
| Ga0209668_103135972 | 3300027899 | Freshwater Lake Sediment | AGGTADLGGGIAPNGEIALKVFIDASATSQAGYRLYMFYP |
| Ga0268265_103728362 | 3300028380 | Switchgrass Rhizosphere | PTDYVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP |
| Ga0311350_108194041 | 3300030002 | Fen | GEYAGGTADLATGIPANGEAAVKLFIDASATTQAGYRLYLFYP |
| Ga0311349_101810383 | 3300030294 | Fen | AADPRAGIPGNTELAVKLFVDASATSQAGYQVYLFYP |
| Ga0318496_107894091 | 3300031713 | Soil | DIANGIAGNGEVVVKLFIDASATTQSGYLLYLFYP |
| Ga0302321_1003886791 | 3300031726 | Fen | APADYAGALDLAKGIPPDGEIPIKLFIDASATTQAGYYLYMFYP |
| Ga0307413_112931941 | 3300031824 | Rhizosphere | SDYAGGTADVAGGIAANGEALVRLFIDASATTQAGYRLYLFYP |
| Ga0318551_108287711 | 3300031896 | Soil | YVSGTADIANGIAGNGEVVVKLFIDASATTQSGYLLYLFYP |
| Ga0308174_105900312 | 3300031939 | Soil | GTADLAAGMAANGERLVKLFIDASATQQAGYQLYLFYP |
| Ga0308176_108286211 | 3300031996 | Soil | SEYAGGTADVATGIAANGEAVVRLFIDASATSQAGYRLYLFYP |
| Ga0315284_121011352 | 3300032053 | Sediment | ADLGGGIAANEEVAFKVFIDASATTQAGYRLYMFYP |
| Ga0318524_103370392 | 3300032067 | Soil | RAFTPQEYVGGTVDLENGIAGNGELNVKLFIDASATTQAGYQVYLFYP |
| Ga0318518_103739591 | 3300032090 | Soil | DYAGGTADLQRGIAPNAEASVKVFIDASATTQAGYRLYMFYP |
| Ga0315281_106293512 | 3300032163 | Sediment | VRRALAPVDYAGGTADLLRGIGPNGEVALKVFIDASATTQAGYRLYMFYP |
| Ga0315283_116532671 | 3300032164 | Sediment | SEYAGGTADLTAGIPANGEVAIKVFIDASATAQAGYRVYLFYA |
| Ga0315268_121344532 | 3300032173 | Sediment | DLEGGIAPNGEVAFKVFIDASATSQAGYRLYMFYP |
| Ga0307470_101454352 | 3300032174 | Hardwood Forest Soil | ADYVGGTTDLSRGIAANGEVALKVFIDASATSQAGYRLYMFYP |
| Ga0307471_1035033991 | 3300032180 | Hardwood Forest Soil | DLDNGIPGNGELNVKLFVDASATTQAGYQVYLFYP |
| Ga0307472_1014089382 | 3300032205 | Hardwood Forest Soil | PQEYVSAAADLDNGIPGNGELNVKLFVDASATTQAGYQVYLFYP |
| Ga0310812_102477242 | 3300032421 | Soil | ADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP |
| Ga0315273_117617811 | 3300032516 | Sediment | SDYAGGAADLTKGIAPNAEVPVKLFIDASATSQAGYYLYMFYP |
| Ga0315273_132294431 | 3300032516 | Sediment | YAGGTADLQRGISPNGEVAVKVFIDASATSQAGYRLYMFYP |
| Ga0335079_100248018 | 3300032783 | Soil | TPQEYLSGTVDLASGIPANAEVNVKLFIDASATTQAGYQVYLFYP |
| Ga0335080_123141032 | 3300032828 | Soil | QEYLSGKVDLASGIPGNGELNVKLFIDASATNQAGYQVYLFYP |
| Ga0316604_106779651 | 3300033406 | Soil | LAPPEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0316603_118606181 | 3300033413 | Soil | APQEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0316603_121045841 | 3300033413 | Soil | GGTVDVGAGIGRNGEVAVKLFVDASATTQAGYRVYLFYP |
| Ga0316625_1023204931 | 3300033418 | Soil | VVRRALTPAEYVGGTVDLARGIPANSDIAVKLFIDASATTQAGYRLFLFYG |
| Ga0326726_106539761 | 3300033433 | Peat Soil | EYVSGAADLDSGLRGNAELNIKLFIDASATTQAGYQVYLFYP |
| Ga0316629_102337202 | 3300033483 | Soil | GGTADVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0316616_1013580032 | 3300033521 | Soil | VVVRRALAPPEYAGGTVDVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0316616_1045276561 | 3300033521 | Soil | EYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP |
| Ga0314862_0033644_914_1036 | 3300033803 | Peatland | LSGAADPGNGFAANSELAIKLFIDASATSQAGYQVYLFYP |
| ⦗Top⦘ |