| Basic Information | |
|---|---|
| Family ID | F065802 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 74.02 % |
| % of genes near scaffold ends (potentially truncated) | 30.71 % |
| % of genes from short scaffolds (< 2000 bps) | 88.98 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (62.992 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (26.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.614 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.488 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 70.00% β-sheet: 0.00% Coil/Unstructured: 30.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 2.36 |
| PF05063 | MT-A70 | 0.79 |
| PF13730 | HTH_36 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.02 % |
| Unclassified | root | N/A | 25.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10102147 | Not Available | 1187 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10118035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 1052 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10154644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 835 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10274737 | Not Available | 517 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10100584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 948 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10124737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 801 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10222411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 515 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10043575 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10202227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 636 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10093397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1127 | Open in IMG/M |
| 3300001355|JGI20158J14315_10230200 | Not Available | 514 | Open in IMG/M |
| 3300001450|JGI24006J15134_10018181 | Not Available | 3281 | Open in IMG/M |
| 3300001450|JGI24006J15134_10059699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1514 | Open in IMG/M |
| 3300001450|JGI24006J15134_10116034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 934 | Open in IMG/M |
| 3300001472|JGI24004J15324_10031882 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300001472|JGI24004J15324_10126291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 620 | Open in IMG/M |
| 3300001472|JGI24004J15324_10139246 | Not Available | 573 | Open in IMG/M |
| 3300001472|JGI24004J15324_10158550 | Not Available | 515 | Open in IMG/M |
| 3300001589|JGI24005J15628_10088983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1065 | Open in IMG/M |
| 3300006026|Ga0075478_10040234 | All Organisms → Viruses → Predicted Viral | 1546 | Open in IMG/M |
| 3300006027|Ga0075462_10053186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1284 | Open in IMG/M |
| 3300006029|Ga0075466_1087090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300006029|Ga0075466_1131511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 656 | Open in IMG/M |
| 3300006399|Ga0075495_1501437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 684 | Open in IMG/M |
| 3300006735|Ga0098038_1052446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1470 | Open in IMG/M |
| 3300006735|Ga0098038_1239667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus | 576 | Open in IMG/M |
| 3300006737|Ga0098037_1041290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1679 | Open in IMG/M |
| 3300006737|Ga0098037_1205231 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 644 | Open in IMG/M |
| 3300006737|Ga0098037_1242556 | Not Available | 580 | Open in IMG/M |
| 3300006749|Ga0098042_1053718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1087 | Open in IMG/M |
| 3300006752|Ga0098048_1050633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1306 | Open in IMG/M |
| 3300006803|Ga0075467_10268924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 918 | Open in IMG/M |
| 3300006810|Ga0070754_10226900 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006810|Ga0070754_10471758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 542 | Open in IMG/M |
| 3300006916|Ga0070750_10248561 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300006922|Ga0098045_1033138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1323 | Open in IMG/M |
| 3300006928|Ga0098041_1145948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 761 | Open in IMG/M |
| 3300006929|Ga0098036_1185179 | Not Available | 633 | Open in IMG/M |
| 3300006929|Ga0098036_1188071 | Not Available | 628 | Open in IMG/M |
| 3300007345|Ga0070752_1200802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 795 | Open in IMG/M |
| 3300007346|Ga0070753_1320436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 551 | Open in IMG/M |
| 3300007540|Ga0099847_1196467 | Not Available | 589 | Open in IMG/M |
| 3300007640|Ga0070751_1223337 | Not Available | 724 | Open in IMG/M |
| 3300008012|Ga0075480_10598621 | Not Available | 522 | Open in IMG/M |
| 3300009001|Ga0102963_1039844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1953 | Open in IMG/M |
| 3300009193|Ga0115551_1495353 | Not Available | 521 | Open in IMG/M |
| 3300009423|Ga0115548_1114444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
| 3300009435|Ga0115546_1113774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 974 | Open in IMG/M |
| 3300010149|Ga0098049_1062128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1184 | Open in IMG/M |
| 3300011254|Ga0151675_1000540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3288 | Open in IMG/M |
| 3300017706|Ga0181377_1027961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1185 | Open in IMG/M |
| 3300017708|Ga0181369_1103806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 589 | Open in IMG/M |
| 3300017709|Ga0181387_1140022 | Not Available | 500 | Open in IMG/M |
| 3300017710|Ga0181403_1027191 | Not Available | 1210 | Open in IMG/M |
| 3300017713|Ga0181391_1022670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth | 1556 | Open in IMG/M |
| 3300017713|Ga0181391_1077586 | Not Available | 761 | Open in IMG/M |
| 3300017713|Ga0181391_1135097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 549 | Open in IMG/M |
| 3300017714|Ga0181412_1050794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 1051 | Open in IMG/M |
| 3300017717|Ga0181404_1153932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
| 3300017720|Ga0181383_1025378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1593 | Open in IMG/M |
| 3300017720|Ga0181383_1186396 | Not Available | 553 | Open in IMG/M |
| 3300017728|Ga0181419_1025033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1655 | Open in IMG/M |
| 3300017729|Ga0181396_1109120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
| 3300017739|Ga0181433_1010916 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300017741|Ga0181421_1064962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 961 | Open in IMG/M |
| 3300017744|Ga0181397_1193130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 511 | Open in IMG/M |
| 3300017750|Ga0181405_1071644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 893 | Open in IMG/M |
| 3300017750|Ga0181405_1114908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 674 | Open in IMG/M |
| 3300017753|Ga0181407_1138479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 604 | Open in IMG/M |
| 3300017755|Ga0181411_1025578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1896 | Open in IMG/M |
| 3300017755|Ga0181411_1138226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 705 | Open in IMG/M |
| 3300017756|Ga0181382_1031339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1608 | Open in IMG/M |
| 3300017760|Ga0181408_1127448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
| 3300017763|Ga0181410_1209126 | Not Available | 532 | Open in IMG/M |
| 3300017767|Ga0181406_1184650 | Not Available | 622 | Open in IMG/M |
| 3300017768|Ga0187220_1219314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
| 3300017770|Ga0187217_1085689 | Not Available | 1078 | Open in IMG/M |
| 3300017773|Ga0181386_1011478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3005 | Open in IMG/M |
| 3300017773|Ga0181386_1167993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 667 | Open in IMG/M |
| 3300017776|Ga0181394_1066147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1193 | Open in IMG/M |
| 3300017776|Ga0181394_1248351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 533 | Open in IMG/M |
| 3300017779|Ga0181395_1166643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
| 3300017781|Ga0181423_1066277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1431 | Open in IMG/M |
| 3300017782|Ga0181380_1143531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 815 | Open in IMG/M |
| 3300017783|Ga0181379_1293786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300017783|Ga0181379_1325982 | Not Available | 519 | Open in IMG/M |
| 3300017824|Ga0181552_10407182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 651 | Open in IMG/M |
| 3300017950|Ga0181607_10019601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5137 | Open in IMG/M |
| 3300018036|Ga0181600_10009821 | All Organisms → Viruses | 7007 | Open in IMG/M |
| 3300018048|Ga0181606_10038323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 3370 | Open in IMG/M |
| 3300020438|Ga0211576_10362956 | Not Available | 745 | Open in IMG/M |
| 3300021375|Ga0213869_10009624 | Not Available | 5842 | Open in IMG/M |
| 3300021375|Ga0213869_10378926 | Not Available | 584 | Open in IMG/M |
| 3300021957|Ga0222717_10561420 | Not Available | 605 | Open in IMG/M |
| 3300021959|Ga0222716_10035128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3630 | Open in IMG/M |
| 3300021959|Ga0222716_10601897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 600 | Open in IMG/M |
| 3300022200|Ga0196901_1198687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 645 | Open in IMG/M |
| 3300024344|Ga0209992_10071164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1605 | Open in IMG/M |
| 3300025070|Ga0208667_1023714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1163 | Open in IMG/M |
| 3300025086|Ga0208157_1044879 | Not Available | 1211 | Open in IMG/M |
| 3300025086|Ga0208157_1118623 | Not Available | 617 | Open in IMG/M |
| 3300025102|Ga0208666_1120069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 624 | Open in IMG/M |
| 3300025120|Ga0209535_1033190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2405 | Open in IMG/M |
| 3300025120|Ga0209535_1046530 | Not Available | 1886 | Open in IMG/M |
| 3300025137|Ga0209336_10162579 | Not Available | 581 | Open in IMG/M |
| 3300025508|Ga0208148_1016146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2186 | Open in IMG/M |
| 3300025543|Ga0208303_1041265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1168 | Open in IMG/M |
| 3300025632|Ga0209194_1070750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 942 | Open in IMG/M |
| 3300025645|Ga0208643_1183177 | Not Available | 507 | Open in IMG/M |
| 3300025652|Ga0208134_1029912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1929 | Open in IMG/M |
| 3300025652|Ga0208134_1037653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1639 | Open in IMG/M |
| 3300025652|Ga0208134_1046105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1414 | Open in IMG/M |
| 3300025759|Ga0208899_1070294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1404 | Open in IMG/M |
| 3300025759|Ga0208899_1076918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1314 | Open in IMG/M |
| 3300025769|Ga0208767_1248394 | Not Available | 558 | Open in IMG/M |
| 3300025816|Ga0209193_1103176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 707 | Open in IMG/M |
| 3300025869|Ga0209308_10094495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1459 | Open in IMG/M |
| 3300025889|Ga0208644_1374705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 533 | Open in IMG/M |
| 3300028600|Ga0265303_11577083 | Not Available | 549 | Open in IMG/M |
| 3300029309|Ga0183683_1003010 | All Organisms → Viruses | 5986 | Open in IMG/M |
| 3300029309|Ga0183683_1012281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 2079 | Open in IMG/M |
| 3300029787|Ga0183757_1019707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1637 | Open in IMG/M |
| 3300031851|Ga0315320_10203695 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300032257|Ga0316205_10205254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
| 3300032277|Ga0316202_10151027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1079 | Open in IMG/M |
| 3300032277|Ga0316202_10306555 | Not Available | 739 | Open in IMG/M |
| 3300032277|Ga0316202_10404554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 26.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.68% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.72% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 3.15% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.15% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.15% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.57% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.79% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.79% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.79% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.79% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101021476 | 3300000101 | Marine | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSV |
| DelMOSum2010_101180353 | 3300000101 | Marine | MIVXGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| DelMOSum2010_101546445 | 3300000101 | Marine | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| DelMOSum2010_102747372 | 3300000101 | Marine | MIVYGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIFLIGFILGSVIF* |
| DelMOSum2011_101005845 | 3300000115 | Marine | MIVLGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF* |
| DelMOSum2011_101247373 | 3300000115 | Marine | MIVLGKTPKEWRKEIGSKSLYYRXEIVIFLIGFILGSVIF* |
| DelMOSum2011_102224112 | 3300000115 | Marine | MIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF* |
| DelMOSpr2010_100435757 | 3300000116 | Marine | MIILGKTPKEWRKEIGIKSLYYRAEIVIFLIGFILGSVIF* |
| DelMOSpr2010_102022273 | 3300000116 | Marine | MMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF* |
| DelMOWin2010_100933975 | 3300000117 | Marine | MIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF* |
| JGI20158J14315_102302001 | 3300001355 | Pelagic Marine | MILMGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIF |
| JGI24006J15134_100181819 | 3300001450 | Marine | MIVLGKTPKEWRKEIGXXSLYYRAEIVIFLIGFILGSIIF* |
| JGI24006J15134_100596994 | 3300001450 | Marine | MIILDKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF* |
| JGI24006J15134_101160343 | 3300001450 | Marine | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF* |
| JGI24004J15324_100318826 | 3300001472 | Marine | MIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF* |
| JGI24004J15324_101262911 | 3300001472 | Marine | MIVLGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSIIF* |
| JGI24004J15324_101392462 | 3300001472 | Marine | MMIVLGKTPKEWRKEIGLKSLYYRVEIIIFLIGFILGSIIF* |
| JGI24004J15324_101585503 | 3300001472 | Marine | KTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| JGI24005J15628_100889835 | 3300001589 | Marine | MIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSIIF* |
| Ga0075478_100402344 | 3300006026 | Aqueous | MIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF* |
| Ga0075462_100531866 | 3300006027 | Aqueous | MILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0075466_10870904 | 3300006029 | Aqueous | LGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0075466_11315115 | 3300006029 | Aqueous | MIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0075495_15014372 | 3300006399 | Aqueous | MIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0098038_10524465 | 3300006735 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0098038_12396673 | 3300006735 | Marine | MILMGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0098037_10412905 | 3300006737 | Marine | MIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF* |
| Ga0098037_12052314 | 3300006737 | Marine | RKRGIMIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF* |
| Ga0098037_12425562 | 3300006737 | Marine | MIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF* |
| Ga0098042_10537182 | 3300006749 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0098048_10506335 | 3300006752 | Marine | MIVYGNTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0075467_102689245 | 3300006803 | Aqueous | MMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0070754_102269001 | 3300006810 | Aqueous | MMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0070754_104717583 | 3300006810 | Aqueous | MMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF* |
| Ga0070750_102485614 | 3300006916 | Aqueous | VLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0098045_10331384 | 3300006922 | Marine | MILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0098041_11459482 | 3300006928 | Marine | MILMGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF* |
| Ga0098036_11851791 | 3300006929 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF* |
| Ga0098036_11880711 | 3300006929 | Marine | MIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGA |
| Ga0070752_12008023 | 3300007345 | Aqueous | MGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0070753_13204363 | 3300007346 | Aqueous | MGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0099847_11964671 | 3300007540 | Aqueous | KTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF* |
| Ga0070751_12233371 | 3300007640 | Aqueous | KTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0075480_105986211 | 3300008012 | Aqueous | MMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0102963_10398443 | 3300009001 | Pond Water | MIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF* |
| Ga0115551_14953533 | 3300009193 | Pelagic Marine | MGKTPKEWRKQIGSKSLYYRAEIVIFLIGFILGSVIF* |
| Ga0115548_11144442 | 3300009423 | Pelagic Marine | MILMGKTPKEWRKEIGSKSIYYRAEIVIFLIGFILGSVIF* |
| Ga0115546_11137745 | 3300009435 | Pelagic Marine | MGKTPKEWRNEIGLKSLYYRAEIVIFLIGFILGSIIF* |
| Ga0098049_10621284 | 3300010149 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF* |
| Ga0151675_10005409 | 3300011254 | Marine | MIVLGKTPKEWRKEIGSKSLYYRVEIVIFLIGFILGSIIF* |
| Ga0181377_10279615 | 3300017706 | Marine | MMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF |
| Ga0181369_11038061 | 3300017708 | Marine | MIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0181387_11400221 | 3300017709 | Seawater | GPMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF |
| Ga0181403_10271914 | 3300017710 | Seawater | MIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGSIIF |
| Ga0181391_10226705 | 3300017713 | Seawater | MIILGKTPKEWRKEIGLKSLYYRAEIIIFLIGFILGSVIF |
| Ga0181391_10775863 | 3300017713 | Seawater | MIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF |
| Ga0181391_11350974 | 3300017713 | Seawater | MIVYRKTPKEWRKEIVLKSLYYRAEIVIFLIGFIL |
| Ga0181412_10507942 | 3300017714 | Seawater | MIVLGKTPKQWRKEMGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181404_11539321 | 3300017717 | Seawater | KEVMMIVLGKTPKEWRKEIGSKSLYYRSEIVIFLIGFILGSVIF |
| Ga0181383_10253783 | 3300017720 | Seawater | MILMGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0181383_11863964 | 3300017720 | Seawater | MIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF |
| Ga0181419_10250335 | 3300017728 | Seawater | MIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFIL |
| Ga0181396_11091201 | 3300017729 | Seawater | VLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0181433_10109161 | 3300017739 | Seawater | MIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAII |
| Ga0181421_10649621 | 3300017741 | Seawater | VLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF |
| Ga0181397_11931303 | 3300017744 | Seawater | GAIGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181405_10716444 | 3300017750 | Seawater | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF |
| Ga0181405_11149083 | 3300017750 | Seawater | FNKEVMMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181407_11384792 | 3300017753 | Seawater | MIILGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF |
| Ga0181411_10255781 | 3300017755 | Seawater | MIVLGKTPKEWRKEIGLKSLYYRVEIVIFLIGFILG |
| Ga0181411_11382263 | 3300017755 | Seawater | VLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF |
| Ga0181382_10313394 | 3300017756 | Seawater | MILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF |
| Ga0181408_11274481 | 3300017760 | Seawater | MMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181410_12091261 | 3300017763 | Seawater | MMIVLGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF |
| Ga0181406_11846501 | 3300017767 | Seawater | DKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF |
| Ga0187220_12193144 | 3300017768 | Seawater | KTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF |
| Ga0187217_10856894 | 3300017770 | Seawater | MIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF |
| Ga0181386_10114785 | 3300017773 | Seawater | MIILGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0181386_11679931 | 3300017773 | Seawater | IVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181394_10661475 | 3300017776 | Seawater | MIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSIIF |
| Ga0181394_12483513 | 3300017776 | Seawater | MMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181395_11666433 | 3300017779 | Seawater | VYGKTTKECRKEIGSKSLDYRAEILIFLIGFILGSIIF |
| Ga0181423_10662771 | 3300017781 | Seawater | GKTPKEWRKEIGLKSLYYRVEIVIFLIGFILGSIIF |
| Ga0181380_11435311 | 3300017782 | Seawater | MIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF |
| Ga0181379_12937861 | 3300017783 | Seawater | LGKTPKQWRKEMGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181379_13259821 | 3300017783 | Seawater | LGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0181552_104071822 | 3300017824 | Salt Marsh | MIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF |
| Ga0181607_100196016 | 3300017950 | Salt Marsh | MMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF |
| Ga0181600_100098217 | 3300018036 | Salt Marsh | MIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF |
| Ga0181606_100383236 | 3300018048 | Salt Marsh | MMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF |
| Ga0211576_103629562 | 3300020438 | Marine | MIILDKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF |
| Ga0213869_100096242 | 3300021375 | Seawater | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0213869_103789263 | 3300021375 | Seawater | MIVLGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF |
| Ga0222717_105614203 | 3300021957 | Estuarine Water | MIILGKTPKEWRSEIGVKSLYYRTEIIIFVCGFILGSIIF |
| Ga0222716_100351284 | 3300021959 | Estuarine Water | MIILGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF |
| Ga0222716_106018972 | 3300021959 | Estuarine Water | MIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0196901_11986872 | 3300022200 | Aqueous | MILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0209992_100711644 | 3300024344 | Deep Subsurface | MLIIGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208667_10237144 | 3300025070 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208157_10448794 | 3300025086 | Marine | MIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF |
| Ga0208157_11186231 | 3300025086 | Marine | MIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF |
| Ga0208666_11200691 | 3300025102 | Marine | MILMGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0209535_10331906 | 3300025120 | Marine | MIVLGKTPKEWQKQIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0209535_10465306 | 3300025120 | Marine | MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF |
| Ga0209336_101625792 | 3300025137 | Marine | MIVLGKTPKEWRKEIGLKSLYYRVEIIIFLIGFILGSIIF |
| Ga0208148_10161467 | 3300025508 | Aqueous | MIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0208303_10412655 | 3300025543 | Aqueous | MIVLEKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0209194_10707505 | 3300025632 | Pelagic Marine | MILMGKTPKEWRNEIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208643_11831773 | 3300025645 | Aqueous | MIVLGKTPKEWRKEIGIKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208134_10299121 | 3300025652 | Aqueous | MMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208134_10376535 | 3300025652 | Aqueous | MMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0208134_10461053 | 3300025652 | Aqueous | MMIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0208899_10702941 | 3300025759 | Aqueous | IIGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0208899_10769185 | 3300025759 | Aqueous | NKEVMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0208767_12483943 | 3300025769 | Aqueous | MMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF |
| Ga0209193_11031762 | 3300025816 | Pelagic Marine | MILMGKTPKEWRKEIGSKSIYYRAEIVIFLIGFILGSVIF |
| Ga0209308_100944952 | 3300025869 | Pelagic Marine | MILMGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIFLIGFILGSVIF |
| Ga0208644_13747051 | 3300025889 | Aqueous | MIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILG |
| Ga0265303_115770831 | 3300028600 | Sediment | MILMGKTPKEWRKEIGSKSSRILLTLQEVSLYYRAEIVIFLIGFILGSIIF |
| Ga0183683_10030109 | 3300029309 | Marine | MILMGKTPKEWRKEIGIKSLYYRHEIQWFLIGLLLGAIIF |
| Ga0183683_10122815 | 3300029309 | Marine | MGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF |
| Ga0183757_10197076 | 3300029787 | Marine | MILMGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF |
| Ga0315320_102036951 | 3300031851 | Seawater | MIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILG |
| Ga0316205_102052541 | 3300032257 | Microbial Mat | GKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF |
| Ga0316202_101510271 | 3300032277 | Microbial Mat | MIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF |
| Ga0316202_103065555 | 3300032277 | Microbial Mat | VLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF |
| Ga0316202_104045542 | 3300032277 | Microbial Mat | KEVMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF |
| ⦗Top⦘ |