NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065874

Metagenome / Metatranscriptome Family F065874

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065874
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 45 residues
Representative Sequence DEIAAKLKEIDCFEEVTKGAITEVSGGAKQFTLTIASKCP
Number of Associated Samples 110
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.64 %
% of genes from short scaffolds (< 2000 bps) 98.43 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (80.315 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(10.236 % of family members)
Environment Ontology (ENVO) Unclassified
(29.134 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(31.496 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.71%    β-sheet: 23.53%    Coil/Unstructured: 61.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF04612T2SSM 22.83
PF13502AsmA_2 2.36
PF10741T2SSM_b 2.36
PF00795CN_hydrolase 0.79
PF13280WYL 0.79
PF00122E1-E2_ATPase 0.79
PF02446Glyco_hydro_77 0.79
PF04350PilO 0.79
PF05134T2SSL 0.79
PF01242PTPS 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG3149Type II secretory pathway, component PulMIntracellular trafficking, secretion, and vesicular transport [U] 22.83
COG3167Type IV pilus assembly protein PilOCell motility [N] 1.57
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.79
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.79
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.79
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.79
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.79
COG3297Type II secretory pathway, component PulLIntracellular trafficking, secretion, and vesicular transport [U] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A80.31 %
All OrganismsrootAll Organisms19.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_13403258Not Available519Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105455634Not Available1408Open in IMG/M
3300000955|JGI1027J12803_105208193Not Available697Open in IMG/M
3300001213|JGIcombinedJ13530_100815317Not Available650Open in IMG/M
3300001213|JGIcombinedJ13530_106040804Not Available1638Open in IMG/M
3300001213|JGIcombinedJ13530_109496753Not Available804Open in IMG/M
3300003323|rootH1_10168793Not Available1544Open in IMG/M
3300004479|Ga0062595_100527327All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium896Open in IMG/M
3300004643|Ga0062591_101891135Not Available612Open in IMG/M
3300005175|Ga0066673_10247130Not Available1032Open in IMG/M
3300005186|Ga0066676_10889498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales598Open in IMG/M
3300005293|Ga0065715_10323932All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium996Open in IMG/M
3300005338|Ga0068868_100720543Not Available894Open in IMG/M
3300005438|Ga0070701_10565312Not Available748Open in IMG/M
3300005466|Ga0070685_10610472Not Available786Open in IMG/M
3300005529|Ga0070741_10375644All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1312Open in IMG/M
3300005535|Ga0070684_100956436Not Available803Open in IMG/M
3300005544|Ga0070686_101794803Not Available522Open in IMG/M
3300005563|Ga0068855_100416218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1471Open in IMG/M
3300005617|Ga0068859_102288893Not Available596Open in IMG/M
3300005618|Ga0068864_101151011Not Available773Open in IMG/M
3300005712|Ga0070764_10715848Not Available618Open in IMG/M
3300005834|Ga0068851_10856102Not Available567Open in IMG/M
3300005836|Ga0074470_11619453Not Available1758Open in IMG/M
3300005841|Ga0068863_100237000Not Available1761Open in IMG/M
3300005843|Ga0068860_102512537Not Available535Open in IMG/M
3300006237|Ga0097621_100844980Not Available850Open in IMG/M
3300006755|Ga0079222_10695146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi803Open in IMG/M
3300006881|Ga0068865_102048700All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium520Open in IMG/M
3300007799|Ga0105049_10212086Not Available1648Open in IMG/M
3300009012|Ga0066710_101308906Not Available1124Open in IMG/M
3300009093|Ga0105240_12611339All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium522Open in IMG/M
3300009100|Ga0075418_10478671Not Available1335Open in IMG/M
3300010397|Ga0134124_11182068Not Available784Open in IMG/M
3300010401|Ga0134121_11288019Not Available735Open in IMG/M
3300010877|Ga0126356_11242264Not Available599Open in IMG/M
3300012469|Ga0150984_121359589Not Available548Open in IMG/M
3300012913|Ga0157298_10077535All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300012929|Ga0137404_10432617Not Available1165Open in IMG/M
3300012930|Ga0137407_11940493Not Available562Open in IMG/M
3300012989|Ga0164305_12090565Not Available519Open in IMG/M
3300014309|Ga0075317_1035932Not Available957Open in IMG/M
3300014325|Ga0163163_10882835Not Available957Open in IMG/M
3300014325|Ga0163163_11971162All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium644Open in IMG/M
3300014498|Ga0182019_10738495Not Available700Open in IMG/M
3300014498|Ga0182019_11445285Not Available511Open in IMG/M
3300014502|Ga0182021_12551974Not Available615Open in IMG/M
3300014502|Ga0182021_13169068Not Available549Open in IMG/M
3300014745|Ga0157377_11086878Not Available612Open in IMG/M
3300014839|Ga0182027_10952327Not Available883Open in IMG/M
3300014969|Ga0157376_10320486Not Available1473Open in IMG/M
3300015164|Ga0167652_1058857Not Available701Open in IMG/M
3300015200|Ga0173480_11165493Not Available518Open in IMG/M
3300015245|Ga0137409_11509850Not Available520Open in IMG/M
3300015371|Ga0132258_13155955Not Available1138Open in IMG/M
3300018073|Ga0184624_10097430Not Available1254Open in IMG/M
3300019785|Ga0182022_1005210Not Available588Open in IMG/M
3300021401|Ga0210393_11278918All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium589Open in IMG/M
3300021403|Ga0210397_10510743Not Available911Open in IMG/M
3300021475|Ga0210392_11470246Not Available509Open in IMG/M
3300022835|Ga0224537_1001608Not Available1386Open in IMG/M
3300025914|Ga0207671_10165143Not Available1716Open in IMG/M
3300025917|Ga0207660_11229720Not Available609Open in IMG/M
3300025937|Ga0207669_11960417Not Available501Open in IMG/M
3300025939|Ga0207665_11233499All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium597Open in IMG/M
3300025949|Ga0207667_12007312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300025960|Ga0207651_10369611All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300025980|Ga0210137_1067462Not Available554Open in IMG/M
3300025981|Ga0207640_10241068All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1397Open in IMG/M
3300025981|Ga0207640_10593793Not Available936Open in IMG/M
3300025986|Ga0207658_11876565Not Available546Open in IMG/M
3300026095|Ga0207676_12268653All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300026116|Ga0207674_10471978Not Available1213Open in IMG/M
3300026116|Ga0207674_10609456Not Available1055Open in IMG/M
3300026121|Ga0207683_10629128All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium994Open in IMG/M
3300026373|Ga0256817_1035019Not Available514Open in IMG/M
3300027905|Ga0209415_10564064Not Available855Open in IMG/M
3300027915|Ga0209069_11040735Not Available504Open in IMG/M
3300028653|Ga0265323_10032460All Organisms → cellular organisms → Bacteria1936Open in IMG/M
3300029957|Ga0265324_10200150Not Available678Open in IMG/M
3300029984|Ga0311332_11476505Not Available551Open in IMG/M
3300030000|Ga0311337_11368721Not Available620Open in IMG/M
3300030114|Ga0311333_10791821Not Available795Open in IMG/M
3300030339|Ga0311360_11279345Not Available576Open in IMG/M
3300030339|Ga0311360_11370877Not Available554Open in IMG/M
3300030838|Ga0311335_11207456Not Available543Open in IMG/M
3300031200|Ga0307496_10071729Not Available627Open in IMG/M
3300031231|Ga0170824_113560072All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium542Open in IMG/M
3300031239|Ga0265328_10195445Not Available767Open in IMG/M
3300031239|Ga0265328_10378220Not Available554Open in IMG/M
3300031241|Ga0265325_10068651Not Available1784Open in IMG/M
3300031242|Ga0265329_10092855Not Available958Open in IMG/M
3300031247|Ga0265340_10183676Not Available945Open in IMG/M
3300031249|Ga0265339_10259320Not Available839Open in IMG/M
3300031250|Ga0265331_10378929Not Available634Open in IMG/M
3300031572|Ga0318515_10248778All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium953Open in IMG/M
3300031595|Ga0265313_10207185All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium814Open in IMG/M
3300031595|Ga0265313_10296358Not Available651Open in IMG/M
3300031681|Ga0318572_10680000All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium613Open in IMG/M
3300031726|Ga0302321_100758098Not Available1092Open in IMG/M
3300031726|Ga0302321_101371405Not Available813Open in IMG/M
3300031726|Ga0302321_101389940Not Available807Open in IMG/M
3300031726|Ga0302321_101464915Not Available786Open in IMG/M
3300031726|Ga0302321_102951632Not Available555Open in IMG/M
3300031753|Ga0307477_10437566Not Available893Open in IMG/M
3300031770|Ga0318521_10394363Not Available824Open in IMG/M
3300031902|Ga0302322_101398903Not Available852Open in IMG/M
3300031902|Ga0302322_103200678Not Available562Open in IMG/M
3300031902|Ga0302322_103788054Not Available517Open in IMG/M
3300031918|Ga0311367_11617230Not Available633Open in IMG/M
3300031943|Ga0310885_10363516All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium763Open in IMG/M
3300031981|Ga0318531_10466504Not Available572Open in IMG/M
3300032001|Ga0306922_11943156Not Available575Open in IMG/M
3300032002|Ga0307416_103520571Not Available524Open in IMG/M
3300032035|Ga0310911_10863639Not Available522Open in IMG/M
3300032067|Ga0318524_10248966Not Available914Open in IMG/M
3300032094|Ga0318540_10302099All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium772Open in IMG/M
3300032261|Ga0306920_101954801Not Available823Open in IMG/M
3300032261|Ga0306920_104345670All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium509Open in IMG/M
3300032955|Ga0335076_11214412Not Available638Open in IMG/M
3300033290|Ga0318519_10519619Not Available718Open in IMG/M
3300033487|Ga0316630_11443126Not Available619Open in IMG/M
3300033798|Ga0334821_033978Not Available1023Open in IMG/M
3300033827|Ga0334848_055054Not Available722Open in IMG/M
3300034070|Ga0334822_011217Not Available2190Open in IMG/M
3300034170|Ga0370487_0274068Not Available569Open in IMG/M
3300034195|Ga0370501_0017438Not Available2060Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen10.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere8.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.51%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.15%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.94%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.57%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.57%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.57%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.57%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.79%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.79%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.79%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.79%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.79%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.79%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022835Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 10-14EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025980Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026373Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034170Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1340325813300000363SoilAVDEMAAKLKEIDCVEDVNKGAITEVSGGSKQFTLTIGAKCP*
INPhiseqgaiiFebDRAFT_10545563413300000364SoilFLKGTVDTAAAVDEMAAKLKEIDCFDDVNKGSITEVAGGAKQFTLNIGAKCP*
JGI1027J12803_10520819323300000955SoilIRGTVDAAAAVDDIVAKLKEMECFEEITKGAISEVSGGAKNFTLTIASKCP*
JGIcombinedJ13530_10081531713300001213WetlandKLKEIECFEEITKGPISEVSGGAKQFSLTVASKCP*
JGIcombinedJ13530_10604080433300001213WetlandSAAAVDEIVAKLKEIECFEEISKGPISEVAGGAKQFSLSIASKCP*
JGIcombinedJ13530_10949675313300001213WetlandKLKEIDCFDEISKGPITEVSGGAKQFSLNIAAKCP*
rootH1_1016879323300003323Sugarcane Root And Bulk SoilAVDEMAEKLKTIDCVESVQKGAITEVADGAKQFTLNVSSKCP*
Ga0062595_10052732723300004479SoilVDEMAAKLKEIDCFDEVNKGSITEVSGGAKQFTLTVSAKCP*
Ga0062591_10189113513300004643SoilPKKTTIRGTIDSATSVDDMVTQLKQIDCFEDISKGPITEVSGGNKQFILTITSKCP*
Ga0066673_1024713013300005175SoilTSVDDMVAQLKLIDCFEEITKGPVTEVSGGSKQFLLTINSKCP*
Ga0066676_1088949823300005186SoilFIKGTVDTAAAVDEIASKLKEIDCFEEVTKGAITEVSDGGKQFTLNVTSKCP*
Ga0065715_1032393213300005293Miscanthus RhizosphereAAVDDMAAKLKEIDCFDEVSKGAITEVSGGAKQFTLTVSAKCP*
Ga0068868_10072054313300005338Miscanthus RhizosphereDEMAAKLKEIDCVEDVNKGAITEVSGGAKQFTLTIGAKCP*
Ga0070701_1056531213300005438Corn, Switchgrass And Miscanthus RhizosphereAAVDEIGTKLKEIECYEEVSKGAITEVSGGGKQFTISINAKCP*
Ga0070685_1061047213300005466Switchgrass RhizosphereKAFLKGTVDTAAAVDEMAAKLKEIDCVEDVNKGAITEVSGGAKQFTLTIGAKCP*
Ga0070741_1037564433300005529Surface SoilDSASAVDEMSVKLKEIDCFEDIGKGAITEVSGGAKQFTLTIASKCP*
Ga0070684_10095643623300005535Corn RhizosphereTVDTAKAVDDMATKLKEIDCVEDVSKGSITEVSGGSKQFTLTIGAKCP*
Ga0070686_10179480313300005544Switchgrass RhizosphereIKGTVDSGAAVDEIATKLKEIDCFEDVTKGAITEVTGGKQFTLTIASKCP*
Ga0068855_10041621833300005563Corn RhizosphereAAAVDEIATKLKEIDCFDDVTKGAITEVSGGAKQFTLTVATKCP*
Ga0068859_10228889313300005617Switchgrass RhizosphereIRGTIDSATSVDDMVAQLKLIDCFEEITKGPITEVSGGNKQFILTVNSKCP*
Ga0068864_10115101123300005618Switchgrass RhizosphereTSVDDMVTQLRLIDCFEEITKGPVTEVSGGSKQFLLTINSKCP*
Ga0070764_1071584823300005712SoilVDDIAAKLKDIDCFDEVTKGAITEVSGGGKQFTLTVASKCP*
Ga0068851_1085610223300005834Corn RhizosphereVDEIATKLKEIDCFDEITKGAITEVSGGAKQFSLTISSKCP*
Ga0074470_1161945333300005836Sediment (Intertidal)VDSATAVDEIAEKLKAIDCYDEVTKGAVTEVSDGAKQFTLNVTSRCP*
Ga0068863_10023700013300005841Switchgrass RhizosphereTVDTAAAVDEMATKLKEIDCFDDVNKGSITEVAGGAKQFTLTISGKCP*
Ga0068860_10251253713300005843Switchgrass RhizosphereVDEIAEKLKEIDCYEDVTKGTVTEVSGDAKQFTLSVASKCP*
Ga0097621_10084498033300006237Miscanthus RhizosphereAAKLKEIDCVEEVNKGAITEVAGGAKQFTLNIGSKCP*
Ga0079222_1069514613300006755Agricultural SoilEIAAKLKEIDCFEEVSKGAITEVSGGAKQFSLTINSKCP*
Ga0068865_10204870023300006881Miscanthus RhizosphereMAAKLKEIDCFDEVNKGSITEVSGGAKQFTLTVSAKCP*
Ga0105049_1021208613300007799FreshwaterAVDEMVVALKEIDCFEEIQKGAITEVSGGEKLFTLNIKSKCP*
Ga0066710_10130890633300009012Grasslands SoilDELVAGLKQIDCFEDIKKGPITEVSGGSKQFLLNIDSKCP
Ga0105240_1261133913300009093Corn RhizosphereIKGTADTAAAVDDIAAKLKEIECFEEVTKGAITEVSGGGKQFTLTIASKCP*
Ga0075418_1047867113300009100Populus RhizosphereKKAFLKGTVDTAAAVDEMATKLKEIDCVEDVNKGAITEVSGGSKQFTLTIGAKCP*
Ga0134124_1118206813300010397Terrestrial SoilMKGTVDTAAAVDEMATKLKEIDCFDDVSKGTVTEVSGGSKQFTLTIGAKCP*
Ga0134121_1128801923300010401Terrestrial SoilVDSAAAVDEIGTKLKEIECYEEVSKGAITEVSGGGKQFTISINAKCP*
Ga0126356_1124226423300010877Boreal Forest SoilVDDMATRLKDIECFEDITKGAITEVTGGAKQFTLTITSKCP*
Ga0150984_12135958913300012469Avena Fatua RhizosphereAVDEIATKLKEISDCYDEVSKGAVTEVSGGGKQFTLTIASRCP*
Ga0157298_1007753523300012913SoilRLAVAVDEMAAKLKEIDCVEDVNKGAITEVSGGVKQFTLTIGAKCP*
Ga0137404_1043261733300012929Vadose Zone SoilIKGTVDSGAAVDEMAAKFKDIECFDEITKGAITEVSGGGKQFTLNITSRCP*
Ga0137407_1194049313300012930Vadose Zone SoilKFKDIECFDEITKGAITEVSGGAKQFTLTINSRCP*
Ga0164305_1209056523300012989SoilMAAKLKEIDCFEDVTKGAITEVSGGAKQFTLTIGSKCP*
Ga0075317_103593213300014309Natural And Restored WetlandsVDSSALLNNVVAKLKTVDCFEEISKGPLTEVSGGAKQFSLTISSKCP*
Ga0163163_1088283533300014325Switchgrass RhizosphereKGTVDSATAVDEIAEKLNEIDCYEDVTKGTVTEVSGDAKQFTLSVASKCP*
Ga0163163_1197116223300014325Switchgrass RhizosphereAKLKEIDCFDEVNKGSITEVSGGAKQFTLTVSAKCP*
Ga0182019_1073849513300014498FenAAKLKEIDCFDEVTKGAITEVSDGSKQFTLNVTSKCP*
Ga0182019_1144528513300014498FenEVVAKLKEVGCFEEISKGPITEVSGGAKQFSLTIASKCP*
Ga0182021_1255197423300014502FenAASLDDVVTKLKEIDCFEEINKGPLTEVSGGQKQFSLTINSKCP*
Ga0182021_1316906813300014502FenKKTSIKGTVDSAAALDEVVAKLKEVDCFEEISKGPLTEVSGGGKQFSLAINSKCP*
Ga0157377_1108687823300014745Miscanthus RhizosphereAAAVDEMATKLKEVECFEEITKGAITEVSGGAKQFSLNIASRCP*
Ga0182027_1095232713300014839FenKTSIKGTVDSAAALDDVVAKLKEIDSFEEINKGPLTEVSDGAKQFSLAINSKCP*
Ga0157376_1032048613300014969Miscanthus RhizosphereIAAKLKEIDCVEEVNKGAITEVAGGAKQFTLNIGSKCP*
Ga0167652_105885713300015164Glacier Forefield SoilVDSATAVDEIAAKLKEIACYDEVTKGAVTEVSEEAKQFTLTVGSKCP*
Ga0173480_1116549313300015200SoilVRDVDEMAAKLKEIDCFEDVTKGAITEVSGGAKQFTLTIGSKCP*
Ga0137409_1150985023300015245Vadose Zone SoilEMAGKFKDIECFDEITKGAITEVSGGAKQFTLNINSRCP*
Ga0132258_1315595513300015371Arabidopsis RhizosphereGTVDSGAAVDEIATKLKEIDCFEEVTKGAITEVSGGAKQFTLNVTSKCP*
Ga0184624_1009743013300018073Groundwater SedimentAAVDEIAAKLKEIDCVEDVNKGAITEVSGGSKQFTLTIGAKCP
Ga0182022_100521023300019785FenAALDDVVAKLKEIDCFEEINKGPLTEVSDGAKQFSLAINSKCP
Ga0210393_1127891813300021401SoilGTVDSAAAVDDMATKLRDIECFEEITKGAITEVSGGAKQFTLTIAAKCP
Ga0210397_1051074333300021403SoilDEMANKFKDIECFEEITKGAITEVSGGGKQFTLNITSRCP
Ga0210392_1147024613300021475SoilAVDEIAAKLKEIDCFEEVTKGAITEVSDGGKQFTLNVTSKCP
Ga0224537_100160813300022835SoilKKTSIKGTVDSAAALDDVVAKLKEIDCFEEINKGPLTEVSDGAKQFSLAINSKCP
Ga0207671_1016514313300025914Corn RhizosphereKTFIKGTVDSATAVDEIAEKLKEIDCYEDVTKGTVTEVSGDAKQFTLSVASKCP
Ga0207660_1122972023300025917Corn RhizosphereAVDEIGAKLKEIDCYEDVSKGAITEVSGGGKQFTISINSKCP
Ga0207669_1196041723300025937Miscanthus RhizosphereDTAAAVDEMAAKLKEIDCFDEVNKGAITEVAGGAKQFTLTIGSKCP
Ga0207665_1123349913300025939Corn, Switchgrass And Miscanthus RhizosphereKGTADTAAAVDDIAAKLKEIECFEEVTKGAITEVSGGGKQFTLTIASKCP
Ga0207667_1200731223300025949Corn RhizosphereKTFIKGTADTAAAVDEIASKLKEIDCFEEVTKGAITEVSGGAKQFTLNIASKCP
Ga0207651_1036961133300025960Switchgrass RhizosphereAKLKEIDCVEDVNKGAITEVSGGAKQFTLTIGAKCP
Ga0210137_106746223300025980Natural And Restored WetlandsDEIVAKLKGVECFEEISKGPITEVSGGAKQFSLAIASKCP
Ga0207640_1024106813300025981Corn RhizosphereSASAVDDMAAKLKEIDCFDEVSKGAITEVSGGAKQFTLTVSAKCP
Ga0207640_1059379313300025981Corn RhizosphereVDSATAVDEIAEKLKEIDCYEDVTKGTVTEVSGDAKQFTLSVASKCP
Ga0207658_1187656523300025986Switchgrass RhizosphereVDTAAAVDEIASRLKEIDCYDDVNKGAITEVSGGAKQFTLTIGAKCP
Ga0207676_1226865333300026095Switchgrass RhizosphereDLVSQLKQIDCFEDITKGPITEVSGGSKQFILTINSKCP
Ga0207674_1047197833300026116Corn RhizosphereTDSGAAVDEIAAKLKEIDCFEDVTKGAITEVSEGGKQFTLNINSKCP
Ga0207674_1060945613300026116Corn RhizosphereAVDEIAEKLKEIDCYEDVTKGTVTEVSGDAKQFTLSVASKCP
Ga0207683_1062912813300026121Miscanthus RhizosphereKGTVDTAAAVDEMTAKLKEIDCFEEVTKGAITEVSGGAKQFTLTIGSKCP
Ga0256817_103501913300026373SedimentAVDEIVAKLKEIECFEDISKGPITEVSGGAKQFSLAITSKCP
Ga0209415_1056406423300027905Peatlands SoilTAAAVDDIAAKLKEIDCFDEVTKGAITEVSDGGKQFTLTIASKCP
Ga0209069_1104073513300027915WatershedsIKGTVDSAAAVDEIGAKLKEIECYEDVSKGAITEVSGGGKQFTINVNSKCP
Ga0265323_1003246013300028653RhizosphereSAAALDDVVAKLKEIDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0265324_1020015013300029957RhizosphereDEIAERLKEIDCYEEVSKGAVTEVSDESKQFTLNVTSKCP
Ga0311332_1147650523300029984FenIAEKLKEIDCYEEVTKGAVTEVSEDAKQFTLNVGSKCP
Ga0311337_1136872123300030000FenAAAVDEIVAKLKGVECFEEISKGPITEVSGGAKQFSLAIASKCP
Ga0311333_1079182113300030114FenKGTVDSAASVDEIVAKLKGVDCFEEISKGPISEVSGGAKQFSLAIASKCP
Ga0311360_1127934523300030339BogATAVDEIAERLKEIDCYEEVTKGAITEVSDESKQFTLNVTSKCP
Ga0311360_1137087723300030339BogTIDSAAAVDEIVARLKEIECFEDISKGPITEVSGGAKQFSLSIAAKCP
Ga0311335_1120745613300030838FenKTSIKGTVDSAAALDDVVAKLKEIDCFEEINKGPLTEVSGGGKQFSLTINSKCP
Ga0307496_1007172913300031200SoilTVDSATAVDEITEKLKEIDCYEEVTKGAITEVSDGAKQFTLNVASKCP
Ga0170824_11356007213300031231Forest SoilDEIAAKLKEIDCFEEVTKGAITEVSGGAKQFTLTIASKCP
Ga0265328_1019544523300031239RhizosphereALDDVVAKLKEIDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0265328_1037822023300031239RhizosphereMAGKFKDIECFDEVTKGAITEVSGGGKQFTLTINSRCP
Ga0265325_1006865133300031241RhizosphereAKLKEIDCFEEVTKGAITEVSDGGKQFTLNVTSKCP
Ga0265329_1009285533300031242RhizosphereLEIKSKKTSIKGTIDSAASLDDVVAKLKEVDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0265340_1018367633300031247RhizosphereTIDSAASLDDVVAKLKEVDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0265339_1025932023300031249RhizosphereDSAAALDDVVAKLKEIDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0265331_1037892923300031250RhizosphereIKGTVDTATAVDEIAERLKDIDCYEDVTKGTVTEVSGDAKQFTLTVGAKCP
Ga0318515_1024877813300031572SoilGTVDSGAAVDEIATKLKEIDCFDEIAKGAITEVSGGGKQFTLTINTKCP
Ga0265313_1020718513300031595RhizosphereGTVDSAAAVDEMAGKFKDIECFDEVTKGAITEVSGGGKQFTLTINSRCP
Ga0265313_1029635823300031595RhizosphereVDEIAAKLKEIDCFEEVTKGAITEVSDGGKQFTLNVTSKCP
Ga0318572_1068000013300031681SoilTFIKGTVDSGAAVDEIATKLKEIDCFDEIAKGAITEVSGGGKQFTLTINTKCP
Ga0302321_10075809833300031726FenVDEIVAKLKGVECFEEISKGPITEVSGGAKQFSLAIASKCP
Ga0302321_10137140513300031726FenKAKKATIKGTVDSAASVDDVVAKLKEIDCFEEISKGPISEVAGGLKQFSLTITSKCQ
Ga0302321_10138994023300031726FenDSAAALDDVVAKLKEIDCFEEISKGPLTEVSGGGKQFSLTINSKCP
Ga0302321_10146491513300031726FenIKGTIDSAAAVDDVVAKLKEIECFEEISKGPITEVSGGAKQFSLNITSKCP
Ga0302321_10295163213300031726FenDEIVAKLKEIECFEEISKGPITEVSGGAKQFSLNITSKCP
Ga0307477_1043756623300031753Hardwood Forest SoilDSGAAVDEMAAKFKDIECFEEITKGAITEVSGGGKQFTLNITSRCP
Ga0318521_1039436333300031770SoilAKLKEIDCFEDVTKGAITEVSGGAKQFTLTITGKCP
Ga0302322_10139890323300031902FenKGTVDSAAALDEVVAKLKEIDCFEEINKGPLTEVSGGGKQFSLAINSKCP
Ga0302322_10320067813300031902FenAVDEVVAMLKGVECFEEISKGPISEVSGGAKQFSLVIASKCP
Ga0302322_10378805423300031902FenVVAKLKEVDCFEEINKGPLTEVSGGAKQFSLTINSKCP
Ga0311367_1161723023300031918FenVVAKLKEIDCFEEINKGPLTEVSDGAKQFSLAINSKCP
Ga0310885_1036351623300031943SoilVDEMAAKLKEIDCFDEVSKGAITEVSGGAKQFTLTVSAKCP
Ga0318531_1046650413300031981SoilIKGTADSGAAVDEIAAKLKEIDCFEDVTKGAITEVSEGGKQFSLTINSKCP
Ga0306922_1194315613300032001SoilMASKFKDIECFEEVTKGAITEVSGGAKQFTLNITSKCP
Ga0307416_10352057123300032002RhizosphereTAVDEIAEKLKEIECYDEVTKGAVTEVSGETKQFTLSVGAKCP
Ga0310911_1086363913300032035SoilTFIKGTADSGAAVDEIAAKLKEIDCFEDVTKGAITEVSEGGKQFSLTINSKCP
Ga0318524_1024896613300032067SoilFIKGTADSGAAVDEIAAKLKEIDCFDDVTKGAITEVSEGGKQFSLNINAKCP
Ga0318540_1030209923300032094SoilATKLKEIDCFDEIAKGAITEVSGGGKQFTLTINTKCP
Ga0306920_10195480123300032261SoilEMAGKFKDIECFDEITKGAITEVSGGAKQFTLNITSRCP
Ga0306920_10434567013300032261SoilVDDIAAKLKEIDCFEEVTKGAITEVSGGGKQFTLTINTKCP
Ga0335076_1121441223300032955SoilDLATKLKEIDCYDEITKGSITEVSGGAKQFTLTITSRCP
Ga0318519_1051961923300033290SoilFIKGTADSGAAVDEIAAKLKEIDCFEDVTKGAITEVSEGGKQFSLTINSKCP
Ga0316630_1144312613300033487SoilIDSAAAVDEIVAKLKEIDCFEDISKGPITEVSGGAKQFSLAITSKCP
Ga0334821_033978_838_10233300033798SoilDLEIKAKKTSIKGTVDSAAALDEVVAKLKEVDCFEEISKGPLTEVSGGGKQFSLAINSKC
Ga0334848_055054_564_7193300033827SoilMKGTIDSAAAVDEIVAKLKGVECFEEISKGPITEVSDGAKQFSLAIASRCP
Ga0334822_011217_1_1593300034070SoilTVKGTVDSAAALDDVVAKLKEIDCFEEISKGPLTEVSGGGKQFSLTINSKCP
Ga0370487_0274068_3_1433300034170Untreated Peat SoilDSAAAVDEIVANLKGVDCFEDISKGPISEVSGGAKQFSLSIASKCP
Ga0370501_0017438_2_1663300034195Untreated Peat SoilKTSIKGTVDSAASLDDVVAKLKEVDCFEEINKGPLTEVSGGAKQFSLTINSKCP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.