| Basic Information | |
|---|---|
| Family ID | F065681 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNA |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.85 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.268 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.472 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.693 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.740 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 7.87 |
| PF03237 | Terminase_6N | 1.57 |
| PF13578 | Methyltransf_24 | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.27 % |
| All Organisms | root | All Organisms | 41.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10239138 | Not Available | 537 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10248399 | Not Available | 521 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10257424 | Not Available | 508 | Open in IMG/M |
| 3300001720|JGI24513J20088_1003379 | All Organisms → Viruses → Predicted Viral | 2310 | Open in IMG/M |
| 3300005747|Ga0076924_1000603 | Not Available | 531 | Open in IMG/M |
| 3300005912|Ga0075109_1067170 | Not Available | 1290 | Open in IMG/M |
| 3300005939|Ga0075123_10220754 | Not Available | 706 | Open in IMG/M |
| 3300006025|Ga0075474_10229016 | Not Available | 563 | Open in IMG/M |
| 3300006027|Ga0075462_10200301 | Not Available | 600 | Open in IMG/M |
| 3300006029|Ga0075466_1047365 | All Organisms → Viruses → environmental samples → uncultured virus | 1279 | Open in IMG/M |
| 3300006029|Ga0075466_1075096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 950 | Open in IMG/M |
| 3300006029|Ga0075466_1165427 | Not Available | 562 | Open in IMG/M |
| 3300006735|Ga0098038_1294599 | Not Available | 505 | Open in IMG/M |
| 3300006752|Ga0098048_1103198 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 862 | Open in IMG/M |
| 3300006789|Ga0098054_1096973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1105 | Open in IMG/M |
| 3300006803|Ga0075467_10253892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 953 | Open in IMG/M |
| 3300006868|Ga0075481_10292801 | Not Available | 568 | Open in IMG/M |
| 3300006869|Ga0075477_10366320 | Not Available | 564 | Open in IMG/M |
| 3300006916|Ga0070750_10260945 | Not Available | 750 | Open in IMG/M |
| 3300006919|Ga0070746_10328836 | Not Available | 697 | Open in IMG/M |
| 3300006919|Ga0070746_10489446 | Not Available | 542 | Open in IMG/M |
| 3300006928|Ga0098041_1233985 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 587 | Open in IMG/M |
| 3300006990|Ga0098046_1101237 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300007276|Ga0070747_1147515 | Not Available | 847 | Open in IMG/M |
| 3300007344|Ga0070745_1340002 | Not Available | 528 | Open in IMG/M |
| 3300007539|Ga0099849_1036771 | Not Available | 2077 | Open in IMG/M |
| 3300007555|Ga0102817_1083822 | Not Available | 698 | Open in IMG/M |
| 3300007963|Ga0110931_1121047 | Not Available | 787 | Open in IMG/M |
| 3300008012|Ga0075480_10627728 | Not Available | 506 | Open in IMG/M |
| 3300009027|Ga0102957_1370423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 532 | Open in IMG/M |
| 3300009058|Ga0102854_1054609 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300009420|Ga0114994_10336342 | Not Available | 1003 | Open in IMG/M |
| 3300009435|Ga0115546_1157497 | Not Available | 799 | Open in IMG/M |
| 3300009442|Ga0115563_1144489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 962 | Open in IMG/M |
| 3300009495|Ga0115571_1401365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 534 | Open in IMG/M |
| 3300009496|Ga0115570_10387835 | Not Available | 594 | Open in IMG/M |
| 3300009497|Ga0115569_10388998 | Not Available | 602 | Open in IMG/M |
| 3300009507|Ga0115572_10223459 | Not Available | 1082 | Open in IMG/M |
| 3300009526|Ga0115004_10906976 | Not Available | 526 | Open in IMG/M |
| 3300009593|Ga0115011_11971007 | Not Available | 532 | Open in IMG/M |
| 3300010150|Ga0098056_1205246 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010430|Ga0118733_101822698 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300010430|Ga0118733_107521691 | Not Available | 565 | Open in IMG/M |
| 3300010883|Ga0133547_11801374 | Not Available | 1132 | Open in IMG/M |
| 3300011118|Ga0114922_10402076 | Not Available | 1136 | Open in IMG/M |
| 3300011254|Ga0151675_1004111 | Not Available | 661 | Open in IMG/M |
| 3300017697|Ga0180120_10154602 | All Organisms → Viruses → environmental samples → uncultured virus | 970 | Open in IMG/M |
| 3300017697|Ga0180120_10327251 | Not Available | 610 | Open in IMG/M |
| 3300017697|Ga0180120_10390445 | Not Available | 547 | Open in IMG/M |
| 3300017705|Ga0181372_1089785 | Not Available | 523 | Open in IMG/M |
| 3300017706|Ga0181377_1036528 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300017714|Ga0181412_1115740 | All Organisms → Viruses → environmental samples → uncultured virus | 621 | Open in IMG/M |
| 3300017728|Ga0181419_1171159 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 516 | Open in IMG/M |
| 3300017753|Ga0181407_1180591 | Not Available | 515 | Open in IMG/M |
| 3300017767|Ga0181406_1089268 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017767|Ga0181406_1169586 | Not Available | 653 | Open in IMG/M |
| 3300017949|Ga0181584_10894524 | Not Available | 521 | Open in IMG/M |
| 3300017951|Ga0181577_10783184 | Not Available | 575 | Open in IMG/M |
| 3300017962|Ga0181581_10354621 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 931 | Open in IMG/M |
| 3300017967|Ga0181590_10970888 | Not Available | 555 | Open in IMG/M |
| 3300017968|Ga0181587_10794855 | Not Available | 591 | Open in IMG/M |
| 3300018416|Ga0181553_10560903 | Not Available | 606 | Open in IMG/M |
| 3300018416|Ga0181553_10614300 | Not Available | 573 | Open in IMG/M |
| 3300018421|Ga0181592_10654159 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300018682|Ga0188851_1010245 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300019751|Ga0194029_1068609 | Not Available | 600 | Open in IMG/M |
| 3300019765|Ga0194024_1122764 | Not Available | 601 | Open in IMG/M |
| 3300019934|Ga0194005_103424 | Not Available | 675 | Open in IMG/M |
| 3300020053|Ga0181595_10097110 | Not Available | 1450 | Open in IMG/M |
| 3300020174|Ga0181603_10385953 | Not Available | 516 | Open in IMG/M |
| 3300020810|Ga0181598_1007835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 7869 | Open in IMG/M |
| 3300021373|Ga0213865_10338529 | Not Available | 687 | Open in IMG/M |
| 3300021375|Ga0213869_10387161 | Not Available | 575 | Open in IMG/M |
| 3300021425|Ga0213866_10078436 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| 3300021957|Ga0222717_10494709 | Not Available | 659 | Open in IMG/M |
| 3300021958|Ga0222718_10474288 | Not Available | 610 | Open in IMG/M |
| 3300022065|Ga0212024_1087505 | Not Available | 554 | Open in IMG/M |
| 3300022068|Ga0212021_1103724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 583 | Open in IMG/M |
| 3300022164|Ga0212022_1037294 | Not Available | 751 | Open in IMG/M |
| 3300022164|Ga0212022_1071219 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 534 | Open in IMG/M |
| 3300022183|Ga0196891_1011932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1708 | Open in IMG/M |
| 3300022187|Ga0196899_1199964 | Not Available | 529 | Open in IMG/M |
| 3300022208|Ga0224495_10395090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 543 | Open in IMG/M |
| 3300022857|Ga0222653_1005749 | Not Available | 3968 | Open in IMG/M |
| 3300022867|Ga0222629_1015529 | Not Available | 1160 | Open in IMG/M |
| 3300022885|Ga0222662_1025605 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300022887|Ga0222642_1025941 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300022925|Ga0255773_10237853 | Not Available | 789 | Open in IMG/M |
| 3300022929|Ga0255752_10335167 | Not Available | 624 | Open in IMG/M |
| 3300023116|Ga0255751_10302865 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300023116|Ga0255751_10589294 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 505 | Open in IMG/M |
| 3300023695|Ga0228680_1010468 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10545647 | All Organisms → Viruses → environmental samples → uncultured virus | 507 | Open in IMG/M |
| 3300024262|Ga0210003_1199764 | Not Available | 820 | Open in IMG/M |
| 3300024262|Ga0210003_1254955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 691 | Open in IMG/M |
| 3300024346|Ga0244775_11232593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 582 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10445994 | Not Available | 626 | Open in IMG/M |
| 3300025086|Ga0208157_1080005 | Not Available | 817 | Open in IMG/M |
| 3300025086|Ga0208157_1127329 | Not Available | 584 | Open in IMG/M |
| 3300025108|Ga0208793_1029505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1838 | Open in IMG/M |
| 3300025110|Ga0208158_1160171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 508 | Open in IMG/M |
| 3300025120|Ga0209535_1185414 | Not Available | 606 | Open in IMG/M |
| 3300025120|Ga0209535_1195817 | Not Available | 575 | Open in IMG/M |
| 3300025132|Ga0209232_1079404 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300025305|Ga0208684_1075532 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300025438|Ga0208770_1065109 | Not Available | 679 | Open in IMG/M |
| 3300025666|Ga0209601_1093031 | All Organisms → Viruses → environmental samples → uncultured virus | 905 | Open in IMG/M |
| 3300025668|Ga0209251_1178974 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 530 | Open in IMG/M |
| 3300025671|Ga0208898_1152905 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 621 | Open in IMG/M |
| 3300025685|Ga0209095_1216374 | Not Available | 522 | Open in IMG/M |
| 3300025687|Ga0208019_1088678 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 972 | Open in IMG/M |
| 3300025690|Ga0209505_1068282 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300025698|Ga0208771_1191246 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 549 | Open in IMG/M |
| 3300025759|Ga0208899_1256992 | Not Available | 515 | Open in IMG/M |
| 3300025806|Ga0208545_1122121 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025853|Ga0208645_1266009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 560 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10556954 | All Organisms → Viruses → environmental samples → uncultured virus | 555 | Open in IMG/M |
| 3300028125|Ga0256368_1024589 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300028125|Ga0256368_1045716 | Not Available | 775 | Open in IMG/M |
| 3300028290|Ga0247572_1191869 | Not Available | 514 | Open in IMG/M |
| 3300028297|Ga0228617_1122913 | Not Available | 607 | Open in IMG/M |
| 3300028600|Ga0265303_11677126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 532 | Open in IMG/M |
| 3300031578|Ga0307376_10652570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 664 | Open in IMG/M |
| 3300031669|Ga0307375_10439966 | Not Available | 799 | Open in IMG/M |
| 3300032254|Ga0316208_1059392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1095 | Open in IMG/M |
| 3300032255|Ga0316209_1151224 | Not Available | 569 | Open in IMG/M |
| 3300033742|Ga0314858_037853 | Not Available | 1138 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.47% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.54% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.09% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.72% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.72% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.15% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 3.15% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.36% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 2.36% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.57% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.57% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.57% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.57% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.79% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.79% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.79% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.79% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.79% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.79% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005939 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019934 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_1-2_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300022885 | Saline water microbial communities from Ace Lake, Antarctica - #600 | Environmental | Open in IMG/M |
| 3300022887 | Saline water microbial communities from Ace Lake, Antarctica - #229 | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023695 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032255 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102391381 | 3300000117 | Marine | MREELINWIKSCDKFHMLELYSEMRRMKRSWNAE* |
| DelMOWin2010_102483992 | 3300000117 | Marine | KNKAKAYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWNAK* |
| DelMOWin2010_102574241 | 3300000117 | Marine | KEMREELINWIKSCDKFHMLELYSEMRRMKRSWNDDE* |
| JGI24513J20088_10033795 | 3300001720 | Marine | EQKSMRKELIDFINKCSKFNMQELHSEMRRMKRS* |
| Ga0076924_10006031 | 3300005747 | Marine | EEQKAMRQELIEWVKSCDQWHMGELFSEMRRMKRSWDGEK* |
| Ga0075109_10671705 | 3300005912 | Saline Lake | AKAHEEQKAMRQELIEWVKTCDQWHMGELHSEMRRMKRSWDGEK* |
| Ga0075123_102207543 | 3300005939 | Saline Lake | KAKAYEEQKAMRQELTDWIKSCDKFHMQELWSEMRRMKRGWEDKE* |
| Ga0075474_102290162 | 3300006025 | Aqueous | QKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE* |
| Ga0075462_102003013 | 3300006027 | Aqueous | AYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNA* |
| Ga0075466_10473651 | 3300006029 | Aqueous | AYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWND* |
| Ga0075466_10750961 | 3300006029 | Aqueous | AYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWNAK* |
| Ga0075466_11654271 | 3300006029 | Aqueous | EEQKEMREELINWIKSCDKFHMLELYSEMRRMKRSWNAE* |
| Ga0098038_12945991 | 3300006735 | Marine | KAKAYEEQKSMRQELIDWVNSCSAMHMQELHSEMRRMKRSWNAK* |
| Ga0098048_11031981 | 3300006752 | Marine | QKSMRKELVDWIDSCSQQHMQELYSEMKRMKRSWNE* |
| Ga0098054_10969731 | 3300006789 | Marine | NKAKAYEEQKSMRQELVDWVNSCNTMHMQELHSEMRRMKRSWNAK* |
| Ga0075467_102538923 | 3300006803 | Aqueous | KAYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWNAK* |
| Ga0075481_102928011 | 3300006868 | Aqueous | EEQKEMRQELINWINSCDKFQMLELYSEMRRMKRSAI* |
| Ga0075477_103663201 | 3300006869 | Aqueous | NRAKAYEEQKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE* |
| Ga0070750_102609451 | 3300006916 | Aqueous | KEMRAELMEWVKTCDKFHMGELYSEMKRMKRSWNE* |
| Ga0070746_103288361 | 3300006919 | Aqueous | EMRAELMEWVKTCDKFHMGELYSEMKRMKRSWNE* |
| Ga0070746_104894461 | 3300006919 | Aqueous | VQDNNKAKAYEEQKAMRQELIEWVKSCDQWHMGELFSEMRRMKRSWDGEK* |
| Ga0098041_12339851 | 3300006928 | Marine | KSMRKELVDWIDSCSQQHMQELYSEMKRMKRSWNE* |
| Ga0098046_11012371 | 3300006990 | Marine | KNKAKAYEEQKSMRQELIDWVNSCSAMHMQELHSEMRRMKRSWNAK* |
| Ga0070747_11475151 | 3300007276 | Aqueous | EEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNA* |
| Ga0070745_13400021 | 3300007344 | Aqueous | KAKAHEEQKAMREELINWIKSCDKLQMGELYSEMRRMKRGWE* |
| Ga0099849_10367711 | 3300007539 | Aqueous | AMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNAK* |
| Ga0102817_10838221 | 3300007555 | Estuarine | AKIHEEQKEMRAELIEWVKTCDKLHMGELYSEMRRMKRSWND* |
| Ga0110931_11210471 | 3300007963 | Marine | SMRKELIDWIDSCSQQHMQELYSEMRRMKRSWNE* |
| Ga0075480_106277281 | 3300008012 | Aqueous | EQKEMREELLRWIKSCDKFQMLELYSEMRRMKRSAI* |
| Ga0102957_13704231 | 3300009027 | Pond Water | RAKAYEEQKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE* |
| Ga0102854_10546091 | 3300009058 | Estuarine | KAYEEQKSMRQELIDWVKSCNTMHMQELHSEMTRMKRSWNNAK* |
| Ga0114994_103363421 | 3300009420 | Marine | NKAKAYEEQKAMRQELIEWVKTCDQWHMGELFSEMRRMKRSWDGEK* |
| Ga0115546_11574971 | 3300009435 | Pelagic Marine | AYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND* |
| Ga0115563_11444891 | 3300009442 | Pelagic Marine | KNKAKAYEEQKSMRQELIDWVKSCNTMHMQELHSEMRRMKRSWNAK* |
| Ga0115571_14013652 | 3300009495 | Pelagic Marine | HEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE* |
| Ga0115570_103878351 | 3300009496 | Pelagic Marine | KAMRQELTDWIKSCDQWHMQELWSEMRRMKRGWEDQE* |
| Ga0115569_103889981 | 3300009497 | Pelagic Marine | QKEMREELINWVKSCDKFHMLELYSEMRRMKRSWNAE* |
| Ga0115572_102234591 | 3300009507 | Pelagic Marine | AMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND* |
| Ga0115004_109069761 | 3300009526 | Marine | KAMRQELNDWIKSCDQWHMQELWSEMRRMKRGWEDKE* |
| Ga0115011_119710072 | 3300009593 | Marine | SMRQELIDWINSCSTMHMQELHSEMRRMKGSWNAK* |
| Ga0098056_12052461 | 3300010150 | Marine | NKAKAYEEQKSMRQELIDWVNSCSAMHMQELHSEMRRMKRSWNAK* |
| Ga0118733_1018226984 | 3300010430 | Marine Sediment | YEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAE* |
| Ga0118733_1075216911 | 3300010430 | Marine Sediment | KAKAYEEQKAMRQELIEWVKSCDQWHMGELFSEMRRMKRTWDGEK* |
| Ga0133547_118013743 | 3300010883 | Marine | ETIDSNKAKAYEEQKAMRQELTDWIKSCDKWHMQELWSHMRRMKRGWEIE* |
| Ga0114922_104020761 | 3300011118 | Deep Subsurface | AYEEQKAMRQELTDWIKSCDQWHMQELWSEMRRMKRGWEDKE* |
| Ga0151675_10041112 | 3300011254 | Marine | KSHQDQKEMREELMEWVKTCDKFHMGELYSEMKRMKRSWNE* |
| Ga0180120_101546021 | 3300017697 | Freshwater To Marine Saline Gradient | KAYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWND |
| Ga0180120_103272511 | 3300017697 | Freshwater To Marine Saline Gradient | KAYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNA |
| Ga0180120_103904451 | 3300017697 | Freshwater To Marine Saline Gradient | KSYEDQKEMRAELIEWVKTCDKFHMGELYSEMKRMKRSWDE |
| Ga0181372_10897851 | 3300017705 | Marine | KNKAKAYEEQKSMRQELIDWVNSCSAMHMQELHSEMRRMKRSWNAK |
| Ga0181377_10365281 | 3300017706 | Marine | AHEEQKSMRQELIDWINSCNTMHMQELHSEMRRMKRSWNAK |
| Ga0181412_11157401 | 3300017714 | Seawater | HEQQKEMRQELIEWVKTCDKLQMGELYSEMKRMKRSWNE |
| Ga0181419_11711591 | 3300017728 | Seawater | EQKSMRKELIDWIDSCSQQHMQELYSEMKRMKRSWNE |
| Ga0181407_11805911 | 3300017753 | Seawater | KSMRQELIDWVNSCSAMHMQELHSEMRRMKRSWND |
| Ga0181406_10892681 | 3300017767 | Seawater | KPLRGELMDWVKRCSAMHMQGLHSEMGRMKGSWNAK |
| Ga0181406_11695861 | 3300017767 | Seawater | EQKEMREELINWIKSCDKFQMSELYSEMRRMKRSAL |
| Ga0181584_108945243 | 3300017949 | Salt Marsh | YEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND |
| Ga0181577_107831841 | 3300017951 | Salt Marsh | KAHEEQKAMREELINWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0181581_103546214 | 3300017962 | Salt Marsh | YEEQKSMRQELVRWIESCDVRHMHELYSEMKRMKKEWE |
| Ga0181590_109708882 | 3300017967 | Salt Marsh | EQKAMRQELIDWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0181587_107948553 | 3300017968 | Salt Marsh | EEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0181553_105609031 | 3300018416 | Salt Marsh | EEQKAMRQELIDWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0181553_106143001 | 3300018416 | Salt Marsh | AMREELINWIKSCDKLQMGELYSEMRRMKRSWNAK |
| Ga0181592_106541593 | 3300018421 | Salt Marsh | AKAYEEQKFMRQELIDWINSCSAMHMQELHSEMRRMKRSWND |
| Ga0188851_10102451 | 3300018682 | Freshwater Lake | QKSMRQELVRWIESCETRHMHELYSEMKRMKKEWE |
| Ga0194029_10686091 | 3300019751 | Freshwater | AYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNA |
| Ga0194024_11227641 | 3300019765 | Freshwater | QKEMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND |
| Ga0194005_1034241 | 3300019934 | Sediment | NKAKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAE |
| Ga0181595_100971104 | 3300020053 | Salt Marsh | AKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAK |
| Ga0181603_103859531 | 3300020174 | Salt Marsh | HEEQKAMREELINWIKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0181598_10078357 | 3300020810 | Salt Marsh | QKAMREELINWIKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0213865_103385293 | 3300021373 | Seawater | EEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND |
| Ga0213869_103871613 | 3300021375 | Seawater | AKAYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWND |
| Ga0213866_100784364 | 3300021425 | Seawater | EQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAK |
| Ga0222717_104947093 | 3300021957 | Estuarine Water | EEQKEMREELINWIKSCDKFHMLELYSEMRRMKRSWND |
| Ga0222718_104742883 | 3300021958 | Estuarine Water | KAMREELINWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0212024_10875051 | 3300022065 | Aqueous | KAKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWND |
| Ga0212021_11037242 | 3300022068 | Aqueous | YEEQKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE |
| Ga0212022_10372941 | 3300022164 | Aqueous | KAKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAE |
| Ga0212022_10712191 | 3300022164 | Aqueous | EQQKEMRQELIEWVKTCDKLQMGELYSEMKRMKRSWNE |
| Ga0196891_10119321 | 3300022183 | Aqueous | NRAKAYEEQKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE |
| Ga0196899_11999641 | 3300022187 | Aqueous | AKAYEEQKAMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0224495_103950902 | 3300022208 | Sediment | IDSNKAKAHEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0222653_10057491 | 3300022857 | Saline Water | KAKAHEEQKAMRQELIEWVKTCDQWHMGELHSEMRRMKRSWDGEK |
| Ga0222629_10155294 | 3300022867 | Saline Water | NNKAKAYEEQKAMRQELIEWVKTCDQWHMGELHSEMRRMKRSWDGEK |
| Ga0222662_10256055 | 3300022885 | Saline Water | SNKAKAHEEQKAMRQELIEWVKTCDQWHMGELHSEMRRMKRSWDGEK |
| Ga0222642_10259411 | 3300022887 | Saline Water | YEEQKQMREELIEWIKTCDKLHMGELFSEMRRMKRSWE |
| Ga0255773_102378531 | 3300022925 | Salt Marsh | KAYEEQKAMRQELIDWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0255752_103351673 | 3300022929 | Salt Marsh | AMRQELIDWVKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0255751_103028653 | 3300023116 | Salt Marsh | EEQKAMREELINWIKSCDKLQMGELYSEMRRMKRSWND |
| Ga0255751_105892941 | 3300023116 | Salt Marsh | KVYEEQKSMRQELVRWIESCEVRHMHELYSEMKRMKKEWE |
| Ga0228680_10104681 | 3300023695 | Seawater | EEQKEMRQELINWINSCDKFQMLELYSEMRRMKRSWK |
| (restricted) Ga0255039_105456471 | 3300024062 | Seawater | EQKAMRQELIDWIKSCDQWHMQELWSEMRRMKRGWEDQE |
| Ga0210003_11997643 | 3300024262 | Deep Subsurface | MRQELTDWIKSCDKFHMQELWSEMRRMKRGWEDKE |
| Ga0210003_12549551 | 3300024262 | Deep Subsurface | QKSMRQELVRWIESCDTRHMHELYSEMKRMKKEWE |
| Ga0244775_112325931 | 3300024346 | Estuarine | KAHEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| (restricted) Ga0255048_104459941 | 3300024518 | Seawater | MRQELIDWIKSCDQWHMQELWSEMRRMKRGWEDQE |
| Ga0208157_10800054 | 3300025086 | Marine | EQKAMRQELIDWVKSCDKLQMGELYSEMKRMKRGWE |
| Ga0208157_11273293 | 3300025086 | Marine | EQKSMRKELIDFINNCSRFNMQELHSEMRRMKRSK |
| Ga0208793_10295055 | 3300025108 | Marine | AHEEQKAMRQELIDWVKSCDKLQMGELYSEMKRMKRGWE |
| Ga0208158_11601711 | 3300025110 | Marine | KSMRKELVDWIDSCSQQHMQELYSEMKRMKRSWNE |
| Ga0209535_11854143 | 3300025120 | Marine | KAYEEQKSMRQELIDWVNSCNTMHMQELHSEMTRMKRSWNAK |
| Ga0209535_11958173 | 3300025120 | Marine | MRQELIDWVKSCNTMHMQELHSEMTRMKRSWNNAK |
| Ga0209232_10794044 | 3300025132 | Marine | SKNKAKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWND |
| Ga0208684_10755323 | 3300025305 | Deep Ocean | NKAKAYEEQKSMRQELIDWVKSCNTMHMQELHSEMTRMKRSWNAK |
| Ga0208770_10651093 | 3300025438 | Saline Lake | EEQKAMRQELIEWVKTCDQWHMGELHSEMRRMKRSWDGEK |
| Ga0209601_10930311 | 3300025666 | Pelagic Marine | DSAPLIDWIKSCDQWHMQELWSEMRRMKRGWEDQE |
| Ga0209251_11789741 | 3300025668 | Marine | QKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0208898_11529051 | 3300025671 | Aqueous | EEQKAMRQELIRWIESCDKRHMQELYSEMKRMKRGWEQ |
| Ga0209095_12163741 | 3300025685 | Pelagic Marine | NKAKAYEEQKSMRQELIDWINSCSAMHMQELHSEMRRMKRSWNAK |
| Ga0208019_10886781 | 3300025687 | Aqueous | AKIHEEQKEMRAELIEWVKTCDKLHMGELYSEMRRMKRSWND |
| Ga0209505_10682824 | 3300025690 | Pelagic Marine | ETIDSNKAKAYEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0208771_11912461 | 3300025698 | Saline Lake | YEEQKQMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0208899_12569922 | 3300025759 | Aqueous | KAKAHEEQKAMREELINWIKSCDKLQMGELYSEMRRMKRSWNAE |
| Ga0208545_11221211 | 3300025806 | Aqueous | SKNKAKAYEEQKSMRQELIDWVNSCNTMHMQELHSEMTRMKRSWNAK |
| Ga0208645_12660091 | 3300025853 | Aqueous | RAKAYEEQKSMRQELVRWIESCEVRHMHELYSEMKRMKKEWE |
| (restricted) Ga0255054_105569541 | 3300027856 | Seawater | EQKAMRQELTDWIKSCDQWHMQELWSEMRRMKRGWEDQE |
| Ga0256368_10245891 | 3300028125 | Sea-Ice Brine | TIDNNKAKAHEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0256368_10457163 | 3300028125 | Sea-Ice Brine | NKAKAYEEQKAMRQELTDWIKSCDQWHMQELWSEMRRMKRGWEDQE |
| Ga0247572_11918691 | 3300028290 | Seawater | AYEEQKEMRQELIKWIKSCDKFQMLELYSERRRMKRSAI |
| Ga0228617_11229133 | 3300028297 | Seawater | YEEQKEMRQELIKWINSCDKFQMLELYSEMRRMKRSAI |
| Ga0265303_116771262 | 3300028600 | Sediment | KEMRQELIEWVKTCDKLQMGELYSEMKRMKRSWNE |
| Ga0307376_106525703 | 3300031578 | Soil | SNKAKAYEEQKAMREELIEWVKTCDKLHMGELFSEMRRMKRSWE |
| Ga0307375_104399661 | 3300031669 | Soil | AMRQELTDWIKSCDKFHMQELWSEMRRMKRGWEDKE |
| Ga0316208_10593923 | 3300032254 | Microbial Mat | KAYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWNAK |
| Ga0316209_11512242 | 3300032255 | Microbial Mat | NKAKAYEEQKSMRQELIDWVNSCNTMHMQELHSEMRRMKRSWNAK |
| Ga0314858_037853_1000_1137 | 3300033742 | Sea-Ice Brine | GNKAKIHEEQKEMRAELIEWVKTCDKLHMGELYSEMRRMKRSWND |
| ⦗Top⦘ |