 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F065553 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MANTYTAIATVTVGSGGAANIEFTSIPQTYTDLVVKVSPR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.79 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.213 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.898 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.480 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 15.75 |
| PF01925 | TauE | 0.79 |
| PF01391 | Collagen | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.21 % |
| All Organisms | root | All Organisms | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300027782|Ga0209500_10000475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34469 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.02% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.66% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.66% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.15% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 3.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.57% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.79% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.79% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.79% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24218J26658_10154301 | 3300002092 | Lentic | MANTYTLIASSTVGSGGASSVVFSSIPSSYTDLLIKFSVRTDRNDG |
| metazooDRAFT_108985443 | 3300002476 | Lake | MATYTLISSVTVGSGGASSIDFTSIPATYTDLVLKMSLRNS |
| Ga0066180_100287734 | 3300004128 | Freshwater Lake | MANTYQLISSVTVGSGGAASIAFTSIPATYTDLEILVSGR |
| Ga0068876_105295313 | 3300005527 | Freshwater Lake | MANTYTLIASSTVGSGGAANIEFTSIPGTYTDLAIFLS |
| Ga0076948_11344143 | 3300005739 | Lake Water | MATYVKIASVTVGSGGAANIEFTSIPGTYDDLVVKISSRSNRS |
| Ga0070749_103924051 | 3300006802 | Aqueous | MANTFEAIATVTVGSGGAATINFTSIPATYTDLLLKVSVRNSVSAL |
| Ga0070749_106435581 | 3300006802 | Aqueous | MANTYTLIQSVEVGSGGAASIEFAGIPQTYTDLLLMVSG |
| Ga0070749_107893102 | 3300006802 | Aqueous | MATTYEAIATVTVGSGGAASIDFTSIPATFTDLVILMSCR |
| Ga0079302_11121181 | 3300007165 | Deep Subsurface | MPTTYNLISKVTVGSGGAAEINFTSIPATYTDLNLVFST |
| Ga0070745_12970762 | 3300007344 | Aqueous | MANTYEAIATVEVGSGGAATISFTSIAADWTDLMVLLCGRTDRAAIADSV |
| Ga0070753_12433771 | 3300007346 | Aqueous | MANTYTAIATVTVGSGGAANIEFTSIPATYTDLLLKVSVRN |
| Ga0099846_10804813 | 3300007542 | Aqueous | MATTYTAIATVEVGSGGAANIEFTSIPSTYTDLYLVTSLRS |
| Ga0099850_11174713 | 3300007960 | Aqueous | MATTYELIASVTVGSGGAANIEFTSIPATYTDLVVLLSARN |
| Ga0105747_10977733 | 3300007974 | Estuary Water | MANTYEAIATVTVGSGGAATIDFTSIPQTYTDLLLKYSGRVNAAVDPTTKII |
| Ga0110929_10254381 | 3300008072 | Water Bodies | MANTYTLISSVTVGAGGASSIDFTSIPATYTDLLVMLSLRSVPAAT |
| Ga0114343_10148037 | 3300008110 | Freshwater, Plankton | MANTFVKIASVTVGSGGAANIEFTSIPQTYTDLLLVCSTR |
| Ga0114347_10995103 | 3300008114 | Freshwater, Plankton | MATTYTLISSVTVGSGGAANIEFTSIPATYTDLLV |
| Ga0114351_10863605 | 3300008117 | Freshwater, Plankton | MANTYEAIATVTVGSGGAANIEFTSIPATYTDLAIKLSVRTSD |
| Ga0114351_12771453 | 3300008117 | Freshwater, Plankton | MAKTYKLIASSTVGSGGAANIEFTSIPSTYTDLLLVISGRTDRA |
| Ga0114363_11415683 | 3300008266 | Freshwater, Plankton | MANTYVAIATVTVGSGGAANIEFASIPATYTDLLL |
| Ga0114363_11633932 | 3300008266 | Freshwater, Plankton | MALTYTAIATVTVGSGGASTMEFTSIPATYTDLVIK |
| Ga0114876_11818022 | 3300008448 | Freshwater Lake | MANTYTPIATVIVGSGGAANIEFTSIPQTYTDLLVKCS |
| Ga0114880_11713321 | 3300008450 | Freshwater Lake | MATFTLISSVTVGSGGAASMTFSSIPATYTDLLLKLSTRTT |
| Ga0114880_11931473 | 3300008450 | Freshwater Lake | MATTFTKIAAVTVGAGGAASIDFTSIPGTYTDLVIKI |
| Ga0114973_101785723 | 3300009068 | Freshwater Lake | MATTFTKIASVSVGVLGASSIDFTSIPSTYTDLCIEVS |
| Ga0114963_101169731 | 3300009154 | Freshwater Lake | MANTYTLIASSTVGSGGATSIDFTSIPSTYTDLIIKI |
| Ga0114977_103936911 | 3300009158 | Freshwater Lake | MANTYTKIASVSVGSGGAATIDFSSIPTTYTDLLIKVSSRTSATGV |
| Ga0114970_103933803 | 3300009163 | Freshwater Lake | MPSAYTFISSVTVGSGGAATIDLTSIPATYTDIVLIF |
| Ga0114979_100655961 | 3300009180 | Freshwater Lake | MANTYELIASSTVGSGGAASIDFTSIPSTYTDLVV |
| Ga0114976_106509231 | 3300009184 | Freshwater Lake | MANTYTLIASNTVGSGGAANIEFTSIPATYTDLLVKVSPRGDSGGTDLAI |
| Ga0114960_105364491 | 3300010158 | Freshwater Lake | MANTMTLIASSTVGAGGASSINFTSIPGTYTDLQVVWSL |
| Ga0136644_102823701 | 3300010334 | Freshwater Lake | MATKSYNLISTVTVGVGTATSIDFTSIPSGYTDLCIKT |
| Ga0129333_112566632 | 3300010354 | Freshwater To Marine Saline Gradient | MATTYKQIAKVTVGSGGAASIDFTSIPQTYTDLQILVSA |
| Ga0129336_102003901 | 3300010370 | Freshwater To Marine Saline Gradient | MATTYEAIATVTVGSGGAANIEFTSIPATYTDLVI |
| Ga0129336_102488613 | 3300010370 | Freshwater To Marine Saline Gradient | MGTYKAIATVTVGSGGSSSIDFTSIPGTYTDLCLLTS |
| Ga0133913_129573623 | 3300010885 | Freshwater Lake | MANTYTLISSVTVGSGGAATIGFTSIPQTYTDLVVKYSLRCN |
| Ga0133913_131440641 | 3300010885 | Freshwater Lake | MANTFELIGSAVVGSGGTANITFTSIPQTYTDLLVKASV |
| Ga0153799_10415813 | 3300012012 | Freshwater | MATTYKLISSVTVGSGGAANIEFTSIPATYTDLLVKM |
| Ga0153801_10200291 | 3300012017 | Freshwater | MANTYTLISSVTVGSGGAANIEFTSIPSTYTDLVVNLS |
| Ga0153801_10262391 | 3300012017 | Freshwater | MANTFVLIASVTVGSGGAANIDFTSIPSTYTDLLLFASTR |
| Ga0164293_109814311 | 3300013004 | Freshwater | MANTYELISSVTVGSGGVSAIDFTSIANTYTDLSLRFSIRNSR |
| (restricted) Ga0172367_101072381 | 3300013126 | Freshwater | MATTYTLISSVTVGSGGAANIEFTSIPQTYTDLVVK |
| (restricted) Ga0172367_103712121 | 3300013126 | Freshwater | MATTYTLISSVTVGSGGAANIEFTSIPATYTDLVVKLSARTTRNTGDA |
| (restricted) Ga0172367_104161812 | 3300013126 | Freshwater | MALTYVAIATVTVGSGGAANIEFTSIPATYTDLQL |
| (restricted) Ga0172373_104242833 | 3300013131 | Freshwater | MANTFVAIATTTVGSGGAANIEFTSIPGTYTDLAVLLTGRR |
| (restricted) Ga0172373_105317363 | 3300013131 | Freshwater | MANTYVAIATTTVGSGGAADIEFTSIPATYTDLIVKL |
| (restricted) Ga0172372_107995352 | 3300013132 | Freshwater | MALTYTAIATVTVGSGGAANIEFTSIPGTYTDLLLK |
| (restricted) Ga0172372_108108903 | 3300013132 | Freshwater | MALTYVAIATTTVGSGGAANIEFTSIPATYTDLLLKISARNE |
| (restricted) Ga0172376_101646954 | 3300014720 | Freshwater | MALTYVAITTTTVGSGGAANIEFTSIPGTYTDLVIKA |
| (restricted) Ga0172376_102119331 | 3300014720 | Freshwater | MANTYVAIATTTVGSGGAANIEFTSIPATYTDLVVKISGRTNGN |
| (restricted) Ga0172376_104422261 | 3300014720 | Freshwater | MALTYVAIATTTVGSGGAANIEFTSIPQTYTDLLLVSS |
| (restricted) Ga0172376_104647671 | 3300014720 | Freshwater | MANTYVAIATTTVGSGGAADIEFTSIPATYTDLIVKLSV |
| (restricted) Ga0172376_105307492 | 3300014720 | Freshwater | MATTYTLIASSTVGSGGAANIEFTSISGSYTDLLVMLSLR |
| (restricted) Ga0172376_106134152 | 3300014720 | Freshwater | MALTYVAIATTTVGSGGAANITFSSIPQTYTDLLVLLSARSE |
| Ga0181350_11273442 | 3300017716 | Freshwater Lake | MANTYTLISSVTVGSGGAASISFTSIPATYTDLLIKLSARGDAA |
| Ga0181358_10332765 | 3300017774 | Freshwater Lake | MATTYTLISSVTVGSGGAATIAFTSIPATYTDLQVLVSTRADNASII |
| Ga0181358_12550532 | 3300017774 | Freshwater Lake | MANTYTAIATVTVGSGGIAEIEFTSIPATYTDLVVKL |
| Ga0181357_12704161 | 3300017777 | Freshwater Lake | MANTYEAIATVTVGSGGAATIEFTSIPATYTDLLLLTS |
| Ga0181346_10540381 | 3300017780 | Freshwater Lake | MATTYKLISSVTVGSGGAASISFTSIPATYTDLVVLVS |
| Ga0181346_12500312 | 3300017780 | Freshwater Lake | MANTYEAIATVTVGSGGAANIEFTSIPGTYTDLVLKTSL |
| Ga0181346_13322861 | 3300017780 | Freshwater Lake | MANTYVLISSVTVGAGGAANITFTSIPATYTDLVI |
| Ga0181355_13637081 | 3300017785 | Freshwater Lake | MPTTYKLISSVTVGGGGAAYVEFTSIPQTYTDLNI |
| Ga0169931_103112373 | 3300017788 | Freshwater | MATTYTLISSITVGSGGAASMTFSSIPATYTDLNLL |
| Ga0169931_104422603 | 3300017788 | Freshwater | MATTYTLISSVTVGSGGAANIEFTSIPATYTDLLIVLSARSNTTFGAD |
| Ga0181359_11389013 | 3300019784 | Freshwater Lake | MANTYTLISSVTVGSGGAASMELTSIPATYTDLMFRFTARYS |
| Ga0181359_11805341 | 3300019784 | Freshwater Lake | MANTYIKIASTTVGSGGAANVEFTSIPATYTDIKIVFSAR |
| Ga0211726_107592371 | 3300020161 | Freshwater | MATYTLIASSTVGSGGAANIEFTSIPSTYTDLVLQMSTRGNRAN |
| Ga0207942_10061141 | 3300020549 | Freshwater | VADTFKKIASVTVGAGGAASMDFTSIPATYTDLCVKLS |
| Ga0208855_10438391 | 3300020553 | Freshwater | MPSTYKLISSITVGTATNTISFTSIPQTYTDLVIKASLRGS |
| Ga0213922_10144821 | 3300021956 | Freshwater | MATYTLISSTTVGSGGVSGIDFTSIPSTYTDLVLLLSLRGNSA |
| Ga0213922_10327333 | 3300021956 | Freshwater | MANTYTLIASSTVGAGGAASIDFTSIPSTYTDLLVKLSGRSNT |
| Ga0222713_101280244 | 3300021962 | Estuarine Water | MATTYEAIATVTVGSGGAANIEFTSIPATYTDILV |
| Ga0222713_102260111 | 3300021962 | Estuarine Water | MATTYEAIATVTVGSGGAANIEFTSIPGTYTDLLVKLSTRTN |
| Ga0181354_12457232 | 3300022190 | Freshwater Lake | MATTYKLISSVTVGSGGAATIAFTSIPATYTDLQVL |
| Ga0196901_10515341 | 3300022200 | Aqueous | MATTYELIASVTVGSGGAANIEFTSIPATYTDLVVLL |
| Ga0196901_10717901 | 3300022200 | Aqueous | MATTYTAIATVEVGAGGASSIDFTGIASSWTDLVLHLSI |
| Ga0196901_11403471 | 3300022200 | Aqueous | MATTYTAIATVEVGAGGASSIDFTGIASSWTDLVLHLS |
| Ga0181351_10586224 | 3300022407 | Freshwater Lake | MATTYTLISSVTVGSGGAATIAFTSIPATYTDLQVLVSTRADN |
| Ga0214921_100824887 | 3300023174 | Freshwater | MANTYTLIASSTVGSGGAANIEFTSIPQTYTDLLVKISLR |
| Ga0214921_100839505 | 3300023174 | Freshwater | MANTYTLIASSTVGSGGASTIDFTSIPATYTDLVVKISP |
| Ga0214919_105937752 | 3300023184 | Freshwater | MANTYTLIASSTVGSGGAATIDFTSIPSTYTDLMVVLSA |
| Ga0255178_10653792 | 3300024298 | Freshwater | MATTYEAIATVTVGSGGAATFGFTSIPATYTDLLVVAS |
| Ga0255141_10238971 | 3300024351 | Freshwater | MANTYTLISSVTVGAGGVSSISFSSIPGIYTDLCL |
| Ga0255142_10214571 | 3300024352 | Freshwater | MATTYEAIATVSVGSGGAATFGFTSIPATFTDLLI |
| Ga0255142_10329703 | 3300024352 | Freshwater | MANTYTLISSVTVGAGGVSSISFSSIPGIYTDLCLKFSL |
| Ga0255171_10368731 | 3300024354 | Freshwater | MATTYEAIATVTVGSGGATNIEFTSIPNTFTDIAI |
| Ga0255152_10308043 | 3300024503 | Freshwater | MANTYVAIATVTVGSGGAANIQFTSIPQTYTDLLIKLSARCNFAGITG |
| Ga0255183_10768511 | 3300024515 | Freshwater | MATTYEAIATVTVGSGGATNIEFTSIPNTFTDIAIKLSARWDQSGGI |
| Ga0255228_10525251 | 3300024531 | Freshwater | MANTYTAIATVTATTSVANIEFTSIPATYTDLLLLYSIRS |
| Ga0208004_10970012 | 3300025630 | Aqueous | MATTYEAIATVTVGSGGAANIEFTSIAADWTDLLLKLSGRTNKAQKQE |
| Ga0208161_11279522 | 3300025646 | Aqueous | MATTYTAIATVEVGAGGASSIDFTGIASSWTDLVL |
| Ga0208161_11283021 | 3300025646 | Aqueous | MATTYEAIATVEVGSGGAASIDFSSIPATYTDLVVKV |
| Ga0255166_10119501 | 3300026473 | Freshwater | MATTYEAIATVTVGSGGAATFGFTSIPATYTDLLV |
| Ga0208009_10773561 | 3300027114 | Deep Subsurface | MPTTYNLISKVTVGSGGAAEINFTSIPATYTDLNLVFSTR |
| Ga0255087_10805261 | 3300027337 | Freshwater | MANTYTAIATVTVGSGGAANIEFTSIPQTYTDLVVKVSPR |
| Ga0208966_11388752 | 3300027586 | Freshwater Lentic | MATYTLISSVTVGSGGAANIEFTSIPQSYTDLLIKLSIRQDKPDGYS |
| Ga0208974_10919681 | 3300027608 | Freshwater Lentic | MADTFVKIATVTVGSGGAANVTFSSIPATYTDLQLVL |
| Ga0209033_10260981 | 3300027697 | Freshwater Lake | MPTTYQAIATVTVGGGGAATIQFSSIPATYTDLELVYST |
| Ga0209297_10479575 | 3300027733 | Freshwater Lake | MPNTYTKIASVSVSSALGAASMDFTSIPATYTDLLVKV |
| Ga0209086_102653111 | 3300027770 | Freshwater Lake | MANTYTLISSVTVGSGGAATIGFTSIPATYTDLIVKTSTRGTSAH |
| Ga0209500_100004751 | 3300027782 | Freshwater Lake | MANTMTLIASSTVGSGGTSSIDFTSIPSTYTDLQLMLSARGA |
| Ga0209358_101044541 | 3300027804 | Freshwater Lake | MANTYEAIATVTVGSGGAANIEFTSIPATYTDLLLMHST |
| Ga0209354_103780951 | 3300027808 | Freshwater Lake | MANTYTLISSVTVGSGGAASINFTSIPATYTDLLIKLSARGDAAGVTWQ |
| Ga0209550_104931943 | 3300027892 | Freshwater Lake | MANTYTAIATVTVDGSAPASIEFTSIPATYTDLCVL |
| Ga0256331_10692243 | 3300028286 | Freshwater | MANTFVALATVTVGSGGASNITFSSIPGTYTDLVL |
| Ga0304730_10699584 | 3300028394 | Freshwater Lake | MANTYTLISSVTVGSGGASSIDFTSIPATYTDLLVKMSTRA |
| Ga0119944_10129463 | 3300029930 | Aquatic | MALTYEAIATVTVGSGGAANISFTSIAASWTDLLIKISGR |
| Ga0119944_10286661 | 3300029930 | Aquatic | MALTYTAIATVTVGSGGAANISFTSIAASWTDLLIKISGR |
| Ga0119945_10119583 | 3300029933 | Aquatic | MALTYQAIATVTVGSGGAASIDFSSIPNTFTDLIL |
| Ga0119945_10274201 | 3300029933 | Aquatic | MALTYQAIATVTVGSGGAANISFTSIAASWTDLLIKISGR |
| Ga0315907_104152623 | 3300031758 | Freshwater | MATYKVIASTTVGSGGTNPIEFTSIPATYTDLLLKISARTDYNDNGRNYV |
| Ga0315907_110350702 | 3300031758 | Freshwater | MAAGITYKKIESTTLGSDQASIEFTSIPGTYTDLVISL |
| Ga0315900_105342523 | 3300031787 | Freshwater | MATTYNLISSVTVGSVTNTISFTSIPQTYTDLVIKA |
| Ga0315909_104421093 | 3300031857 | Freshwater | MANTYEAIATVTVGSGGAADIEFTSIPQTYTDLVVLLSTKTLRAGSP |
| Ga0315909_106275843 | 3300031857 | Freshwater | MPTYTLISSVTVGSGGAANIEFTSIPATYTDLLVN |
| Ga0315909_106664821 | 3300031857 | Freshwater | MANTYTLIASSTVGSGGAANIEFTSIPGTYTDLAIFLSAR |
| Ga0315909_107066602 | 3300031857 | Freshwater | MAATFEALATVTVGSGGAANIEFTSIPGTYTDLVVKVSG |
| Ga0315904_101829791 | 3300031951 | Freshwater | MATYTLISSVTVGSGGAANIEFTGIPQTYTDLLVKISGR |
| Ga0315901_106910241 | 3300031963 | Freshwater | MANTYEAIATVTVGSGGAADIEFTSIPQTYTDLVVLLSTKTLRAGS |
| Ga0315902_112574241 | 3300032093 | Freshwater | MAITYTAIATTTVGSGGAANITFSSIPGTYTDLVVKASVRSDQAN |
| Ga0315903_101263181 | 3300032116 | Freshwater | MATTYVKIASVTVGSGGAASIQFTSIPGTYDDLVI |
| Ga0315276_122351222 | 3300032177 | Sediment | MATTYTLIQAVTVGSGGAANIEFTSIPQTYTDLLYKISARMSVAT |
| Ga0335021_0113952_1447_1560 | 3300034023 | Freshwater | MANTYEAIATVTVGSGGAATMAFSSIPATYTDLLLKVS |
| Ga0335027_0143864_1593_1757 | 3300034101 | Freshwater | MATTYTLISSVTVGSGGAATMTFSSIPQTYTDLLVRVSARNTSTSGSGLNMRFNS |
| Ga0335031_0025946_2_118 | 3300034104 | Freshwater | MPATFTLISSVTVGSGGAANIEFTSIPATYTDLILKLSL |
| Ga0335049_0301405_3_149 | 3300034272 | Freshwater | MAQGYQLIQTVNVGSGGAASIEFTSIPQNYTDLVIKLSLRSTVGTAHQG |
| Ga0335064_0526339_1_117 | 3300034357 | Freshwater | MANTYQLIEAITVGSGGAANITFSSIPGTYTDLKLVFSL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |