| Basic Information | |
|---|---|
| Family ID | F065772 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 85.83 % |
| % of genes near scaffold ends (potentially truncated) | 94.49 % |
| % of genes from short scaffolds (< 2000 bps) | 88.19 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (55.906 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.047 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.606 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.118 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.95% β-sheet: 0.00% Coil/Unstructured: 71.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF08241 | Methyltransf_11 | 25.20 |
| PF13489 | Methyltransf_23 | 13.39 |
| PF00535 | Glycos_transf_2 | 3.94 |
| PF03764 | EFG_IV | 0.79 |
| PF10926 | DUF2800 | 0.79 |
| PF13884 | Peptidase_S74 | 0.79 |
| PF08774 | VRR_NUC | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.83 % |
| Unclassified | root | N/A | 14.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_103913042 | Not Available | 555 | Open in IMG/M |
| 3300002835|B570J40625_100438328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
| 3300003388|JGI25910J50241_10168969 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300003394|JGI25907J50239_1053215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300003493|JGI25923J51411_1055746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300003497|JGI25925J51416_10107705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300005581|Ga0049081_10038743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
| 3300005582|Ga0049080_10122300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300005582|Ga0049080_10149219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300005584|Ga0049082_10118726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300006484|Ga0070744_10193933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300006484|Ga0070744_10200427 | Not Available | 568 | Open in IMG/M |
| 3300006802|Ga0070749_10384248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300006802|Ga0070749_10424923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300006805|Ga0075464_11062803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300007544|Ga0102861_1067366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300007550|Ga0102880_1150711 | Not Available | 609 | Open in IMG/M |
| 3300007559|Ga0102828_1207886 | Not Available | 503 | Open in IMG/M |
| 3300007622|Ga0102863_1057854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300007639|Ga0102865_1205539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300007992|Ga0105748_10400573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300008055|Ga0108970_10253948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300008107|Ga0114340_1006716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7629 | Open in IMG/M |
| 3300008107|Ga0114340_1112238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300008120|Ga0114355_1249479 | All Organisms → Viruses | 523 | Open in IMG/M |
| 3300008259|Ga0114841_1207200 | Not Available | 699 | Open in IMG/M |
| 3300008266|Ga0114363_1028273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2392 | Open in IMG/M |
| 3300008267|Ga0114364_1084272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300008339|Ga0114878_1264347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300009026|Ga0102829_1073053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300009026|Ga0102829_1221849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300009056|Ga0102860_1179994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009068|Ga0114973_10056084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2312 | Open in IMG/M |
| 3300009079|Ga0102814_10735917 | Not Available | 543 | Open in IMG/M |
| 3300009082|Ga0105099_11013744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300009152|Ga0114980_10472634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300009158|Ga0114977_10530944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300009158|Ga0114977_10725196 | Not Available | 528 | Open in IMG/M |
| 3300009165|Ga0105102_10026502 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300009165|Ga0105102_10541908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300010370|Ga0129336_10107381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
| 3300010885|Ga0133913_13589490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300011010|Ga0139557_1010982 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
| 3300011010|Ga0139557_1014555 | All Organisms → Viruses → Predicted Viral | 1497 | Open in IMG/M |
| 3300011010|Ga0139557_1066668 | Not Available | 604 | Open in IMG/M |
| 3300011011|Ga0139556_1007590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
| 3300012012|Ga0153799_1070015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300012017|Ga0153801_1043220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300012665|Ga0157210_1000149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35738 | Open in IMG/M |
| 3300012666|Ga0157498_1010185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
| 3300012964|Ga0153916_13338852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300013004|Ga0164293_10973531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017716|Ga0181350_1029484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1515 | Open in IMG/M |
| 3300017716|Ga0181350_1036108 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300017716|Ga0181350_1131008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300017723|Ga0181362_1039673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300017747|Ga0181352_1205998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300017754|Ga0181344_1003788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5225 | Open in IMG/M |
| 3300017761|Ga0181356_1032969 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300017761|Ga0181356_1057978 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300017766|Ga0181343_1120931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300017774|Ga0181358_1085998 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300017777|Ga0181357_1139670 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300017780|Ga0181346_1032164 | All Organisms → Viruses → Predicted Viral | 2170 | Open in IMG/M |
| 3300017785|Ga0181355_1091809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
| 3300019784|Ga0181359_1221427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300019784|Ga0181359_1268654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300020048|Ga0207193_1074268 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300020048|Ga0207193_1147769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1981 | Open in IMG/M |
| 3300020205|Ga0211731_10625622 | Not Available | 535 | Open in IMG/M |
| 3300020498|Ga0208050_1009998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300020554|Ga0208599_1056173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300021962|Ga0222713_10279254 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
| 3300022179|Ga0181353_1009531 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300022179|Ga0181353_1109654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300022179|Ga0181353_1147730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300024866|Ga0255272_1128193 | All Organisms → Viruses | 631 | Open in IMG/M |
| 3300027124|Ga0255116_1047053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300027141|Ga0255076_1042334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300027489|Ga0255095_1086103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027563|Ga0209552_1056983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300027563|Ga0209552_1082392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300027608|Ga0208974_1166498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027608|Ga0208974_1169500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027649|Ga0208960_1138201 | Not Available | 619 | Open in IMG/M |
| 3300027679|Ga0209769_1163971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300027683|Ga0209392_1119778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300027733|Ga0209297_1344382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300027736|Ga0209190_1318641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300027782|Ga0209500_10119396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300027785|Ga0209246_10024350 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300027798|Ga0209353_10075223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1535 | Open in IMG/M |
| 3300027804|Ga0209358_10000819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26347 | Open in IMG/M |
| 3300027897|Ga0209254_10352899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300027900|Ga0209253_10440822 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300027900|Ga0209253_10705681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027969|Ga0209191_1258860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300027971|Ga0209401_1010520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5155 | Open in IMG/M |
| 3300031758|Ga0315907_10306168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1304 | Open in IMG/M |
| 3300031758|Ga0315907_10391435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
| 3300031758|Ga0315907_11012889 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031772|Ga0315288_11646969 | Not Available | 520 | Open in IMG/M |
| 3300031784|Ga0315899_10555973 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031787|Ga0315900_10580080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300031834|Ga0315290_10394923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300031857|Ga0315909_10072606 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300031857|Ga0315909_10713733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300031873|Ga0315297_11317449 | Not Available | 588 | Open in IMG/M |
| 3300031951|Ga0315904_10811205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300031951|Ga0315904_10868679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300031963|Ga0315901_10084217 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300031999|Ga0315274_11554029 | Not Available | 625 | Open in IMG/M |
| 3300032046|Ga0315289_10711613 | Not Available | 906 | Open in IMG/M |
| 3300032092|Ga0315905_10199486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1970 | Open in IMG/M |
| 3300032093|Ga0315902_10783033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300032116|Ga0315903_10220675 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300032342|Ga0315286_11043421 | Not Available | 810 | Open in IMG/M |
| 3300032401|Ga0315275_11904798 | Not Available | 629 | Open in IMG/M |
| 3300033233|Ga0334722_11270824 | Not Available | 515 | Open in IMG/M |
| 3300033981|Ga0334982_0169399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300033995|Ga0335003_0027560 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300034066|Ga0335019_0551458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300034092|Ga0335010_0650224 | Not Available | 526 | Open in IMG/M |
| 3300034106|Ga0335036_0247131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
| 3300034117|Ga0335033_0394615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300034118|Ga0335053_0526719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300034272|Ga0335049_0779516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.09% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.30% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.15% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.36% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 2.36% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.36% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.57% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.79% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.79% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.79% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.79% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.79% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027124 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1039130421 | 3300001213 | Wetland | MNDIENLSTDIAAQTPMDDAELQAIVTQDLTDAISY |
| B570J40625_1004383283 | 3300002835 | Freshwater | MIENITENLSTDIAAQEPMDDAELQSIITQDLTDAVSYVDSDLSPTRAKGTEYYR |
| JGI25910J50241_101689691 | 3300003388 | Freshwater Lake | MNDIENLSTDIAATEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAKGT |
| JGI25907J50239_10532151 | 3300003394 | Freshwater Lake | MIENITDNLSTDIASQNQMDDAELQAIITQDLTDAISYVDS |
| JGI25923J51411_10557462 | 3300003493 | Freshwater Lake | MNMNELPITTDLAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYYRAARLLALTPTH* |
| JGI25925J51416_101077052 | 3300003497 | Freshwater Lake | MNMNDMPVTTDVAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYY |
| Ga0049081_100387435 | 3300005581 | Freshwater Lentic | MIENDIPENLSTDIAAKEPMDDAELQAIVTQDLTDAVSYVDSDLSPT |
| Ga0049080_101223001 | 3300005582 | Freshwater Lentic | MNEQDITNTISTDIAAKTQMDDAELQSIITQDLTDAVSYIDSDLSPTRAKGTEYY |
| Ga0049080_101492193 | 3300005582 | Freshwater Lentic | MIEQDITENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKG |
| Ga0049082_101187263 | 3300005584 | Freshwater Lentic | MNDIENLSTDIAATEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAKGTEYY |
| Ga0070744_101939332 | 3300006484 | Estuarine | MNMNELPISTDVAAQEPMDDDELQAIITQDITDAISYIDTDISPTRARGTEYY |
| Ga0070744_102004271 | 3300006484 | Estuarine | MNDIENLSTDIAAKEPMDDMELQAIITQDLTDAISYVDSDLSPT |
| Ga0070749_103842481 | 3300006802 | Aqueous | MIENITENLSTDIAAKQPMDDAELQSIITQDLTDAV |
| Ga0070749_104249231 | 3300006802 | Aqueous | MIENITDNLSTDIAAQQPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKGTEYYR |
| Ga0075464_110628031 | 3300006805 | Aqueous | MIEQNITENLSTDIAAKQPMDDAELQSIITQDLTDAVSYVDSDLSPTRAKGTEYYRGD |
| Ga0102861_10673663 | 3300007544 | Estuarine | MNEQDITSAINTDIAATEPMDDMELQAIITQDLTDAISYVDSDLSPTRA* |
| Ga0102880_11507111 | 3300007550 | Estuarine | MMNELLTTDVSAIEPMDDAELEAIIGQDLTDAVSYVDTYLSPIRARGTEYYRGD |
| Ga0102828_12078861 | 3300007559 | Estuarine | MMNELLTTDVSAIEPMDDAELEAIIGQDLTDAVSYVDSDLSPIRARGTEY |
| Ga0102863_10578543 | 3300007622 | Estuarine | MIENITENLSTDIAATEPMDDAELQAIVTQDLTDAVSYVDSDLSP |
| Ga0102865_12055392 | 3300007639 | Estuarine | MIENITDNLSTDIAATEPMDEMELQAIITQDLTDAISYVDSDLSPT |
| Ga0105748_104005732 | 3300007992 | Estuary Water | MIEQDITENLSTDIAATEPMDDMELQAIITQDLTDAISYVDSDLSPTRA |
| Ga0108970_102539482 | 3300008055 | Estuary | MNDIENLSTDIAATEPMDEMELQAIITQDLTDAISYVDSDLSPTRAKGTEYYR |
| Ga0114340_10067161 | 3300008107 | Freshwater, Plankton | MIEQNITENLSTDIAAKQPMDDAELQSIITQDLTDAVSYVDSDLSPT |
| Ga0114340_11122383 | 3300008107 | Freshwater, Plankton | MNEQDITSAINTDITATEPMDEMELQAIITQDLTDAISYVDSDLSPTRA |
| Ga0114355_12494791 | 3300008120 | Freshwater, Plankton | MNMNDIPLSVDMAAPEPMDDAELQAIINGELQDAVSYIDSDISPIRAKGTE |
| Ga0114841_12072002 | 3300008259 | Freshwater, Plankton | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKGTEY* |
| Ga0114363_10282731 | 3300008266 | Freshwater, Plankton | MIENDIPENLSTDIAATQPMDDAELQAIVTQDLTDAVSYVDSDLSPTR |
| Ga0114364_10842721 | 3300008267 | Freshwater, Plankton | MIENITDNLSTDIASQNQMDDAELQAIITQDLTDAISYVDSDLSP |
| Ga0114878_12643472 | 3300008339 | Freshwater Lake | MIENITDNLSTDIAATEPMDDMELQAIITQDLTDAVSYVD |
| Ga0102829_10730531 | 3300009026 | Estuarine | MIENDIPENLSTDIAAKEPMDEMELQAIITQDLTDAI |
| Ga0102829_12218492 | 3300009026 | Estuarine | MIENITENLSTDIAATEPMDDAELQAIITQDLTDAVSYVD |
| Ga0102860_11799941 | 3300009056 | Estuarine | MIENITENLSTDIAATEPMDEMELQAIITQDLTDAVSY |
| Ga0114973_100560841 | 3300009068 | Freshwater Lake | MIDNMTENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKGTEY |
| Ga0102814_107359173 | 3300009079 | Estuarine | MNESEISTDIAAQTPMDDAELQSIITQELTDAVSYV |
| Ga0105099_110137441 | 3300009082 | Freshwater Sediment | MIQQNITNTINTDISSTAPMDDAELQAIITQDLVDAV |
| Ga0114980_104726342 | 3300009152 | Freshwater Lake | MIDNMTENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKG |
| Ga0114977_105309442 | 3300009158 | Freshwater Lake | MNMNDMPVTTDVAAQEPMDDTELEAIIGQDLTDAVSYIDSDISPVRAMGTAYYR |
| Ga0114977_107251962 | 3300009158 | Freshwater Lake | MNDLENLSTDIAAKQPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKGTEY |
| Ga0105102_100265026 | 3300009165 | Freshwater Sediment | MNEQDITSAITTDIVATKPMDDAELESIIGQDLTDAVS |
| Ga0105102_105419082 | 3300009165 | Freshwater Sediment | MNDIENLSTDIAATEPMDDAELQAIITQDLTDAVS |
| Ga0129336_101073811 | 3300010370 | Freshwater To Marine Saline Gradient | MIENITENLSTDIAAKEPMDDAELQSIITQDLTDAISYVDSDLSPTRAKGT* |
| Ga0133913_135894901 | 3300010885 | Freshwater Lake | MIENDIPENLSTDIAAKEPMDEMELQAIITQDLTDAISYVDS |
| Ga0139557_10109821 | 3300011010 | Freshwater | MIENITDNLSTDIASQNQMDDAKLQAIITQDLTDAISYVDSDLSPTRARGTEYYRGD |
| Ga0139557_10145555 | 3300011010 | Freshwater | MNEKITTDIAATESMDDAELQAIITQDLTDAISYVDSDLS |
| Ga0139557_10666682 | 3300011010 | Freshwater | MNEKITTDIAAQNQMDDAELQAIITQDLTDAISYVDSDLSPTRARGT |
| Ga0139556_10075901 | 3300011011 | Freshwater | MIENITDNLSTDIASQNQMDDAELQAIITQDLTDAISYVDSDLSPTRARGTE |
| Ga0153799_10700152 | 3300012012 | Freshwater | MIENITDNLSTDIAATEPMDDAELQSIITQDLVDAVSYVDSDLSPTRAKGTEYYR |
| Ga0153801_10432203 | 3300012017 | Freshwater | MNDIENLSTDIAATEPMDDMELQAIITQDLTDAISYVDSDLSPT |
| Ga0157210_100014935 | 3300012665 | Freshwater | MNMNDMPVTTDVAAQETMDDTELEAIIGQDLTDAVSYIDSDISPVRAMGTAYYRXXXXX |
| Ga0157498_10101851 | 3300012666 | Freshwater, Surface Ice | MNDIENLSTDIAATEPMDDAELQAIVTQDLTDAISYVDSDLSPTR |
| Ga0153916_133388521 | 3300012964 | Freshwater Wetlands | MNEQDITNAINTDIVAAKPMDDAELESIISQDLVDAVSYVDSDLSPTRAK |
| Ga0164293_109735312 | 3300013004 | Freshwater | MIEKVTENLSTDIAATEPMDDAELQAIITQDLVDAVSYVDSDLSPTRAKG |
| Ga0181350_10294844 | 3300017716 | Freshwater Lake | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAISYVDSDLSPTRA |
| Ga0181350_10361083 | 3300017716 | Freshwater Lake | MNMNDMPVTTDVAAQEPMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYY |
| Ga0181350_11310082 | 3300017716 | Freshwater Lake | MNMNELPITTDVAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGT |
| Ga0181362_10396733 | 3300017723 | Freshwater Lake | MNDMNISTDIAAKTKMDDAELQSIITQDLTDAVSY |
| Ga0181352_12059982 | 3300017747 | Freshwater Lake | MIEKVTENLSTDIAATEPMDDAELQAIITQDLTDAVSYVD |
| Ga0181344_100378812 | 3300017754 | Freshwater Lake | MIENITDNLSTDIAAQEPMDDMELQAIITQDLTDAVSYVDS |
| Ga0181356_10329696 | 3300017761 | Freshwater Lake | MNEKITTDIAATEPMDDAELQAIITQDLTDAISYV |
| Ga0181356_10579781 | 3300017761 | Freshwater Lake | MIEQDITENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAK |
| Ga0181343_11209312 | 3300017766 | Freshwater Lake | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAISYVDSDLSPTRARG |
| Ga0181358_10859981 | 3300017774 | Freshwater Lake | MNMNELPITTDLAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTA |
| Ga0181357_11396703 | 3300017777 | Freshwater Lake | MNMNELPITTDLAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYYRG |
| Ga0181346_10321646 | 3300017780 | Freshwater Lake | MNMNDMPITTDVAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAY |
| Ga0181355_10918091 | 3300017785 | Freshwater Lake | MNDLENLSTDIAAKQPMDDAELQAIVTQDLTDAVSYV |
| Ga0181359_12214271 | 3300019784 | Freshwater Lake | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAISYVDSDLSPTRARGTL |
| Ga0181359_12686541 | 3300019784 | Freshwater Lake | MNMNELPITTDLAAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYYRGD |
| Ga0207193_10742681 | 3300020048 | Freshwater Lake Sediment | MIENITENLSTDIAATEPMDDMELQSIITQDLTDAVSYVDSDLSPTRAKGTEYYR |
| Ga0207193_11477694 | 3300020048 | Freshwater Lake Sediment | MNDIENLSTDIAAKEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAKGTEYYR |
| Ga0211731_106256221 | 3300020205 | Freshwater | MMNELPTTDISATEPMDDAELEAIIGQDLTDAVSYVDSDLSPIRARGTE |
| Ga0208050_10099983 | 3300020498 | Freshwater | MIEQDITENLSTDIAATEPMDDMELQAIITQDLTDAISYVDSDLSPT |
| Ga0208599_10561732 | 3300020554 | Freshwater | MIENITDNLSTDIASQNQMDDAELQAIITQDLTDAISYVDSDLSPTRA |
| Ga0222713_102792545 | 3300021962 | Estuarine Water | MNMTDLPLNVDVAAPEPMDDSELEAIVNGELQDAVSYIDSDISPIRAKGT |
| Ga0181353_10095317 | 3300022179 | Freshwater Lake | MNDIENLSTDIAATEPMDEMELQAIITQDLTDAISYVDSDLS |
| Ga0181353_11096542 | 3300022179 | Freshwater Lake | MIEKVTENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKG |
| Ga0181353_11477302 | 3300022179 | Freshwater Lake | MNDIENLSTDIAATEPMDDAELQAIVTQDLTDAISYVDSDL |
| Ga0255272_11281933 | 3300024866 | Freshwater | MNMNEIGLSVDVAAPEPMDDAELQAIINGELQDAVSYIDSDISPIRAKGTEYY |
| Ga0255116_10470532 | 3300027124 | Freshwater | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAISYVDSDL |
| Ga0255076_10423342 | 3300027141 | Freshwater | MIENITDNLSTDIAAAEPMDDAELQAIVTQDLTDAISYVDSDLSPTRAKGTEY |
| Ga0255095_10861031 | 3300027489 | Freshwater | MIEQDITENLSTDIAATEPMDEMELQAIITQDLTDAIS |
| Ga0209552_10569831 | 3300027563 | Freshwater Lake | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRA |
| Ga0209552_10823923 | 3300027563 | Freshwater Lake | MNMNELPITTDVVAQEQMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYYRGDPFG |
| Ga0208974_11664982 | 3300027608 | Freshwater Lentic | MIENITENLSTDIAATEPMDDMELQAIITQDLTDAISYVDSDLSPTRAKGTE |
| Ga0208974_11695002 | 3300027608 | Freshwater Lentic | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAK |
| Ga0208960_11382011 | 3300027649 | Freshwater Lentic | MNEKITTDIAAQNQMDDAELQAIITQDLTDAISYVDSDLSPTRA |
| Ga0209769_11639712 | 3300027679 | Freshwater Lake | MIENITDNLSTDIAATEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAK |
| Ga0209392_11197781 | 3300027683 | Freshwater Sediment | MNEQDITNAITTDIAATKPMDDAELESIIGQDLTDAVSYVDSDLSP |
| Ga0209297_13443822 | 3300027733 | Freshwater Lake | MNMNDMPVTTDVAAQEPMDDTELEAIIGQDLTDAVSYIDSDISPIRAMGTAYYRGD |
| Ga0209190_13186412 | 3300027736 | Freshwater Lake | MNMNDMPVTTDVAAQEPMDDTELEAIIGQDLTDAVSYIDSDISPVRAMGTAYYRGDPFG |
| Ga0209500_101193962 | 3300027782 | Freshwater Lake | MNDISKQDIEQNISTDVTATEPMDDAELQSIITSDLTDAISYVDTDLSPTRARVSQRP |
| Ga0209246_100243505 | 3300027785 | Freshwater Lake | MNDIENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAK |
| Ga0209353_100752234 | 3300027798 | Freshwater Lake | MNDIENLSTDIAATEPMDEMELQAIITQDLTDAISYVDSDLSPTRAKGTEY |
| Ga0209358_100008191 | 3300027804 | Freshwater Lake | MIEKVTENLSTDIAATEPMDDAELQAIITQDLTDAVSYV |
| Ga0209254_103528991 | 3300027897 | Freshwater Lake Sediment | MNDIENLSTDIAAKEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAKGTDH |
| Ga0209253_104408223 | 3300027900 | Freshwater Lake Sediment | MIENITENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSP |
| Ga0209253_107056811 | 3300027900 | Freshwater Lake Sediment | MNEQDITNVINTDIVAAKPMDDAELESIISQDLVDAVSY |
| Ga0209191_12588602 | 3300027969 | Freshwater Lake | MNDLENLSTDIAAKQPMDDAELQAIVTQDLTDAVSYVDS |
| Ga0209401_101052012 | 3300027971 | Freshwater Lake | MIDNMTENLSTDIAATEPMDDAELQAIITQDLTDAVSYV |
| Ga0315907_103061681 | 3300031758 | Freshwater | MIENITDNLSTDIASQNQMDDAELQAIITQDLTDAIS |
| Ga0315907_103914353 | 3300031758 | Freshwater | MNMNDIPLSVDMAAPEPMDDAELQAIINGELQDAVSYIDSDISPIRAK |
| Ga0315907_110128893 | 3300031758 | Freshwater | MINEMGLSIDVAAPEPMDDAELQAIINGELQDAVSYIDSDISPIRAKGTE |
| Ga0315288_116469691 | 3300031772 | Sediment | MNEKITTDIAAQTPMDDAELQAIVTQDLTDAISYVDSDLSPTRARGTEYY |
| Ga0315899_105559733 | 3300031784 | Freshwater | MIEQDITENLSTDIAATEPMDDAELQAIITQDLTDAVSYV |
| Ga0315900_105800803 | 3300031787 | Freshwater | MIENITDNLSTDIAATQPMDDAELQSIITQDLTDAVSYVDSDLSPTRAK |
| Ga0315290_103949231 | 3300031834 | Sediment | MMNELLTTDVSAIEPMDDAELEAIIGQDLTDAVSYVDSDLSPIRARGTEYYRGDRF |
| Ga0315909_100726067 | 3300031857 | Freshwater | MINEMGLSIDVAAPEPMDDAELQAIINGELQDAVSYIDSDISPIRAKGTEYY |
| Ga0315909_107137331 | 3300031857 | Freshwater | MNEQDITSAINTDIGAKEPMDDAELQAIVTQDLTDAVS |
| Ga0315297_113174491 | 3300031873 | Sediment | MNESEISTDIAAQTPMDDAELQAIVTQDLTDAVSYVDSDLSPTRARGT |
| Ga0315904_108112051 | 3300031951 | Freshwater | MNEQDITSAINTDIAATEPMDDAELQAIVTQDLTD |
| Ga0315904_108686791 | 3300031951 | Freshwater | MNDIENLSTDIAAKQPMDDAELQAIVTQDLTDAVSYVDSDL |
| Ga0315901_100842178 | 3300031963 | Freshwater | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAV |
| Ga0315274_115540291 | 3300031999 | Sediment | MNESEISTDIAATEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRAR |
| Ga0315289_107116133 | 3300032046 | Sediment | MMNELLTTDVSATEPMDDAELEAIIGQDLTDAVSYVDSDLSPIRARGT |
| Ga0315905_101994866 | 3300032092 | Freshwater | MIENINENLSTDIAAQEPMDDAELQSIITQDLVDAVSYVDSDLSPTRAKGT |
| Ga0315902_107830331 | 3300032093 | Freshwater | MIENITENLSTDIAATEPMDDAELQSIITQDLTDAVS |
| Ga0315903_102206751 | 3300032116 | Freshwater | MIENITDNLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRAKGTEYYR |
| Ga0315286_110434213 | 3300032342 | Sediment | MMNELPNTDVSAIEPMDDTELEAIIGQDLTDAVSYVDSDLSPIRARGTEY |
| Ga0315275_119047982 | 3300032401 | Sediment | MMNELPNTDVSAIEPMDDTELEAIIGQDLTDAVSYVDSDLSPIRARGTEYYRGD |
| Ga0334722_112708241 | 3300033233 | Sediment | MNEKITTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTRARG |
| Ga0334982_0169399_1_153 | 3300033981 | Freshwater | MIENITDNLSTDIAAKQPMDEMELQAIITQDLTDAVSYVDSDLSPTRAKGT |
| Ga0335003_0027560_2_142 | 3300033995 | Freshwater | MIENITENLSTDIAATEPMDDAELQAIITQDLTDAVSYVDSDLSPTR |
| Ga0335019_0551458_3_158 | 3300034066 | Freshwater | MNMNDIPLSVDMAAPEPMDDAELQSIINGELTDAVSYIDSDISPIRAKGTEY |
| Ga0335010_0650224_3_140 | 3300034092 | Freshwater | MNDIENLSTDIAAKEPMDDAELQAIVTQDLTDAVSYVDSDLSPTRA |
| Ga0335036_0247131_1_111 | 3300034106 | Freshwater | MIENITDNLSTDIAAQTPMDDAELQAIITQDLTDAIS |
| Ga0335033_0394615_3_158 | 3300034117 | Freshwater | MNPNDMPISVDVAAPEAMDDAELESIVNGELTDAVSYIDTDISPIRAKGTEY |
| Ga0335053_0526719_2_163 | 3300034118 | Freshwater | MNMNDIPLSVDMAAPEPMDDAELQSIINGELTDAVSYIDSDISPIRAKGTEYYR |
| Ga0335049_0779516_1_156 | 3300034272 | Freshwater | MNEQDITNVINTDIVAAKPMDDAELESIIGQDLTDAVSYVDSDLSPTRAKGT |
| ⦗Top⦘ |