NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065750

Metagenome / Metatranscriptome Family F065750

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065750
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 187 residues
Representative Sequence PTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Number of Associated Samples 105
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 29.92 %
% of genes near scaffold ends (potentially truncated) 71.65 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.583 % of family members)
Environment Ontology (ENVO) Unclassified
(51.181 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.094 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 1.79%    β-sheet: 32.14%    Coil/Unstructured: 66.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00849PseudoU_synth_2 34.65
PF05193Peptidase_M16_C 5.51
PF00005ABC_tran 1.57
PF13185GAF_2 0.79
PF00547Urease_gamma 0.79
PF01168Ala_racemase_N 0.79
PF01475FUR 0.79
PF02405MlaE 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 34.65
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 34.65
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.79
COG0767Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2344966All Organisms → cellular organisms → Bacteria → Proteobacteria1915Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105322988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1182Open in IMG/M
3300000443|F12B_11289486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium594Open in IMG/M
3300002899|JGIcombinedJ43975_10083921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium568Open in IMG/M
3300003659|JGI25404J52841_10002603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3440Open in IMG/M
3300004114|Ga0062593_101148912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales810Open in IMG/M
3300004156|Ga0062589_100523524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1006Open in IMG/M
3300004479|Ga0062595_101462825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales627Open in IMG/M
3300005329|Ga0070683_100310609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca1500Open in IMG/M
3300005355|Ga0070671_100221769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1604Open in IMG/M
3300005545|Ga0070695_100109384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1873Open in IMG/M
3300005983|Ga0081540_1000162All Organisms → cellular organisms → Bacteria → Proteobacteria68999Open in IMG/M
3300005983|Ga0081540_1002990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales13551Open in IMG/M
3300005983|Ga0081540_1003667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales12045Open in IMG/M
3300006605|Ga0074057_11743336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium598Open in IMG/M
3300006904|Ga0075424_100752429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1040Open in IMG/M
3300009092|Ga0105250_10094845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra1216Open in IMG/M
3300009168|Ga0105104_10041644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2528Open in IMG/M
3300009174|Ga0105241_12074240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium561Open in IMG/M
3300009792|Ga0126374_10489044All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium884Open in IMG/M
3300010048|Ga0126373_12372288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium590Open in IMG/M
3300010359|Ga0126376_11190354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium776Open in IMG/M
3300010360|Ga0126372_10954647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium865Open in IMG/M
3300010360|Ga0126372_12851958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium535Open in IMG/M
3300010361|Ga0126378_11386997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium795Open in IMG/M
3300010366|Ga0126379_11364403All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium815Open in IMG/M
3300010376|Ga0126381_100293752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2222Open in IMG/M
3300010376|Ga0126381_102285945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium777Open in IMG/M
3300010398|Ga0126383_10437560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1354Open in IMG/M
3300011107|Ga0151490_1517633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium575Open in IMG/M
3300012957|Ga0164303_11475905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium512Open in IMG/M
3300012960|Ga0164301_11085168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium635Open in IMG/M
3300013104|Ga0157370_11321202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium649Open in IMG/M
3300014497|Ga0182008_10415290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium725Open in IMG/M
3300015371|Ga0132258_10377754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3513Open in IMG/M
3300015371|Ga0132258_11355818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1797Open in IMG/M
3300015372|Ga0132256_100103588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2776Open in IMG/M
3300015372|Ga0132256_100791800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1064Open in IMG/M
3300015372|Ga0132256_101137754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium895Open in IMG/M
3300015373|Ga0132257_100042321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae5028Open in IMG/M
3300015373|Ga0132257_100649526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1307Open in IMG/M
3300015374|Ga0132255_100571697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1668Open in IMG/M
3300015374|Ga0132255_105129730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium554Open in IMG/M
3300016270|Ga0182036_10894612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium727Open in IMG/M
3300016319|Ga0182033_10091528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2211Open in IMG/M
3300016341|Ga0182035_10879628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium789Open in IMG/M
3300016357|Ga0182032_11172919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium660Open in IMG/M
3300016371|Ga0182034_10652768All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae891Open in IMG/M
3300016404|Ga0182037_11937567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium528Open in IMG/M
3300016445|Ga0182038_11027730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium730Open in IMG/M
3300021377|Ga0213874_10016715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1959Open in IMG/M
3300021445|Ga0182009_10038946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1952Open in IMG/M
3300021560|Ga0126371_13240065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium550Open in IMG/M
3300025461|Ga0208851_1000509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales16874Open in IMG/M
3300025920|Ga0207649_10091781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1990Open in IMG/M
3300025921|Ga0207652_10231069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1667Open in IMG/M
3300025931|Ga0207644_10985733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium707Open in IMG/M
3300025935|Ga0207709_10041798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2753Open in IMG/M
3300025981|Ga0207640_10000709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae19311Open in IMG/M
3300026088|Ga0207641_10415628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1294Open in IMG/M
3300027743|Ga0209593_10025782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2348Open in IMG/M
3300027902|Ga0209048_10943012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → unclassified Archangium → Archangium sp. Cb G35555Open in IMG/M
3300031538|Ga0310888_10062564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1784Open in IMG/M
3300031543|Ga0318516_10181636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1212Open in IMG/M
3300031543|Ga0318516_10342220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium863Open in IMG/M
3300031544|Ga0318534_10181103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1217Open in IMG/M
3300031564|Ga0318573_10060630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1869Open in IMG/M
3300031572|Ga0318515_10257378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium936Open in IMG/M
3300031680|Ga0318574_10309308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium919Open in IMG/M
3300031681|Ga0318572_10232393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1082Open in IMG/M
3300031681|Ga0318572_10596691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium658Open in IMG/M
3300031713|Ga0318496_10013144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3970Open in IMG/M
3300031713|Ga0318496_10269575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium939Open in IMG/M
3300031719|Ga0306917_11333066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium555Open in IMG/M
3300031723|Ga0318493_10176674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1118Open in IMG/M
3300031723|Ga0318493_10316105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium845Open in IMG/M
3300031744|Ga0306918_10154037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1700Open in IMG/M
3300031747|Ga0318502_10207005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1136Open in IMG/M
3300031751|Ga0318494_10238372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1041Open in IMG/M
3300031751|Ga0318494_10263111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium991Open in IMG/M
3300031765|Ga0318554_10482205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium702Open in IMG/M
3300031768|Ga0318509_10315413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium875Open in IMG/M
3300031768|Ga0318509_10590563All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium619Open in IMG/M
3300031770|Ga0318521_10183465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1202Open in IMG/M
3300031771|Ga0318546_10637971All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium749Open in IMG/M
3300031771|Ga0318546_10662215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium734Open in IMG/M
3300031781|Ga0318547_10093495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1706Open in IMG/M
3300031781|Ga0318547_10872996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium561Open in IMG/M
3300031792|Ga0318529_10389209All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium649Open in IMG/M
3300031805|Ga0318497_10092164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1617Open in IMG/M
3300031819|Ga0318568_10983173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium521Open in IMG/M
3300031821|Ga0318567_10442399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium737Open in IMG/M
3300031835|Ga0318517_10139745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1079Open in IMG/M
3300031845|Ga0318511_10054648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1611Open in IMG/M
3300031846|Ga0318512_10283747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium821Open in IMG/M
3300031846|Ga0318512_10351461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium737Open in IMG/M
3300031854|Ga0310904_10952307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium609Open in IMG/M
3300031860|Ga0318495_10138562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1096Open in IMG/M
3300031860|Ga0318495_10340733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium664Open in IMG/M
3300031879|Ga0306919_10743605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium755Open in IMG/M
3300031890|Ga0306925_10960991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium874Open in IMG/M
3300031896|Ga0318551_10254264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium982Open in IMG/M
3300031896|Ga0318551_10401202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium780Open in IMG/M
3300031910|Ga0306923_11067363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium872Open in IMG/M
3300031912|Ga0306921_11073011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium904Open in IMG/M
3300031954|Ga0306926_10118177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3266Open in IMG/M
3300032009|Ga0318563_10132944All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1329Open in IMG/M
3300032009|Ga0318563_10201155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1074Open in IMG/M
3300032041|Ga0318549_10155488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1019Open in IMG/M
3300032043|Ga0318556_10321441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium809Open in IMG/M
3300032054|Ga0318570_10218097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium863Open in IMG/M
3300032055|Ga0318575_10664842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium527Open in IMG/M
3300032064|Ga0318510_10434978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium562Open in IMG/M
3300032065|Ga0318513_10339173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium731Open in IMG/M
3300032066|Ga0318514_10134441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1275Open in IMG/M
3300032067|Ga0318524_10464249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium663Open in IMG/M
3300032068|Ga0318553_10156916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1179Open in IMG/M
3300032089|Ga0318525_10036425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2416Open in IMG/M
3300032090|Ga0318518_10570371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium578Open in IMG/M
3300032211|Ga0310896_10293426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium838Open in IMG/M
3300032261|Ga0306920_100113865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales4012Open in IMG/M
3300032261|Ga0306920_101464182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium976Open in IMG/M
3300032421|Ga0310812_10265307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium758Open in IMG/M
3300032782|Ga0335082_10335572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1381Open in IMG/M
3300033290|Ga0318519_10232986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1060Open in IMG/M
3300033412|Ga0310810_10554977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1121Open in IMG/M
3300034820|Ga0373959_0196456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium531Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.15%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.57%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.57%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.79%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_234496623300000033SoilVTRVLCLLVALCLAGCTGATLPPPTVVSVSPAQRPASSSGPVTVMVDAVLPTFVDHSAQAVSVDDRLTLSIGPRPFGPSRWADGGVITDFLPSVLPQGSYDVTVELADGRLATATDAFRVSQGTWPTGYTXDLIPDQHSGVPFGVTLRAQGGQDGGYIGTVNFSVNGATVSPTVSGPFTGGVRVEVITVTVNRPASYQLVVSDLGGRSGTSLFFYVXR*
INPhiseqgaiiFebDRAFT_10532298823300000364SoilVSRLSCLLAVLCLAGCSGAALPAPSVVSVSPADRPASSSGPVTVTLDAVLPTLSDHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSDVPFGVTIRAQGGTDGGYVGTVNFAVPGATVSPVISGPFSAGVRVELITVTVDHPGNYHLDVSDLAGRTGRSLNFQISQ*
F12B_1128948623300000443SoilGPVTVMVDAVLPTFVDHSAQAVSVDDRLTLSIGPRPFGPSRWADGGVITDFLPSVLPQGSYDVTVELADGRLATATDAFRVSQGTWPTGYTIDLIPDQHSGVPFGVTLRAQGGQDGGYIGTVNFSVNGATVSPTVSGPFTGGVRVEVITVTVNRPASYQLVVSDLGGRSGTSLFFYVNR*
JGIcombinedJ43975_1008392113300002899SoilCTGATLPPPAVVSVSPAQRPASSSGPVTVMVDAVLPTFVDHSAQAVSVDDRLTLSIGPRPFGPSRWADGGVITDFLPSVLPQGSYDVTVELADGRLATATDAFRVSQGTWPTGYTIDLIPDQHSGVPFGVTLRAQGGQDGGYIGTVNFSVNGATVSPTVSGPFTGGVRVEVITVTVNRPASYQLVVSD
JGI25404J52841_1000260313300003659Tabebuia Heterophylla RhizosphereVTRALRFLIALCIAGCGGATLPPPSVVSVSPAARPASTSGPVTLTLDAVLPTFADHGSSTATVDDRMTVKIGPRTFGPSRWADAGVITDFLPSVLPEGSYDVTLVLGDGRLAMATDAFRVSAGTWPVGYTIDTIPEQTSGSPFGVTLRAQGGQDGGYIGTVNFAVPGASVTPTISGPFEAGLRVEVITVTVPRPGNYHLDVSDLGGRTGRSLDFRVNQ*
Ga0062593_10114891213300004114SoilPTVVSVSPAARRASTSGPVTVTIDAVLPTVADHGTNTVTVDDRLTVTIGPRPFGPSRWADAGVISDFLPSVLPEGSYDVTVELGDGRLATATDALHITPGEWPVGYTVGMIGDQTSGVPFGVTLRAQGAPDAGYTGTVFLSVPDATVVPSVTGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAR*
Ga0062589_10052352423300004156SoilDHGTNTVTVDDRLTVTIGPRPFGPSRWADAGVISDFLPSVLPEGSYDVTVELGDGRLATATDALHITPGEWPVGYTVGMIGDQTSGVPFGVTLRAQGAPDAGYTGTVFLSVPDATVVPSVTGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAR*
Ga0062595_10146282513300004479SoilLTIGPRPFGPSRWADAGVITDFLPSVLPDGSYDVTVELGDGRRATATAALRVTPGDWPVGYTIDMIGDQTSGVPFGVTVRARGAPDGGYDGTVYLSVPGATVSPAISGPFSGGVRVEVITVTVDGAGMYHLDVSDLAGRTGRSLNFRVSQ*
Ga0070683_10031060923300005329Corn RhizosphereVTRVLRLVVALCLAGCTGATLPPPTVVSVSPAQRPASSSGPVTVTVDAVLPTFVDHSAQAVSVDDRLTLSIGPRTFGPSRWADAGVITDFLPSVLPQGSYDVTVELADGRLATATDVFRVSPGTWPVGYTIDTIPDQHSGVPFGVTLRAQGGQDGGYIGTVNLSVPGATVSPGISGPFVAGVRVEVITVTVSRPASHQLVVSDLGGGPGGTSLFFYVDR*
Ga0070671_10022176923300005355Switchgrass RhizosphereVSRLRCLLTVLLLAGCSGATLPPPTVVSVSPAERPASSSGPVTVTLDAVLPTRADHGTNTVTVDDRLTLTIGPRPFGPSRWADAGMISDFLPSVLADGSYDVTVELGDGRLATATDAFRVTPGDWPVGYTLDMIGDQTSGVPFGVTLRARGAPDGGYGGTVFLAVPGASVSPAISGPFSGGVRVEVITVTVDDPGMFHLDVSDLAGRTGRSLNFRVSQ*
Ga0070695_10010938413300005545Corn, Switchgrass And Miscanthus RhizosphereGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ*
Ga0081540_100016243300005983Tabebuia Heterophylla RhizosphereVSRLRCLVAGLCLAGCSGATLPAPAVVSVTPAERPASSSGPVTVTIDAVLPTLADHGLSTVTVDDNLTLKIGPRPFGPSHWADAGVITDFLPSVLPDGNYDVTVELGDGRLTTATSAFRVTTGEWPTGYIIDMIANQRSGVPFGVTLRAQGGQDGGYDGTVYLSVPGATVDPLISGPFLAGVRVEVITVTVDHPGQYHLDVSDLGGRTGRSLNFQISQ*
Ga0081540_1002990113300005983Tabebuia Heterophylla RhizosphereVTRALRFLIALCIAGCGGATLPPPSVVSVSPAARPASTSGPVTLTLDAVLPTFADHGSSTATVDDRMTVKIGPRTFGPSRWADAGVITDFLPSVLPEGSYDVTLVLGDGRLAMATDAFRVSAGTWPVGYTIDTIPEQTSGSPFGVTLRAQGGQDGGYIGTVNFAVPGASVTPTISGPFEAGLRVEVITVTVSRPGNYHLDVSDLGGRTGRSLDFRVNQ*
Ga0081540_100366783300005983Tabebuia Heterophylla RhizosphereVSRPLPLSLLVLALAACNGATLSPPTVVSVSPPDRAASSSGPVTVTVDAVLPTVADHGAQTVTVDDRLTMKIGPRPFGPSHWADAGVIADFLPSVLPEGTYDITVELGDGRLATATGAFRVTQGFWPIGYTIDMIGGQTSGVPFGVTMRAQGAPDGGYGGTVFLSVNGATVSPTISGPFNAGVRVEVITVTVANPGSYRLDVSDLAGRTGHSVNFQVRQ*
Ga0074057_1174333623300006605SoilVILDAVLPTRADHGTNTVTVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPDGSYDVTVELGDGRRATATAALRVTPGDWPVGYTIDMIGDQTSGVPFGVTVRARGAPDGGYDGTVYLSVPGATVSPAISGPFSGGVRVEVITVTVDGAGMYHLDVSDLAGRTGRSLNFRVAQ*
Ga0075424_10075242923300006904Populus RhizosphereISGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRLATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHAGQYHLEVMDLDGRPGRSLDFHVAQ*
Ga0105250_1009484523300009092Switchgrass RhizosphereASTSGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ*
Ga0105104_1004164433300009168Freshwater SedimentVIRVVRLLVALCLAGCSGATLPPPIVVSVSPAQRPASSSGPVTVTLDAVLPTVADHGASTVSVDDRLTLTIGPRPFGPSHWADAGVITDFLPSVLSEGSYDVMVELGDGRLAMATDVFRVTAGTWPVGYTIDTIPDQHSGIPFGVTLRAQGGQNGGYIGTVNFSVPGATVSPAVSGPFVGGVRVEVITVTVDRPASYQLEVSDLAGRRGRSLFFYVNQ*
Ga0105241_1207424013300009174Corn RhizosphereCSGATLPPPTIVSVSPAERPASSSGELTVTLDAILPTLANHGADTVTVDDRLTVTIGPRPFGPSRWADAGVLSDFVASVLPEGSYDVTVELGDGRLATATGAFRVTTGDWPVGYTVGMIGDQTSGVPFGVTLRAQGGMDGGYIGTVNLAVPNATVSPSVSGPFSAGLRVETVTVTVDHPGTYHLDVS
Ga0126374_1048904423300009792Tropical Forest SoilVLPTLADHGLNTVTVDDSLTMKIGPRPFGPSHWADAGVISDFLPSVLPEGSYDVTVELGDGRLTTATGGFRVTAGAWPVGYTVDMIGGQRSGSPFGVTIRAQGAPDGGYGGTVNFTVPGASVTPAISGPFAAGVRVEVITVTVDNPAQYHLDVSDLAGRTGRSLDFHISQ*
Ga0126373_1237228813300010048Tropical Forest SoilVTVTLDAVLPTLADHGEQTVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGGYDVTVELGDGRLTTATGAFRVTAGDWPVGYTIDMIGGQKSGVPFGVTIRAQGAPDGGYGGTVNLAVPGAAVSPGISGPFAAGVRVEVITVTVDHSGLYHLDVSDLAGRTGRSLNFQINQ*
Ga0126376_1119035423300010359Tropical Forest SoilVVSVSPAERPASSSGTVTVTVDAVLPTLADHGLNTVTVDDSLTMKIGPRPFGPSHWADAGVISDFLPSVLPEGSYDVTVELGDGRLTTATGGFRVTAGDWPVGYTLDMIGGQRSGSPFGVTIRAQGAPDGGYGGTVNFTVPGASVTPAISGPFAAGVRVEVITVTVD
Ga0126372_1095464723300010360Tropical Forest SoilVVSVSPAERPASSSGTVTVTVDAVLPTLADHGLNTVTVDDSLTMKIGPRPFGPSHWADAGVISDFLPSVLPEGSYDVTVELGDGRLTTATGGFRVTAGAWPVGYTVDMIGGQRSGSPFGVTIRAQGAPDGGYGGTVNFTVPGASVTPAISGPFAAGVRVEVITVTVDNPGQYHLDVSDLAGRTGRSLDFHISQ*
Ga0126372_1285195813300010360Tropical Forest SoilFVDHSAQAVSVDDRLNLKIGPRPFGPSRWADGGVITDFLPSILPEGSYDVTLELADGRLATATNAFRVSAGTWPVGYTIDTIPDQRSGIPFGVTLRAQGGQDGGYIGTVNLTVPGATVSPAISGPFVAGVRVEVITVTVDHSASYHLFVSDLGGRGGQSLFFFVNR*
Ga0126378_1138699713300010361Tropical Forest SoilCQTALMALCLAACSGASLPAPTVVSVNPAERPASSSGPVTVTIDAVLPTLADHGLETVTIDDSLSVRIGPRPFGPSHWADAGVITDFVPSVLSEGSYDVTVELGDGRLTTASSAFTVTAGTWPVGYIVDMIGDQTSGVPFGVTIRAQGGADGGYTGTVNFAVPGATVSPQISGPFAAGVRVELITITADHSGQYHLDVSDLAGRTGRSLNFQLAQ*
Ga0126379_1136440313300010366Tropical Forest SoilSSGPVTVTLDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFVPSVLPEGSYDVTVELGDDRLTTATGAFRVTAGDWPVGYTIDMIGGQRSGTPFGVTIRAQGAPDGGYGGTVNLAVAGARVSPGISGPFAAGVRVEVITVTVDHSAAYHLDVSDLAGRTGRSLNFQINQ*
Ga0126381_10029375233300010376Tropical Forest SoilMALCLAACSGASLPAPTVVSVNPAERPASSSGPVTVTIDAVLPTLADHGLETVTIDDRLSVRIGPRPFGPSHWADAGVITDFVPSVLSEGSYDVTVELGDGRLTTASSAFTVTAGTWPVGYIVDMIGDQTSGVPFGVTIRAQGGADGGYTGTVNFAVPGATVSPQISGPFAAGVRVELITITADHSGQYHLDVSDLAGRTGRSLNFQLAQ*
Ga0126381_10228594513300010376Tropical Forest SoilVSRIPCLLAGICLAGCSGATLPEPRVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFVPSVLPEGSYDVTVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGTPFGVTIRAQGAPDGGYGGTVNLAVPGARVSPGISGPFAAGVRVEVITVTVDHSAAYHLDVSDLAGRTGRSLN
Ga0126383_1043756023300010398Tropical Forest SoilVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFVPSVLPEGSYDVTVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGTPFGVTIRAQGAPDGGYGGTVNLAVPGARVSPGISGPFAAGVRVEVITVTVDHSAAYHLDVSDLAGRTGRSLNFQINQ*
Ga0151490_151763313300011107SoilVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPDGSYDVTVELGDGRRATATAALRVTPGDWPVGYTIDMIGDQTSGVPFGVTVRARGAPDGGYDGTVYLSVPGATVSPAISGPFSGGVRVEVITVTVDGAGMYHLDVSDLAGRTGRSLNFRVSQ*
Ga0164303_1147590513300012957SoilASTSGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLD
Ga0164301_1108516813300012960SoilRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ*
Ga0157370_1132120213300013104Corn RhizosphereSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGSSLDFHVAQ*
Ga0182008_1041529023300014497RhizosphereVVVDDRLTLTIGPRPFGPSRWADAGIITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGYTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ*
Ga0132258_1037775433300015371Arabidopsis RhizosphereVTVTLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSDVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVDHSGNYHLDVSDLAGRTGRSLNFQISQ*
Ga0132258_1135581833300015371Arabidopsis RhizosphereVALGLVAACSGGTLPQPTVVSVSPAARPASSSGPVTVTLDAVLPTLVDYGTSAATVDDRLTLKIGPRTFGPHVWTDAGVVTDFLPSVLAEGRYDITVQLGDGRATTATNAFQVTAGAWPVGYTIDTIPSQTSGVPFGVTIRAQGAPDGGYGGTVSLSVPGARVFPVTSGPFVAGVLVQVITVTADQQGNFQLVVSDLAGHIGTSLPFKLR*
Ga0132256_10010358823300015372Arabidopsis RhizosphereVTVTLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSDVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVNHPGNYHLDVSDLAGRTGRSLNFQISQ*
Ga0132256_10079180013300015372Arabidopsis RhizosphereAARRLLGGRAGRAPVTRVLRLVVALCLAGCTGATLPPPTVVSVSPAQRPASSSGPVTVTVDAVLPTFVAHSAQAVSVDDRLTLSIGPRTFGPSRWADAGGITDFLPSVLPQGSYDVTVELADGRLATATDVFRVSPGTWPVGYTIDTIPDQHSGVPFGVTLRAQGGQDGGYIGTVNLSVPGATVSPGISGPFVAGVRVEVITVTVSRPASHQLVVSDLGGGPGGTSLFFYVDR*
Ga0132256_10113775423300015372Arabidopsis RhizosphereGLVAACSGGTLPQPTVVSVSPAARPASSSGPVTVTLDAVLPTLVDYGTSAATVDDRLTLKIGPRTFGPHVWTDAGVVTDFLPSVLAEGRYDITVQLGDGRSSTATNAFQVTAGAWPVGYTIDTIPSQTSGVPFGVTIRAQGAPDGGYGGTVSLSVPGARVFPVTSGPFVAGVLVQVITVTANQGNFQLVVSDLAGHIGTSLPFKLR*
Ga0132257_10004232123300015373Arabidopsis RhizosphereVVSVSPADRPASSSGPVTVTLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSDVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVDHSGNYHLDVSDLAGRTGRSLNFQISQ*
Ga0132257_10064952623300015373Arabidopsis RhizosphereVALGLVAACSGGTLPQPTVVSVSPAARPASSSGPVTVTLDAVLPTLVDYGTSAATVDDRLTLKIGPRTFGPHVWTDAGVVTDFLPSVLAEGRYDITVQLGDGRSSTATNAFQVTAGAWPVGYTIDTIPSQTSGVPFGVTIRAQGAPDGGYGGTVSLSVPGARVFPVTSGPFVAGVLVQVITVTANQGNFQLVVSDLAGHAGTSLPFKVR*
Ga0132255_10057169723300015374Arabidopsis RhizosphereVTVTLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSDVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVDHPGNYHLDVSDLAGRTGRSLNFQISQ*
Ga0132255_10512973013300015374Arabidopsis RhizosphereRAKIAWVALGLLAACSGGTLPPPTVVSVSPAARPASSSGPVTVTLDAVLPTLVDYGTSAATVDDRLTLKIGPRTFGPHVWTDAGVVTDFLPSVLAEGRYDITVQLGDGRATTATNAFQVTAGAWPVGYTIDTIPSQTSGVPFGVTIRAQGAPDGGYGGTVSLSVPGARVFPVTSGPFVAGVLVQ
Ga0182036_1089461223300016270SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPY
Ga0182033_1009152823300016319SoilVSRLSRLLGALCLTACSGATLPAPTVVSVSLTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFFVRQ
Ga0182035_1087962813300016341SoilAGSATVDDGLSLKIGGRPFGPSRWVDGGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0182032_1117291923300016357SoilIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0182034_1065276823300016371SoilFACSGATLPAPTVVSVDPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0182037_1193756723300016404SoilGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0182038_1102773013300016445SoilDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFLVRQ
Ga0213874_1001671523300021377Plant RootsVSRLPRALAVLCLAACSGATLPAPVVVSVSPADRPASSSGPVTVTLDAVLPTLADHGLDMVSVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVMVELGDGRLTTATSAFQVTAGDWPVGYVVDTIGDQKSNVPFGVTIRAQGGADGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVKVDHPGSYHLDVSDLAGRTGRSLNFQISQ
Ga0182009_1003894623300021445SoilVSRDRVLLGALLLAGCSGATLPAPTVVSVSPSGRQASTSGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGIITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGYTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ
Ga0126371_1324006513300021560Tropical Forest SoilLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLAEGSYDVTVELGDGRLTTASNALRITAGTWPVGYIVDMIGDQTSGVPFGVTIRAQGGADGGYTGTVNFAVPGATVSPQISGAFAAGVRVELITITADHAGQYHLDVSDLAGRTGRSLNFQLAQ
Ga0208851_1000509143300025461Arctic Peat SoilVSTRETLAWVLLGLLPACSGGTLPQPTVVSVNPAERPASSSGPVTVTIEAVLPTMVNYGAVSATVDDRLTVKIGPRSFGPPVWTDGGVVTDFLPSVLPEGRYDVTLALGDGRSATAPSAFHVTAGDWPVGYTIDTIPNQTSGVPFGVTLRARGAPDGGYGGTVSLSVPGARVSPVTSGPFVAGVLVQVITVTADGAGNYQLVVSDLAGHTGTSLPFRLR
Ga0207649_1009178123300025920Corn RhizosphereVTRVLRLVVALCLAGCTGATLPPPTVVSVSPAQRPASSSGPVTVTVDAVLPTFVDHSAQAVSVDDRLTLSIGPRTFGPSRWADAGVITDFLPSVLPQGSYDVTVELADGRLATATDVFRVSPGTWPVGYTIDTIPDQHSGVPFGVTLRAQGGQDGGYIGTVNLSVPGATVSPGISGPFVAGVRVEVITVTVSRPASHQLVVSDLGGGPGGTSLFFYVDR
Ga0207652_1023106913300025921Corn RhizosphereRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ
Ga0207644_1098573323300025931Switchgrass RhizospherePFGPSRWADAGMISDFLPSVLADGSYDVTVELGDGRLATATDAFRVTPGDWPVGYTLDMIGDQTSGVPFGVTLRARGAPDGGYGGTVFLAVPGASVSPAISGPFSGGVRVEVITVTVDDPGMFHLDVSDLAGRTGRSLNFRVSQ
Ga0207709_1004179823300025935Miscanthus RhizosphereVSPPERQASTSGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ
Ga0207640_10000709223300025981Corn RhizospherePRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSLDFHVAQ
Ga0207641_1041562823300026088Switchgrass RhizosphereRRFLLTVLLLAGCSGATLPPPTVVSVSPAERPASSSGPVTVTLDAVLPTRADHGTNTVTVDDRLTLTIGPRPFGPSRWADAGMISDFLPSVLADGSYDVTVELGDGRLATATDAFRVTPGDWPVGYTLDMIGDQTSGVPFGVTLRARGAPDGGYGGTVFLAVPGASVSPAISGPFSGGVRVEVITVTVDDPGMFHLDVSDLAGRTGRSLNFRVSQ
Ga0209593_1002578223300027743Freshwater SedimentVIRVVRLLVALCLAGCSGATLPPPIVVSVSPAQRPASSSGPVTVTLDAVLPTVADHGASTVSVDDRLTLTIGPRPFGPSHWADAGVITDFLPSVLSEGSYDVMVELGDGRLAMATDVFRVTAGTWPVGYTIDTIPDQHSGIPFGVTLRAQGGQNGGYIGTVNFSVPGATVSPAVSGPFVGGVRVEVITVTVDRPASYQLEVSDLAGRRGRSLFFYVNQ
Ga0209048_1094301213300027902Freshwater Lake SedimentALAACNGGTLPPPTVVSVDPADRPASSSGAVTVTLDAVLPTLVNYGASTATVDDRLTLKIGPRPFGPPVWTDAGVVTDFLPTVLLPGRYDVTVQLGDGRLATAASAFHVTAGDWPVGYTVDTIPTQTSGVPFAVTIRARGAPDGGYGGTVNLSMSVPGPQVAPAVSGPFVAGVLVQVITVTTSDS
Ga0310888_1006256423300031538SoilVSRLSCLLAVLCLAGCSGAALPAPSVVSVSPADRPASSSGPVTVTLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSNVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVNHSGNYHLDVSDLAGRTGRSLNFQIAQ
Ga0318516_1018163613300031543SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFV
Ga0318516_1034222023300031543SoilVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318534_1018110323300031544SoilPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318573_1006063013300031564SoilAQVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318515_1025737823300031572SoilLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318574_1030930823300031680SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318572_1023239313300031681SoilAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318572_1059669113300031681SoilAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318496_1001314423300031713SoilVSRLSRLLGALCLTACSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318496_1026957523300031713SoilVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0306917_1133306613300031719SoilGAQVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGF
Ga0318493_1017667423300031723SoilTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318493_1031610523300031723SoilPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNMVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0306918_1015403723300031744SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318502_1020700523300031747SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318494_1023837213300031751SoilGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318494_1026311113300031751SoilGIIADFLPSVLPEGTYDITVELGDGRLATATGAFRVTQGFWPIGYTIDMIGGQTSGVPFGVTMRAQGAPDAGYGGTVFLSVNGATVSPTISGPFNAGVRVEVITVTVDNPGTYRLDVSDLAGRTGHSVNFQVRQ
Ga0318554_1048220513300031765SoilHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318509_1031541313300031768SoilDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318509_1059056313300031768SoilLAGICLAGCSGATLPEPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNMVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLN
Ga0318521_1018346523300031770SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318546_1063797123300031771SoilPTLADHGLNMVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318546_1066221513300031771SoilVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318547_1009349513300031781SoilADHGLNTVTVDDRLTLKIGPRPFGPSLWADAGVITECLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318547_1087299613300031781SoilGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318529_1038920913300031792SoilLRGRARGAQVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGG
Ga0318497_1009216413300031805SoilWVDAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318568_1098317313300031819SoilDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318567_1044239923300031821SoilVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGALQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITV
Ga0318517_1013974523300031835SoilDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318511_1005464813300031845SoilAQVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318512_1028374723300031846SoilVSRIPCLLAGICLAGCSGATLPEPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDQRLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318512_1035146123300031846SoilSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVR
Ga0310904_1095230723300031854SoilTIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGFTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHAGQYHLEVMDLDGRPGRSLDFHVAQ
Ga0318495_1013856213300031860SoilRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318495_1034073313300031860SoilVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0306919_1074360523300031879SoilASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0306925_1096099123300031890SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318551_1025426423300031896SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGTQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISG
Ga0318551_1040120213300031896SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0306923_1106736323300031910SoilVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISG
Ga0306921_1107301123300031912SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGP
Ga0306926_1011817733300031954SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318563_1013294413300032009SoilQVSRLSRLLGALCLTACSGATLPAPTVVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318563_1020115513300032009SoilVSRIPCLLAGICLAGCSGATLPEPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNMVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318549_1015548823300032041SoilSPAERPASSSGPVTVTLDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGARRHPPQAGRRPRAAPAVRRGAGSWRAPGHPGHRPGDAR
Ga0318556_1032144113300032043SoilAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318570_1021809713300032054SoilTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318575_1066484213300032055SoilVTLDAVLPTLADHGLNMVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318510_1043497813300032064SoilVSVSPTERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSL
Ga0318513_1033917313300032065SoilARGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318514_1013444123300032066SoilSSSGPVTVTVDAVLPTLADHGLDTVTVDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0318524_1046424913300032067SoilATLPEPTVVSVSPAERPASSSGPVTVTLDAVLPTLADHGLNTVTVDDRLTLKIGPRPFGPSHWADAGVITDFLPSVLPEGSYDVMVELGDERLTTATGAFRVTAGDWPVGYTIDMIGGQRSGIPFGVTIRAQGAPDGGYGGTVNLAVPGATVAPGISGPFAAGVRVEVITVTVDHSGPYHLDVSDLAGRTGRSLNFQINQ
Ga0318553_1015691623300032068SoilALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318525_1003642513300032089SoilVSRLPRLLAALCFAGCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSLKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGTQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAISPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0318518_1057037123300032090SoilRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTASGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0310896_1029342613300032211SoilVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSNVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVNHSGNYHLDVSDLAGRTGRSLNFQIAQ
Ga0306920_10011386543300032261SoilVSRLPRLLAALCLTSCSGATLPAPTVVSVSPAERPASSSGPVTVTVDAVLPTLADHGLDTVTVDDRLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0306920_10146418223300032261SoilKIGPRAFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLSTATGAFQVTRGAWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGATVSPTISGPFDGGFRVEVITVTVGTSGPHHLEVSDLSGGPGGRSLDFLVRQ
Ga0310812_1026530713300032421SoilVSRDRVLLGALLLAGCSGATLPAPTVVSVSPSGRQASTSGPVTVTLDAVLPTVADHGTNTVVVDDRLTLTIGPRPFGPSRWADAGIITDFLPSVLPEGSYDVTVVLGDGRMATATDALHITAGDWPVGYTVGMIGDQTSNVPFGVTLRAQGAPDAGYTGTVFLSVPGATVVPSVSGPFSGNLRVETITVTVDHPGQYHLEVMDLDGRPGRSL
Ga0335082_1033557223300032782SoilRAWGVPVRGAALPIGFLVVAGCSGATLPPPTVVSVNPAQRPESSSGPVTVTLDAILPTAVDFGAGSATVDDALSLKIGGRPFGPSRWADAGVVTDFLPSVLPEGRYDVTVELGDGRLATATDAFRVTAGNWPTGYIIDTIPSQRSGVPFGVTIRAQGIPDAGFDGTVSLALLPSGAHVTPTISGPFVDGIRVEVITVTVDDPPGDFQLVVSDLSGHPPGMSLAFHVR
Ga0318519_1023298613300033290SoilLSVKIGPRAFGPSRWADAGVITDFLPSVLPEGGYDVTVELGDGRLSTAVGAFQVTRGGWPVGYTIDMIGAQTSGVPFGVTVRAQGAPDGGYSGTVFLSVPGAAVSPTISGPFDGGFRVEVITVTVGTSGPYHLEVSDLSGGPGGRSLDFFVRQ
Ga0310810_1055497713300033412SoilPVTRVLCLLVALCLAGCTGATLPPPTVVSVSPAQRPASSSGPVTVMVDAVLPTFVDHSAQAVSVDDRLTLSIGPRPFGPSRWADGGVITDFLPSVLPQGSYDVTVELADGRLATATDAFRVSQGTWPTGYTIDLIPDQHSGVPFGVTLRAQGGQDGGYIGTVNFSVNGATVSPTVSGPFTGGVRVEVITVTVNRPASYQLVVSDLGGRSGTSLFFYVNR
Ga0373959_0196456_8_5293300034820Rhizosphere SoilLDAVLPTLADHGLETVTIDDRLTLKIGPRPFGPSRWADAGVITDFLPSVLPEGSYDVTVELGDGRLTTASSAFRVTTGDWPVGYIVDTIGDQRSNVPFGVTIRAQGGTDGGYIGTVNFAVPGATVSPVISGPFSAGVRVELITVTVNHSGNYHLDVSDLAGRTGRSLNFQIAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.