| Basic Information | |
|---|---|
| Family ID | F065663 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSIPKQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLF |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.65 % |
| % of genes near scaffold ends (potentially truncated) | 34.65 % |
| % of genes from short scaffolds (< 2000 bps) | 81.10 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.142 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.559 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.094 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.59% β-sheet: 0.00% Coil/Unstructured: 55.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00210 | Ferritin | 21.26 |
| PF00132 | Hexapep | 7.09 |
| PF08666 | SAF | 6.30 |
| PF06035 | Peptidase_C93 | 5.51 |
| PF13545 | HTH_Crp_2 | 3.15 |
| PF04290 | DctQ | 3.15 |
| PF06808 | DctM | 2.36 |
| PF00325 | Crp | 2.36 |
| PF11324 | DUF3126 | 1.57 |
| PF07885 | Ion_trans_2 | 1.57 |
| PF08734 | GYD | 1.57 |
| PF13356 | Arm-DNA-bind_3 | 0.79 |
| PF13340 | DUF4096 | 0.79 |
| PF04392 | ABC_sub_bind | 0.79 |
| PF01494 | FAD_binding_3 | 0.79 |
| PF01145 | Band_7 | 0.79 |
| PF01694 | Rhomboid | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 5.51 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.57 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.57 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.79 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.79 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.14 % |
| Unclassified | root | N/A | 33.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_103878544 | Not Available | 562 | Open in IMG/M |
| 3300004152|Ga0062386_100094159 | Not Available | 2297 | Open in IMG/M |
| 3300004479|Ga0062595_100831431 | Not Available | 766 | Open in IMG/M |
| 3300004633|Ga0066395_10014052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3038 | Open in IMG/M |
| 3300004633|Ga0066395_10306672 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300004633|Ga0066395_10337643 | Not Available | 834 | Open in IMG/M |
| 3300005179|Ga0066684_10133469 | Not Available | 1560 | Open in IMG/M |
| 3300005187|Ga0066675_10051590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2535 | Open in IMG/M |
| 3300005332|Ga0066388_100069454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3817 | Open in IMG/M |
| 3300005332|Ga0066388_100326229 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300005332|Ga0066388_101303295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1252 | Open in IMG/M |
| 3300005332|Ga0066388_102518670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 935 | Open in IMG/M |
| 3300005332|Ga0066388_103893429 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005332|Ga0066388_108172073 | Not Available | 522 | Open in IMG/M |
| 3300005436|Ga0070713_100070670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2947 | Open in IMG/M |
| 3300005436|Ga0070713_101205212 | Not Available | 733 | Open in IMG/M |
| 3300005437|Ga0070710_11305422 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005764|Ga0066903_100117282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3682 | Open in IMG/M |
| 3300005764|Ga0066903_100505994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2049 | Open in IMG/M |
| 3300005764|Ga0066903_102967718 | Not Available | 919 | Open in IMG/M |
| 3300005764|Ga0066903_106000929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
| 3300005764|Ga0066903_107098077 | Not Available | 580 | Open in IMG/M |
| 3300005764|Ga0066903_107848937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300005764|Ga0066903_108073373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300006755|Ga0079222_10004663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4464 | Open in IMG/M |
| 3300006755|Ga0079222_10677811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300006804|Ga0079221_10268572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300006804|Ga0079221_11156401 | Not Available | 597 | Open in IMG/M |
| 3300006806|Ga0079220_10080300 | Not Available | 1635 | Open in IMG/M |
| 3300006806|Ga0079220_10088899 | Not Available | 1572 | Open in IMG/M |
| 3300006854|Ga0075425_100853353 | Not Available | 1042 | Open in IMG/M |
| 3300006903|Ga0075426_10691089 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300006954|Ga0079219_10451350 | Not Available | 877 | Open in IMG/M |
| 3300010048|Ga0126373_11434344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 756 | Open in IMG/M |
| 3300010048|Ga0126373_12180022 | Not Available | 615 | Open in IMG/M |
| 3300010358|Ga0126370_10046230 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300010358|Ga0126370_10132822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Pantoea → Pantoea ananatis → Pantoea ananatis AJ13355 | 1785 | Open in IMG/M |
| 3300010359|Ga0126376_10233373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1552 | Open in IMG/M |
| 3300010360|Ga0126372_13176356 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010361|Ga0126378_10660165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1159 | Open in IMG/M |
| 3300010361|Ga0126378_11735016 | Not Available | 710 | Open in IMG/M |
| 3300010361|Ga0126378_11789048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 699 | Open in IMG/M |
| 3300010366|Ga0126379_12283232 | Not Available | 641 | Open in IMG/M |
| 3300010366|Ga0126379_12311840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300010863|Ga0124850_1081190 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012971|Ga0126369_10687175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300012975|Ga0134110_10504941 | Not Available | 550 | Open in IMG/M |
| 3300015371|Ga0132258_10971920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2145 | Open in IMG/M |
| 3300016270|Ga0182036_10421923 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300016294|Ga0182041_11201500 | Not Available | 691 | Open in IMG/M |
| 3300016319|Ga0182033_11061841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 722 | Open in IMG/M |
| 3300016319|Ga0182033_11290198 | Not Available | 656 | Open in IMG/M |
| 3300016341|Ga0182035_11354379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 638 | Open in IMG/M |
| 3300016341|Ga0182035_11946765 | Not Available | 534 | Open in IMG/M |
| 3300016357|Ga0182032_10117335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1913 | Open in IMG/M |
| 3300016357|Ga0182032_11671289 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300016387|Ga0182040_11610357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300016404|Ga0182037_10081007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2280 | Open in IMG/M |
| 3300016422|Ga0182039_10011274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5198 | Open in IMG/M |
| 3300016445|Ga0182038_11583385 | Not Available | 589 | Open in IMG/M |
| 3300017822|Ga0187802_10000009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 37198 | Open in IMG/M |
| 3300017926|Ga0187807_1048363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1318 | Open in IMG/M |
| 3300017930|Ga0187825_10228890 | Not Available | 676 | Open in IMG/M |
| 3300017932|Ga0187814_10008828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3964 | Open in IMG/M |
| 3300017994|Ga0187822_10304786 | Not Available | 563 | Open in IMG/M |
| 3300018060|Ga0187765_10219429 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300021560|Ga0126371_10077898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3245 | Open in IMG/M |
| 3300021560|Ga0126371_10227959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1970 | Open in IMG/M |
| 3300021560|Ga0126371_10993482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1 | 981 | Open in IMG/M |
| 3300021560|Ga0126371_11159435 | Not Available | 910 | Open in IMG/M |
| 3300021560|Ga0126371_12005063 | Not Available | 696 | Open in IMG/M |
| 3300021560|Ga0126371_12487293 | Not Available | 627 | Open in IMG/M |
| 3300021560|Ga0126371_13031894 | Not Available | 569 | Open in IMG/M |
| 3300025928|Ga0207700_10333985 | Not Available | 1316 | Open in IMG/M |
| 3300026308|Ga0209265_1194792 | Not Available | 542 | Open in IMG/M |
| 3300026330|Ga0209473_1229504 | Not Available | 666 | Open in IMG/M |
| 3300027050|Ga0209325_1047955 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027070|Ga0208365_1004718 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300027787|Ga0209074_10201045 | Not Available | 748 | Open in IMG/M |
| 3300027874|Ga0209465_10006573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5100 | Open in IMG/M |
| 3300031543|Ga0318516_10038534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2558 | Open in IMG/M |
| 3300031545|Ga0318541_10164450 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300031545|Ga0318541_10714063 | Not Available | 560 | Open in IMG/M |
| 3300031546|Ga0318538_10031738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2467 | Open in IMG/M |
| 3300031546|Ga0318538_10373529 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300031564|Ga0318573_10034169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2399 | Open in IMG/M |
| 3300031572|Ga0318515_10484660 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031679|Ga0318561_10516980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300031680|Ga0318574_10268156 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031718|Ga0307474_10218086 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300031719|Ga0306917_10703272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 794 | Open in IMG/M |
| 3300031724|Ga0318500_10322161 | Not Available | 760 | Open in IMG/M |
| 3300031747|Ga0318502_10276762 | Not Available | 984 | Open in IMG/M |
| 3300031748|Ga0318492_10643984 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031754|Ga0307475_10099353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2269 | Open in IMG/M |
| 3300031770|Ga0318521_10023821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2902 | Open in IMG/M |
| 3300031771|Ga0318546_10467992 | Not Available | 883 | Open in IMG/M |
| 3300031779|Ga0318566_10254748 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300031781|Ga0318547_10382596 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300031782|Ga0318552_10382562 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031782|Ga0318552_10505982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300031792|Ga0318529_10169395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1009 | Open in IMG/M |
| 3300031793|Ga0318548_10272267 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031797|Ga0318550_10056811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1772 | Open in IMG/M |
| 3300031805|Ga0318497_10717030 | Not Available | 561 | Open in IMG/M |
| 3300031823|Ga0307478_10740641 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031845|Ga0318511_10222834 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300031859|Ga0318527_10486886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 526 | Open in IMG/M |
| 3300031879|Ga0306919_10568796 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300031890|Ga0306925_10678183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1081 | Open in IMG/M |
| 3300031890|Ga0306925_11639983 | Not Available | 623 | Open in IMG/M |
| 3300031910|Ga0306923_10095345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3352 | Open in IMG/M |
| 3300031912|Ga0306921_11498117 | Not Available | 737 | Open in IMG/M |
| 3300031941|Ga0310912_10080051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2371 | Open in IMG/M |
| 3300031942|Ga0310916_11041003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 682 | Open in IMG/M |
| 3300031942|Ga0310916_11553657 | Not Available | 538 | Open in IMG/M |
| 3300031946|Ga0310910_10816308 | Not Available | 734 | Open in IMG/M |
| 3300032001|Ga0306922_10254591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1887 | Open in IMG/M |
| 3300032001|Ga0306922_10291706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1752 | Open in IMG/M |
| 3300032025|Ga0318507_10172498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 929 | Open in IMG/M |
| 3300032051|Ga0318532_10277666 | Not Available | 595 | Open in IMG/M |
| 3300032054|Ga0318570_10126408 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300032063|Ga0318504_10181910 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300032064|Ga0318510_10136979 | Not Available | 958 | Open in IMG/M |
| 3300032089|Ga0318525_10196971 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300032094|Ga0318540_10611796 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032261|Ga0306920_103763586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1038785442 | 3300004092 | Bog Forest Soil | MANFVHNSQMSIPEQQVPPIEERIGSMAGKIIVLALCALLLWGYSTTFLAQIGLF* |
| Ga0062386_1000941591 | 3300004152 | Bog Forest Soil | MSIPEQQVLSIEERIGSMVGKIIVLALCALLLWGYSTTFLAQIGLF* |
| Ga0062595_1008314312 | 3300004479 | Soil | MSIAEQQTPTSEERIGSMVGKSVVLALCAFLLWGYSTTFLAQVGLF* |
| Ga0066395_100140523 | 3300004633 | Tropical Forest Soil | MANEQQRQPIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0066395_103066722 | 3300004633 | Tropical Forest Soil | MSLPEQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLM* |
| Ga0066395_103376431 | 3300004633 | Tropical Forest Soil | MSIPVQQTSSAEDRIGAAIGKIIVLALLAFLLWGYSTTFLAQVGLF* |
| Ga0066684_101334692 | 3300005179 | Soil | MSVPEQQTPPSEERIGGAVGKIITLALLAFLLWGYSTTFMAQVGLF* |
| Ga0066675_100515901 | 3300005187 | Soil | SVPEQQTPPSEERIGGAVGKIITLALLAFLLWGYSTTFMAQVGLF* |
| Ga0066388_1000694546 | 3300005332 | Tropical Forest Soil | MADEQQDQPIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLF* |
| Ga0066388_1003262293 | 3300005332 | Tropical Forest Soil | MSLPEQQTPPIEERIGGMVGKIIVLALCAMLLWGYSTTFLAQIGLM* |
| Ga0066388_1013032952 | 3300005332 | Tropical Forest Soil | MANEQQDQPIEERIGSMVGKIIVLAICALLLWGYSTTFLAQVGLF* |
| Ga0066388_1025186702 | 3300005332 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFHAQVGLF* |
| Ga0066388_1038934292 | 3300005332 | Tropical Forest Soil | MSISEQQVPPIEERVGSMVGKIVLAFCAMLLWGYSTTFLAQIGLI* |
| Ga0066388_1081720732 | 3300005332 | Tropical Forest Soil | MSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGL |
| Ga0070713_1000706703 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VHNSPMSIPKQQTPPIEERIGSMVGKIIVLTLCAMLLWGYSTTFLAQIGLF* |
| Ga0070713_1012052122 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VHNSSMSIAEQQTPTSEERIGSMVGKFAVLALCAFLLWGYTTTFLAQVGLF* |
| Ga0070710_113054221 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVPEQQTPPVEERVGSMLGKIIVLALCAMLLWGYSTTFLGQIRLF* |
| Ga0066903_1001172823 | 3300005764 | Tropical Forest Soil | MANEQQDQPIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLF* |
| Ga0066903_1005059942 | 3300005764 | Tropical Forest Soil | MANEQQHQAIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLF* |
| Ga0066903_1029677181 | 3300005764 | Tropical Forest Soil | MADEQQDQPIEERIGSMVGKIIVLAICAMLLWGYSTTFLA |
| Ga0066903_1060009291 | 3300005764 | Tropical Forest Soil | QSIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0066903_1070980771 | 3300005764 | Tropical Forest Soil | MHNSPMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI* |
| Ga0066903_1078489371 | 3300005764 | Tropical Forest Soil | QQAQSIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0066903_1080733732 | 3300005764 | Tropical Forest Soil | MSGDGAETMANEEQYQPIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLF* |
| Ga0079222_100046632 | 3300006755 | Agricultural Soil | MSIPKRQTPPIEERIGSMVGKIIVLTLCAMLLWGYSTTFLAQIGLF* |
| Ga0079222_106778112 | 3300006755 | Agricultural Soil | MSSPEQETPEIEERIGSAVGKIMVLALCAFLLWGYSTSFLAQLGLF* |
| Ga0079221_102685722 | 3300006804 | Agricultural Soil | MSSPEQETLEIEERIGSAVGKIMVLALCAFLLWGYSTSFLAQLGLF* |
| Ga0079221_111564012 | 3300006804 | Agricultural Soil | MSIAEQNSLPIEDRIGSMAGKVFVLALCAWLLWGYSTTFLAQVGLF* |
| Ga0079220_100803002 | 3300006806 | Agricultural Soil | CDASPVGGWRIFVHNCGMSSPEQETPEIEERIGSAVGKIMVLALCAFLLWGYSTSFLAQLGLF* |
| Ga0079220_100888991 | 3300006806 | Agricultural Soil | MSIPEQQSPASEERIGGAIGKIIALALLAFLLWGYSTTF |
| Ga0075425_1008533531 | 3300006854 | Populus Rhizosphere | VHNSSMSIAEQQTPTSEERIGSMVGKSVVLALCAFLLWGYSTTFLAQVGLF* |
| Ga0075426_106910892 | 3300006903 | Populus Rhizosphere | MSIPKQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLF* |
| Ga0079219_104513502 | 3300006954 | Agricultural Soil | MSSPEQETLEIEERIGSAVGKTMVLALCAFLLWGYSTSFLAQLGLF* |
| Ga0126373_114343442 | 3300010048 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFLAQVGLF* |
| Ga0126373_121800222 | 3300010048 | Tropical Forest Soil | MANEQQAQSIEERIGSMVGKIIVLAICAKLLWGYSTTFLAQVGLF* |
| Ga0126370_100462306 | 3300010358 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYST |
| Ga0126370_101328222 | 3300010358 | Tropical Forest Soil | MSIPVQQNPPAEDRIGAAIGKIIVLALLAFLLWGYSTTFLAQVGLF* |
| Ga0126376_102333733 | 3300010359 | Tropical Forest Soil | MGNEQQAQSIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0126372_131763562 | 3300010360 | Tropical Forest Soil | MSISQQQTSPIEERIGSMVGKIIVLALCAMLLWGYSTTFLGQIGLF* |
| Ga0126378_106601653 | 3300010361 | Tropical Forest Soil | MSTSEQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTAFLAQIGII* |
| Ga0126378_117350162 | 3300010361 | Tropical Forest Soil | MANEQQAQSIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0126378_117890481 | 3300010361 | Tropical Forest Soil | NEQQRQLIEERTGSMVRKIIVLAICVMLLWDYSTTFLAQVRLL* |
| Ga0126379_122832321 | 3300010366 | Tropical Forest Soil | MTNEQQRQPIEDRVGSMVGKIIVLAICAMLLWGYSTNFLAQVGLL* |
| Ga0126379_123118401 | 3300010366 | Tropical Forest Soil | MSTSEQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLM* |
| Ga0124850_10811901 | 3300010863 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFRQPSSRR* |
| Ga0126369_106871753 | 3300012971 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFLAQVGLL* |
| Ga0134110_105049411 | 3300012975 | Grasslands Soil | LANSRVSVPEQQTPPSEERIGGAVGKIITLALLAFLLWGYSTTFMAQVGLF* |
| Ga0132258_109719203 | 3300015371 | Arabidopsis Rhizosphere | MSIAEQNSLPVEERVGAMVGKVIVLALCAFLLWGYSTTFLAQVGLF* |
| Ga0182036_104219231 | 3300016270 | Soil | MSISEQQVPPIEERVGGMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0182041_112015001 | 3300016294 | Soil | MHNSRMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLVWGYSTAFLAQISLI |
| Ga0182033_110618411 | 3300016319 | Soil | NEQQRQPIEERIGSMVGKIIVLAICAMFLWGYSTTFLAQVGLF |
| Ga0182033_112901982 | 3300016319 | Soil | MSNSAQQTEPIEERIGSMVRKIFVLMLCAMLLWGYSTAFLAQI |
| Ga0182035_113543791 | 3300016341 | Soil | QRQLIEERTGSMVGKIIVLAILCYAIWAYSTTFLAQVRLL |
| Ga0182035_119467651 | 3300016341 | Soil | MHNSRMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAF |
| Ga0182032_101173352 | 3300016357 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICVMILWGYSTTFLAQVGLL |
| Ga0182032_116712892 | 3300016357 | Soil | MSISERQVPPIEERIGSMEGKIIVLALCALLLWGYSTTLLAQIGLI |
| Ga0182040_116103571 | 3300016387 | Soil | IANEQQRQLIEERTGSMVGKIIVLAILCYAIWAYSTTFLAQVRLL |
| Ga0182037_100810072 | 3300016404 | Soil | MSIPEQQTPPVEDRIGAAVGKVIALGLFAFLLWGYSTTFLAQVGLF |
| Ga0182039_100112742 | 3300016422 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICAMILWGYLTTFLAQVRLL |
| Ga0182038_115833851 | 3300016445 | Soil | VFDRFAQQHVLMHNSPMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0187802_1000000918 | 3300017822 | Freshwater Sediment | MANFVHNSQMSIPEQQVPPIEERIGSMAGKIIVLALCALLLWGYSTTFLAQIGLF |
| Ga0187807_10483632 | 3300017926 | Freshwater Sediment | MANFVHNSQMSIPEQQVPPIEERIGNMAGKIIVLALCALLLWGYSTTFLAQIGLF |
| Ga0187825_102288902 | 3300017930 | Freshwater Sediment | MNIPNQQAPPIEERIGSMVGKVIVLALCAMLLWGYSTAFLAQIGLF |
| Ga0187814_100088283 | 3300017932 | Freshwater Sediment | MANFVHNSRMSIPEQQVPPIEERIGSMAGKIIVLALCALLLWGYSTTFLAQIGLF |
| Ga0187822_103047862 | 3300017994 | Freshwater Sediment | MSIAEQQTPPIEERIGGMVGKAIVLALCAFLLWGYSTTFVAQVGLF |
| Ga0187765_102194292 | 3300018060 | Tropical Peatland | VSIPEQQTPPPEERIGSAVGKIIALALFAFLLWGYSTAFLAQVGLF |
| Ga0126371_100778982 | 3300021560 | Tropical Forest Soil | MSIPVQQTSSAEDRIGAAIGKIIVLALLAFLLWGYSTTFLAQVGLF |
| Ga0126371_102279592 | 3300021560 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFLAQVGLF |
| Ga0126371_109934821 | 3300021560 | Tropical Forest Soil | QPIEERIGSMVGKIIVLAICALLLWGYSTTFLAEVGLF |
| Ga0126371_111594352 | 3300021560 | Tropical Forest Soil | MANEQQAQSIEERIGSMVGKIIVLAICAKLLWGYSTTFLAQVGLF |
| Ga0126371_120050631 | 3300021560 | Tropical Forest Soil | MSLPEQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLM |
| Ga0126371_124872932 | 3300021560 | Tropical Forest Soil | MSIPAAQIPPIEERLGSMVGKIIVLALCALLLWGYSTTFLAQLGLF |
| Ga0126371_130318942 | 3300021560 | Tropical Forest Soil | MSIPEQNSLPIEERIGTMVGKVIVLALCAFLLWGYSTTFLAQVGLF |
| Ga0207700_103339851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIPKQQTPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLF |
| Ga0209265_11947922 | 3300026308 | Soil | MSVPEQQTPPSEERIGGAVGKIITLALLAFLLWGYSTTFMAQVGLF |
| Ga0209473_12295042 | 3300026330 | Soil | MSVPEQQTPPSEERIGGAVGKIITLALLAFLLWGYSTTFMA |
| Ga0209325_10479551 | 3300027050 | Forest Soil | MSIPKQQTPPIEERIGSMVGKIIVLTLCAMLLWGYSTTFLAQIGLF |
| Ga0208365_10047183 | 3300027070 | Forest Soil | MSVPEQQTPPIEERVGSMLGKIIVLALCAMLLWGYSTTFLGQIRLF |
| Ga0209074_102010451 | 3300027787 | Agricultural Soil | MSSPEQETPEIEERIGSAVGKIMVLALCAFLLWGYSTSFLAQLGLF |
| Ga0209465_100065732 | 3300027874 | Tropical Forest Soil | MANEEQYKPIEERIGGMVGKIIVLAICAMLLWGYSTTFLAQVGLL |
| Ga0318516_100385343 | 3300031543 | Soil | MANERQRQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318541_101644501 | 3300031545 | Soil | MHNSPMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318541_107140631 | 3300031545 | Soil | MSISERQVPPIEERIGSMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0318538_100317383 | 3300031546 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318538_103735292 | 3300031546 | Soil | IEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318573_100341695 | 3300031564 | Soil | MHNSRMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318515_104846602 | 3300031572 | Soil | SNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318561_105169802 | 3300031679 | Soil | MSISERQVPPIEERIGSMVGKIIVLALCALLLWGYSTTLLAQIGLI |
| Ga0318574_102681561 | 3300031680 | Soil | MHNSAMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0307474_102180863 | 3300031718 | Hardwood Forest Soil | MSIPEQQTPPIEERVGSMLGKIIVLALCAMLLWGYSTTFLGQIGLF |
| Ga0306917_107032721 | 3300031719 | Soil | MSRDGAQTMANEQQRQPIEERIGSMVGKIIVLAICAMFLWGYSTTFLAQVGLF |
| Ga0318500_103221611 | 3300031724 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVR |
| Ga0318502_102767621 | 3300031747 | Soil | MSISEQQVPPIEDRVGSMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0318492_106439841 | 3300031748 | Soil | QQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0307475_100993531 | 3300031754 | Hardwood Forest Soil | NSPMSILEQQTPPIEERVGSMLGKIIVLALCAMLLWGYSTTFLGQIGLF |
| Ga0318521_100238212 | 3300031770 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICVMILWGYSTTFLAQVRLL |
| Ga0318546_104679922 | 3300031771 | Soil | MSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTA |
| Ga0318566_102547482 | 3300031779 | Soil | MHNSPMSNSAQKTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318547_103825962 | 3300031781 | Soil | QVPPIEERIGSMVGKIIVLALCALLLWGYSTTLLAQIGLI |
| Ga0318552_103825622 | 3300031782 | Soil | SEQQVPPIEERVGSMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0318552_105059822 | 3300031782 | Soil | IEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318529_101693952 | 3300031792 | Soil | MANEQQGQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318548_102722672 | 3300031793 | Soil | ISEQQVPPIEERVGSMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0318550_100568111 | 3300031797 | Soil | MANEQQRQPIEKRIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318497_107170301 | 3300031805 | Soil | MSISEQQAPPIEERIGSMVGKIIVLALCALLLWGYSTTFLAQIGLI |
| Ga0307478_107406411 | 3300031823 | Hardwood Forest Soil | QQTPPIEERVGSMLGKIIVLALCAMLLWGYSTTFLGQIGLF |
| Ga0318511_102228342 | 3300031845 | Soil | HVLMHNSPMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318527_104868861 | 3300031859 | Soil | MTNEQQRQPIEDHVGSMVGKIIVLAICAMLLWGYSTTFLAQVRLL |
| Ga0306919_105687961 | 3300031879 | Soil | EQQVPPIEERVGSMVGKIIVLALCAMLLWGYSTTFLAQIGLI |
| Ga0306925_106781832 | 3300031890 | Soil | MANEQQRQPIEERIGSMVGKIIVLAICAMFLWGYSTTFLAQVGLF |
| Ga0306925_116399832 | 3300031890 | Soil | MSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAF |
| Ga0306923_100953452 | 3300031910 | Soil | MSIHEQQTPPVEDRIGAAVGKVIALGLFAFLLWGYSTTFLAQVGLF |
| Ga0306921_114981172 | 3300031912 | Soil | MHNSAMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLTQIGLI |
| Ga0310912_100800512 | 3300031941 | Soil | MSIPQQQIPPIEERIGSMVGKFIVLALCAFLLWGYSTTFLAQLGLF |
| Ga0310916_110410032 | 3300031942 | Soil | MANEQQAQSIEERIGSMVGKIIVLAICAMLLWGYSTTFLAQVGLF |
| Ga0310916_115536571 | 3300031942 | Soil | MSISEQQVPPIEERVGSMVGKIIVLALCAMLLCGYST |
| Ga0310910_108163082 | 3300031946 | Soil | MADEQQDQPIEERIGSMVGKIIVLAICAMPLWGYSTTFLAQVGLF |
| Ga0306922_102545911 | 3300032001 | Soil | QRQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0306922_102917064 | 3300032001 | Soil | MSISEQQVPPIEERVGSMVGKIIVLALCAMLLWGYSTTFLAQ |
| Ga0318507_101724982 | 3300032025 | Soil | CATVTDGAETMANEQQRQPIEERIGSMVGKIIVLAICAMILWGYSTTFLAQVRLL |
| Ga0318532_102776661 | 3300032051 | Soil | MHNSRMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLN |
| Ga0318570_101264081 | 3300032054 | Soil | TEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318504_101819103 | 3300032063 | Soil | AQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318510_101369791 | 3300032064 | Soil | MHNSPMSNSAQQTEPIEERIGSMVGKIFVLMLCAMLLWGYSTA |
| Ga0318525_101969711 | 3300032089 | Soil | PIEERIGSMVGKIFVLMLCAMLLWGYSTAFLAQIGLI |
| Ga0318540_106117961 | 3300032094 | Soil | EERIGSMVGKIIVLALCALLLWGYSTTLLAQIGLI |
| Ga0306920_1037635861 | 3300032261 | Soil | MSISERQVPPIEERIGSMVGKIIVLALCALLLWGYSTTLLA |
| ⦗Top⦘ |