Basic Information | |
---|---|
Family ID | F065770 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 42 residues |
Representative Sequence | WRWRKYSGINKHDHHCHISFTKKGDADGSFFNIPMIGGTA |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.21 % |
% of genes from short scaffolds (< 2000 bps) | 87.40 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (91.339 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.835 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.268 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.929 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.82% β-sheet: 5.88% Coil/Unstructured: 85.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF01391 | Collagen | 2.36 |
PF01844 | HNH | 1.57 |
PF03406 | Phage_fiber_2 | 1.57 |
PF00145 | DNA_methylase | 0.79 |
PF14279 | HNH_5 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.64 % |
Unclassified | root | N/A | 2.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003393|JGI25909J50240_1088416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300004123|Ga0066181_10197688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 571 | Open in IMG/M |
3300005528|Ga0068872_10640860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 561 | Open in IMG/M |
3300005662|Ga0078894_10889042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300006037|Ga0075465_10160480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300006484|Ga0070744_10211590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300006802|Ga0070749_10122841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
3300006863|Ga0075459_1016042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
3300006875|Ga0075473_10103222 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300006920|Ga0070748_1081354 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300006920|Ga0070748_1091696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300006920|Ga0070748_1267104 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300007542|Ga0099846_1036770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1877 | Open in IMG/M |
3300008107|Ga0114340_1202942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300008117|Ga0114351_1364101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300008119|Ga0114354_1069649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
3300008266|Ga0114363_1036990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2018 | Open in IMG/M |
3300008266|Ga0114363_1154943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300008266|Ga0114363_1180380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300008266|Ga0114363_1207710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300008448|Ga0114876_1129179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300008448|Ga0114876_1205278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300008450|Ga0114880_1018302 | All Organisms → Viruses → Predicted Viral | 3296 | Open in IMG/M |
3300008450|Ga0114880_1068479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300008450|Ga0114880_1104985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
3300008450|Ga0114880_1133698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300008450|Ga0114880_1182258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300008450|Ga0114880_1191768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300008450|Ga0114880_1193494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300008450|Ga0114880_1267542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300009068|Ga0114973_10294104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300009081|Ga0105098_10079076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300009082|Ga0105099_10503155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300009085|Ga0105103_10473733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300009154|Ga0114963_10261039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
3300009155|Ga0114968_10082836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1991 | Open in IMG/M |
3300009155|Ga0114968_10445346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300009158|Ga0114977_10072553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2110 | Open in IMG/M |
3300009158|Ga0114977_10167997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
3300009159|Ga0114978_10258935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300009160|Ga0114981_10534164 | Not Available | 626 | Open in IMG/M |
3300009163|Ga0114970_10624963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300009165|Ga0105102_10475727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300009168|Ga0105104_10572797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009168|Ga0105104_10944991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300009169|Ga0105097_10848735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300009179|Ga0115028_10625422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300009182|Ga0114959_10636565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300009183|Ga0114974_10603131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300009183|Ga0114974_10704631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300009184|Ga0114976_10087870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
3300009184|Ga0114976_10303562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300009184|Ga0114976_10353360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300009184|Ga0114976_10593275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300009187|Ga0114972_10466739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300009419|Ga0114982_1223998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300009450|Ga0127391_1118605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300010158|Ga0114960_10194413 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300010158|Ga0114960_10584532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300010160|Ga0114967_10061471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2314 | Open in IMG/M |
3300010316|Ga0136655_1109200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300010356|Ga0116237_10960658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300010885|Ga0133913_11478441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
3300010885|Ga0133913_12401408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300010885|Ga0133913_12738013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300012712|Ga0157598_1191267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300012734|Ga0157615_1198889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300012752|Ga0157629_1068546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300012779|Ga0138284_1090197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300013004|Ga0164293_10468983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300014711|Ga0134314_104885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300017707|Ga0181363_1089402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300017716|Ga0181350_1035298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1366 | Open in IMG/M |
3300017736|Ga0181365_1034281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
3300017736|Ga0181365_1174413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300017754|Ga0181344_1083617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300017774|Ga0181358_1277985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300017778|Ga0181349_1220398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300017778|Ga0181349_1305925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017780|Ga0181346_1023984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2553 | Open in IMG/M |
3300017780|Ga0181346_1157153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300017780|Ga0181346_1184546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300018682|Ga0188851_1014171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300020161|Ga0211726_10212815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300020524|Ga0208858_1046185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300021438|Ga0213920_1080362 | Not Available | 635 | Open in IMG/M |
3300021961|Ga0222714_10553367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300021962|Ga0222713_10234869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1204 | Open in IMG/M |
3300021962|Ga0222713_10553150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300022190|Ga0181354_1138986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300024262|Ga0210003_1387894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300024357|Ga0255165_1003281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3518 | Open in IMG/M |
3300024513|Ga0255144_1074272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300024562|Ga0256336_1063265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300025445|Ga0208424_1013500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300027396|Ga0255146_1101057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300027600|Ga0255117_1052382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
3300027644|Ga0209356_1017000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2492 | Open in IMG/M |
3300027707|Ga0209443_1319917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300027733|Ga0209297_1007116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5628 | Open in IMG/M |
3300027743|Ga0209593_10067019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
3300027743|Ga0209593_10233200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300027749|Ga0209084_1009429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6021 | Open in IMG/M |
3300027754|Ga0209596_1033585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2863 | Open in IMG/M |
3300027764|Ga0209134_10161396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300027764|Ga0209134_10295293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300027782|Ga0209500_10007851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6731 | Open in IMG/M |
3300027792|Ga0209287_10386420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300027798|Ga0209353_10087372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
3300027816|Ga0209990_10195115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300027969|Ga0209191_1142878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300028025|Ga0247723_1019440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2324 | Open in IMG/M |
3300028025|Ga0247723_1125346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10565770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300031857|Ga0315909_10226516 | Not Available | 1457 | Open in IMG/M |
3300031857|Ga0315909_10814279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300031951|Ga0315904_10195350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1993 | Open in IMG/M |
3300031951|Ga0315904_10839964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300031963|Ga0315901_10805500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300032050|Ga0315906_10087566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3125 | Open in IMG/M |
3300032092|Ga0315905_10323749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
3300032092|Ga0315905_11041002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300032116|Ga0315903_10054543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4046 | Open in IMG/M |
3300033521|Ga0316616_104808960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300034061|Ga0334987_0034288 | All Organisms → Viruses → Predicted Viral | 4382 | Open in IMG/M |
3300034062|Ga0334995_0071436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2731 | Open in IMG/M |
3300034106|Ga0335036_0506341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 751 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.11% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.87% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.87% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.09% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.30% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.51% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.94% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.36% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.57% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.79% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.79% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.79% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.79% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.79% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25909J50240_10884164 | 3300003393 | Freshwater Lake | KIASPRMGWRWRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA* |
Ga0066181_101976883 | 3300004123 | Freshwater Lake | IIFAGKIASPRMGWRWRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA* |
Ga0068872_106408601 | 3300005528 | Freshwater Lake | GRIASSRMGWRWRKYTGSNPHNQHCHISFTKQGDTDGSFFNIPLLGGTQ* |
Ga0078894_108890425 | 3300005662 | Freshwater Lake | SFWRWRSYNGVNRHDHHIHISFTKKGDKDSSFFQIPMLGANT* |
Ga0075465_101604801 | 3300006037 | Aqueous | KKGWAWREYSGINRHDKHMHVSFTPKGDEDSSYFNIPMIGGK* |
Ga0070744_102115901 | 3300006484 | Estuarine | KAWAWRPYDGINKHNHHAHVSFTPKGDEDSSFFNIPMIGGN* |
Ga0070749_101228411 | 3300006802 | Aqueous | LNWRWRKYRGANPHRQHLHISFTKAGDKDGRFFNVPMLGGDLV* |
Ga0075459_10160425 | 3300006863 | Aqueous | VTYRGFNPHTKHCHISFTKQGDTDDSFFNIPMIGGTQ* |
Ga0075473_101032221 | 3300006875 | Aqueous | SSKKAWAWRPYDGINKHNHHCHVSFTKAGDTDGSFFNIPMLGGK* |
Ga0070748_10813541 | 3300006920 | Aqueous | RGSNPHKSHCHISFTKKGDSDDSFFNIPMIGGSV* |
Ga0070748_10916965 | 3300006920 | Aqueous | YDGINKHNHHCHVSFTKAGDTDGSFFNIPMLGGK* |
Ga0070748_12671043 | 3300006920 | Aqueous | KIASPRMGWRWRKYRGVNPHDHHCHISFTKKGDADGSVFNIPMIGGTL* |
Ga0099846_10367704 | 3300007542 | Aqueous | QGKIASRVRGWRWRPYTGASSHHQHLHISFTKAGDRDGRFFNIPLLGGDLD* |
Ga0114340_12029424 | 3300008107 | Freshwater, Plankton | RWRSYNGVNRHDHHIHISFTKKGDKDSSFFQIPMLGAN* |
Ga0114351_13641014 | 3300008117 | Freshwater, Plankton | WKKYKGINSHHAHIHISFTKEGDQNGSWFDIPMLGVNR* |
Ga0114354_10696495 | 3300008119 | Freshwater, Plankton | KAWAWRPYDGINKHNHHAHISFTIKGDEDSQFFTIPMIGGQ* |
Ga0114363_10369908 | 3300008266 | Freshwater, Plankton | SRMGWRWRKYSGSNPHNAHCHISFTKQGDQDGSFFNIPVLGGKA* |
Ga0114363_11549431 | 3300008266 | Freshwater, Plankton | AGRIASSRMGWRWRKYSGSNPHNAHCHISFTQQGDQDGSFFNIPLLGGTA* |
Ga0114363_11803801 | 3300008266 | Freshwater, Plankton | WAWRPYDGINKHNHHAHVSFTIKGDEDSTWFNIPMIGGK* |
Ga0114363_12077104 | 3300008266 | Freshwater, Plankton | YSGINPHTKHCHVSFTKKGDADGSFFNIPMIGGTA* |
Ga0114876_11291791 | 3300008448 | Freshwater Lake | RMGWRWRKYSGINPHNTHCHVSFTSKGDTDGSFFNIPMLGGTK* |
Ga0114876_12052784 | 3300008448 | Freshwater Lake | WRSYNGVNRHDHHIHISFTKKGDKDSSFFQIPMLGAN* |
Ga0114880_10183021 | 3300008450 | Freshwater Lake | AWRPYDGINKHNHHAHVSFTIKGDEDSSWFNIPMIGGK* |
Ga0114880_10684791 | 3300008450 | Freshwater Lake | KAWRWRPYDGINKHNHHAHISFTTKGDEDSTWFNIPMIGGTA* |
Ga0114880_11049851 | 3300008450 | Freshwater Lake | AWRPYDGINKHNHHAHVSFTIKGDEDSSWFNIPMIGGN* |
Ga0114880_11336981 | 3300008450 | Freshwater Lake | SPRMGWRWRKYSGSNPHNKHCHISFTTKGDTDGSFFNIPLLGGTV* |
Ga0114880_11822584 | 3300008450 | Freshwater Lake | KKAWRWRPYDGINKHNHHAHVSFTPKGDEDSTWFNIPMIGGN* |
Ga0114880_11917681 | 3300008450 | Freshwater Lake | AWRWRPYDGINKHNHHAHISFTTKGDEDSTWFNIPMIGGN* |
Ga0114880_11934941 | 3300008450 | Freshwater Lake | RWRPYDGINKHNHHAHISFTTKGDEDSTWFNIPMIGGTA* |
Ga0114880_12675421 | 3300008450 | Freshwater Lake | RWRTYTGINKHRHHLHVSFSIKGDQDGSFFQIPLLGASK* |
Ga0114973_102941041 | 3300009068 | Freshwater Lake | KAWAWRPYDGINKHNHHAHISFTIKGDEDNSWFNIPMIGGK* |
Ga0105098_100790765 | 3300009081 | Freshwater Sediment | YRGINPHNTHCHVSFTKKGDADGSFFNIPMIGGTV* |
Ga0105099_105031551 | 3300009082 | Freshwater Sediment | EGRIASSRMGWRWRKYSGSNPHSKHCHVSFTKQGDADGSFFNIPLLGGN* |
Ga0105103_104737331 | 3300009085 | Freshwater Sediment | RKYKGSNPHIAHCHISFTKAGDNDGSFFNIPLLGGTA* |
Ga0114963_102610395 | 3300009154 | Freshwater Lake | AWAWRPYDGANKHNHHCHISFTQAGDTDGSFFNIPMIGGKA* |
Ga0114968_100828366 | 3300009155 | Freshwater Lake | YDGINRHDHHIHISFTKEGDQNGRWFDIPMLGANK* |
Ga0114968_104453461 | 3300009155 | Freshwater Lake | PYSGINKHNHHCHISFTKKGDADGSFFNVPMIGGTA* |
Ga0114977_100725531 | 3300009158 | Freshwater Lake | YKGANKHNHHCHISFKKEADNDGSFFQIPMLGGTHDSGN* |
Ga0114977_101679975 | 3300009158 | Freshwater Lake | DGINQHNHHIHISFTKEGDSNGRWFEIPMLGATNENN* |
Ga0114978_102589355 | 3300009159 | Freshwater Lake | KYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA* |
Ga0114981_105341641 | 3300009160 | Freshwater Lake | GINAHTHHIHVSFAKTADEDSSFFNIPMVGGING* |
Ga0114970_106249634 | 3300009163 | Freshwater Lake | RNYSGFSRHDHHIHISFTKEGDENGSWFDIPMLGANNERP* |
Ga0105102_104757271 | 3300009165 | Freshwater Sediment | SSRMGWRWRKYSGINPHIKHCHISFTKKGDTDSSFFNIPMIGGTV* |
Ga0105104_105727974 | 3300009168 | Freshwater Sediment | SRMGWRWRKYSGSNPHRAHCHVSFTRKGDKDGSFFQIPLLGADK* |
Ga0105104_109449911 | 3300009168 | Freshwater Sediment | IFEGRIASSRMGWRWRKYSGSNPHNKHCHISFTTKGDTDSSFFNIPMLGAE* |
Ga0105097_108487352 | 3300009169 | Freshwater Sediment | GWRWRKYSGINPHNAHCHVSFTKAGDKDGSFFNIPLLGGE* |
Ga0115028_106254225 | 3300009179 | Wetland | IAYVIFDGRIASPRLGWRWRVYRGSNPHRAHCHISFTKAGDNDGSFFNIPLLGGTQ* |
Ga0114959_106365654 | 3300009182 | Freshwater Lake | PYDGVNKHNHHCHVSFTKAGDNDSSFFNIPMIGGTV* |
Ga0114974_106031314 | 3300009183 | Freshwater Lake | RWKPYSGINKHDHHCHISFTSKGDKDGSFFNIPLLGATK* |
Ga0114974_107046311 | 3300009183 | Freshwater Lake | WRWRTYTGINQHRHHCHISFTIKGDEDGSFFNIPLLGANK* |
Ga0114976_100878701 | 3300009184 | Freshwater Lake | WRPYDGINKHNHHCHISFTKEADEASDFFQIPLIGGTK* |
Ga0114976_103035623 | 3300009184 | Freshwater Lake | SSKKAWAWRPYDGINKHNHHAHISFTIKGDEDNSWFNIPMIGGN* |
Ga0114976_103533601 | 3300009184 | Freshwater Lake | TGINKHDHHCHISFTVKGDEDGSFFNIPLLGATK* |
Ga0114976_105932753 | 3300009184 | Freshwater Lake | KSWSWRTYDGINRHDHHIHISFTKEGDQNGRWFDIPMLGAKHE* |
Ga0114972_104667394 | 3300009187 | Freshwater Lake | SRLGWRWRKYSGINKHDHHCHISFTKKGDADGSFFNIPMLGGTA* |
Ga0114982_12239981 | 3300009419 | Deep Subsurface | LWRWRTYSGINRHDAHIHISFTKKGDKDSSFFQIPMLGANT* |
Ga0127391_11186053 | 3300009450 | Meromictic Pond | GRIASSRMGWRWRKYRGINPHNTHLHVSFSPKGDTDGSFFFIQ* |
Ga0114960_101944131 | 3300010158 | Freshwater Lake | WAWRPYDGINKHNHHCHISFTQAGDNDSSFFNIPMLGGK* |
Ga0114960_105845323 | 3300010158 | Freshwater Lake | PYDGINKHNHHCHISFTQAGDNDSSFFNIPMLGGK* |
Ga0114967_100614716 | 3300010160 | Freshwater Lake | LGWKWRKYTGINKHNHHCHISFTKEADLNSEFLQIPMIGGSSNG* |
Ga0136655_11092001 | 3300010316 | Freshwater To Marine Saline Gradient | RPYSGINSHHAHIHISFTKKGDENGSWFEIPMLGAGNENN* |
Ga0116237_109606582 | 3300010356 | Anaerobic Digestor Sludge | RKAWRWRPYDGINKHRHHAHVSFTTKGDEDSKWFNIPMIGGN* |
Ga0133913_114784416 | 3300010885 | Freshwater Lake | YNGFNKHNHHCHISFTKEGDSNNSFFNIPMIGGK* |
Ga0133913_124014085 | 3300010885 | Freshwater Lake | RTYTGINKHNHHCHISFTKKGDADGSFFNVPMIGGTA* |
Ga0133913_127380131 | 3300010885 | Freshwater Lake | KIASSKKAWAWRPYDGINKHNHHAHFSFTIKGDEDSNFFNIPMIGGQ* |
Ga0157598_11912671 | 3300012712 | Freshwater | RIASSRMGWRWRKYKGSNPHNKHCHISFTTKGDTDSSFFNIPMLGAE* |
Ga0157615_11988891 | 3300012734 | Freshwater | RMGWRWRKYKGSNPHNKHCHISFHPAGDVDSSFFNIPMLGAE* |
Ga0157629_10685464 | 3300012752 | Freshwater | WRWRKYKGSNPHNKHCHISFHPAGDVDSSFFNIPMLGAE* |
Ga0138284_10901971 | 3300012779 | Freshwater Lake | WRWRKYSGINKHDHHCHISFTKKGDADGSFFNIPMIGGTA* |
Ga0164293_104689831 | 3300013004 | Freshwater | WRWRKYSGINPHDHHCHISFSKKGDADGSFFNIPMIGGTA* |
Ga0134314_1048851 | 3300014711 | Surface Water | AFRPYQGLNPHNHHCHVSFTKEGDTDGSPFQIPMLKEI* |
Ga0181363_10894023 | 3300017707 | Freshwater Lake | RIASSKKNWSWRIYSGFSRHDHHIHISFSKEGDQNGSWFDIPMLGVNK |
Ga0181350_10352981 | 3300017716 | Freshwater Lake | KAWAWRPYDGINKHNHHAHVSFTIKGDEDSSFFNIPMIGGN |
Ga0181365_10342814 | 3300017736 | Freshwater Lake | KYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0181365_11744131 | 3300017736 | Freshwater Lake | IPYKGINKHAHHAHISFTRKGDEDGSFFNIPLLGATK |
Ga0181344_10836175 | 3300017754 | Freshwater Lake | AWAWRPYDGINKHNHHAHFSFTIKGDEDSSFFNIPMIGGN |
Ga0181358_12779853 | 3300017774 | Freshwater Lake | WRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTT |
Ga0181349_12203981 | 3300017778 | Freshwater Lake | IASAKKAWAWRSYDGINKHNHHAHVSFTIKGDEDSSWFNIPMIGGK |
Ga0181349_13059253 | 3300017778 | Freshwater Lake | AWAWRPYDGINKHNHHAHISFTIKGDEDSQFFTIPMIGGQ |
Ga0181346_10239848 | 3300017780 | Freshwater Lake | VTYKGINSHHAHIHISFTKEGDQNGSWFDIPMLGATNE |
Ga0181346_11571533 | 3300017780 | Freshwater Lake | GKIASSKKAWAWRPYDGINKHNHHAHFSFTTKGDEDNSWFNIPMIGGK |
Ga0181346_11845461 | 3300017780 | Freshwater Lake | KIASPRMGWRWRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0188851_10141714 | 3300018682 | Freshwater Lake | YIIFAGRIASSRMGWRWRKYRGVNPHDKHCHISFTKKGDSDDSFFSNIPMIGGSV |
Ga0211726_102128151 | 3300020161 | Freshwater | ILNWRWRKYKGINPHKKHLHCSFTKAGDLDGSPFNIPLIGGKI |
Ga0208858_10461853 | 3300020524 | Freshwater | KWKWRKYTGINKHNHHCHISFTKEADLNGEFLQIPMIGESQ |
Ga0213920_10803624 | 3300021438 | Freshwater | KKSWAWRPYDGINKHNHHCHISFTKVGDNDSSFFNIPMIGGKP |
Ga0222714_105533671 | 3300021961 | Estuarine Water | GKIASPRMGWRWRKYRGINPHDHHCHISFTKQGDTDSSFFNIPMIGGTV |
Ga0222713_102348691 | 3300021962 | Estuarine Water | WRKYTGINKHEHHIHISFAKTEDLNSEFFNIPMIGGTDA |
Ga0222713_105531501 | 3300021962 | Estuarine Water | KSFWRWRSYNGINRHDHHIHISFTKKGDKDSSFFQIPMLGANT |
Ga0181354_11389861 | 3300022190 | Freshwater Lake | RWRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0210003_13878943 | 3300024262 | Deep Subsurface | IFQGKIASPRMGWRWRKYRGSNPHNMHCHISFTKAGDKDGSFFNIPLLGGTNDKDKR |
Ga0255165_10032811 | 3300024357 | Freshwater | AWRPYDGLNRHVKHLHCSFTKKGDQDGSFFNIPMIGGSI |
Ga0255144_10742721 | 3300024513 | Freshwater | RPYDGLNRHTKHCHISFTKKGDHDGSFFNIPMIGGSV |
Ga0256336_10632651 | 3300024562 | Freshwater | KKNWAWRPYDGVNRHVKHLHCSFTKKGDQDGSFFNIPMIGGSV |
Ga0208424_10135005 | 3300025445 | Aqueous | YSGSNPHKHHCHISFTPKGDTDGSFFNIPMLGGTK |
Ga0255146_11010571 | 3300027396 | Freshwater | NWAWRPYDGLNRHVKHLHCSFTKKGDQDGSFFNIPMIGGSI |
Ga0255117_10523821 | 3300027600 | Freshwater | RKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0209356_10170001 | 3300027644 | Freshwater Lake | KKAWAWRPYDGINKHNHHAHVSFTIKGDEDSQFFTIPMIGGK |
Ga0209443_13199173 | 3300027707 | Freshwater Lake | AKKAWAWRSYDGINKHNHHAHVSFTIKGDEDSQFFTIPMIGGK |
Ga0209297_10071161 | 3300027733 | Freshwater Lake | WKPYSGINKHDHHCHISFTSKGDEDGAFFNIPLLGASK |
Ga0209593_100670191 | 3300027743 | Freshwater Sediment | IFEGRIASPRMGWRWRKYSGSNPHNAHCHVSFTKQGDKDGSFFNIPLLGGE |
Ga0209593_102332001 | 3300027743 | Freshwater Sediment | IASSRMGWRWRKYSGSNPHRAHCHVSFTRKGDKDGSFFQIPLLGADK |
Ga0209084_10094291 | 3300027749 | Freshwater Lake | WAWRPYDGINKHNHHCHISFTQAGDNDSSFFNIPMLGGK |
Ga0209596_10335851 | 3300027754 | Freshwater Lake | KYTGINAHTHHIHVSFAKTADEDSSFFNIPMVGGTNG |
Ga0209134_101613961 | 3300027764 | Freshwater Lake | KIASSKKAWAWRTYDGINKHNHHAHFSFTIKGDSDSTFFNIPMIGGK |
Ga0209134_102952931 | 3300027764 | Freshwater Lake | KYTGSNPHNHHCHISFTSKGDQDGSFFQIPLLGATK |
Ga0209500_1000785116 | 3300027782 | Freshwater Lake | LWRWVAYRGINPHIKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0209287_103864203 | 3300027792 | Freshwater Sediment | YIIFAGKIASPRMGWRWRKYSGINPHDKHCHISFTKQGDSDDSFFNIPMIGGTL |
Ga0209353_100873724 | 3300027798 | Freshwater Lake | IIFQGKIASPRMGWRWRKYSGINPHTKHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0209990_101951151 | 3300027816 | Freshwater Lake | SPRKAWRWRPYDGINQHRHHAHVSFTTKGDEDFTWFNIPMIGGN |
Ga0209191_11428781 | 3300027969 | Freshwater Lake | WAWRPYDGVNKHNHHCHVSFTKAGDTDSSFFNIPMIGGTQ |
Ga0247723_10194401 | 3300028025 | Deep Subsurface Sediment | KSFWRWRSYNGVNRHDHHIHISFTKKGDKDSSFFQIPMLGANT |
Ga0247723_11253461 | 3300028025 | Deep Subsurface Sediment | VRIASARLGFRWRKYTGSNPHHAHCHISFTKKGDADGSFFNIPMIGGTQ |
(restricted) Ga0247842_105657701 | 3300029268 | Freshwater | ASPRKAWRWRSYDGINQHRAHAHFSFTIKGDEDRSFFDIPMIGGQ |
Ga0315909_102265164 | 3300031857 | Freshwater | IASSKKAWAWRPYDGINQHRAHAHFSFTIKGDEDRSFFDVPMIGGK |
Ga0315909_108142791 | 3300031857 | Freshwater | WRKFSGSNPHNKHCHISFTTKGDSDGSFFNIPLLGGTV |
Ga0315904_101953506 | 3300031951 | Freshwater | WRKYRGANPHRQHLHISFTKAGDKDGRFFNVPMLGGDLV |
Ga0315904_108399641 | 3300031951 | Freshwater | RWRKYSGSNPHNKHCHISFTTKGDTDGSFFNIPLLGGTV |
Ga0315901_108055001 | 3300031963 | Freshwater | RKYTGSNPHDKHCHISFTSKGDQDGSFFNIPLLGGK |
Ga0315906_100875661 | 3300032050 | Freshwater | FSGSNPHNKHCHISFTTKGDSDGSFFNIPLLGGTV |
Ga0315905_103237496 | 3300032092 | Freshwater | KAWAWRPYDGINKHNHHAHISFTIKGDEDSQFFTIPMIGGQ |
Ga0315905_110410021 | 3300032092 | Freshwater | KAWAWRPYDGINKHNHHAHISFTIKGDEDNSWFNIPMIGGN |
Ga0315903_100545431 | 3300032116 | Freshwater | KSFWRWRSYNGVNRHDHHIHISFTKKGDKDSSFFQIPMLGAN |
Ga0316616_1048089603 | 3300033521 | Soil | AKSFWRWRSYSGVNRHDHHIHISFTKKGDSDSSFFQIPMLGAN |
Ga0334987_0034288_4226_4354 | 3300034061 | Freshwater | MGWRWRKYSGINPHDHHCHISFTKKGDADGSFFNIPMIGGTA |
Ga0334995_0071436_2_130 | 3300034062 | Freshwater | MGWRWRKYSGINPHDHHCHISFTKKGDADGSFFNIPMIGGTV |
Ga0335036_0506341_2_133 | 3300034106 | Freshwater | KKSWRWRPYDGINRHDHHIHISFTKEGDQNGSWFDIPMLGADK |
⦗Top⦘ |