| Basic Information | |
|---|---|
| Family ID | F065551 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKTNWWVESGMAAQAAQELVWFVVIVVVGIGVVIWLDMRKDK |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.83 % |
| % of genes near scaffold ends (potentially truncated) | 21.26 % |
| % of genes from short scaffolds (< 2000 bps) | 74.02 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.268 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.047 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.906 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF10765 | Phage_P22_NinX | 6.30 |
| PF13203 | DUF2201_N | 5.51 |
| PF07728 | AAA_5 | 3.94 |
| PF00004 | AAA | 1.57 |
| PF13589 | HATPase_c_3 | 0.79 |
| PF11348 | DUF3150 | 0.79 |
| PF08774 | VRR_NUC | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.27 % |
| All Organisms | root | All Organisms | 41.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 15.75% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 13.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.57% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.79% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.79% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.79% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1096432592 | 3300002408 | Freshwater | MKTTWWIESGYAAEAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD* |
| B570J40625_1001461513 | 3300002835 | Freshwater | MKTSWWYESGMAAEAAQGLVWFVVIVFVGIGLLIWNDIRKDKRDGKK* |
| Ga0007787_101168231 | 3300004240 | Freshwater Lake | MKTVWWYESGLAAQAAQELVWFVVIVVVGIGVMAWRDMRKEKPKRKEHNDGL* |
| Ga0007787_101878581 | 3300004240 | Freshwater Lake | MKTNWWIESGYAAEAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD* |
| Ga0078894_102037732 | 3300005662 | Freshwater Lake | MKTNWWVDSGMAAQAAQELVWFVVIVVVGIGIVIWLDMRKDK* |
| Ga0076948_10255673 | 3300005739 | Lake Water | MKTNWWIESGMAAQAAQELVWFVVIVFVGIGIVIWLDMRKDK* |
| Ga0079957_101071112 | 3300005805 | Lake | MKTSWWYESGMAAEAAQGLVWFVVIVFVGIGLFIWNDIRKDKRDGKK* |
| Ga0070749_105134034 | 3300006802 | Aqueous | MKTSWWYESGAASQAAHELMWFVIIVVVGIGVVIWLDMRKDK* |
| Ga0114340_100049529 | 3300008107 | Freshwater, Plankton | MKTSWWYESGMAAEAAQELVWFVVIVFVGIGLLIWNDIRKDKRDGKK* |
| Ga0114340_10156798 | 3300008107 | Freshwater, Plankton | MKTNWWIDSGMASQAAHELMWFVIIVVVGIGVVIWLDMRKDK* |
| Ga0114340_11938142 | 3300008107 | Freshwater, Plankton | MKTSWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI* |
| Ga0114340_11987571 | 3300008107 | Freshwater, Plankton | MKTAWWYESGMAAQAAQELMWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGL* |
| Ga0114346_11215733 | 3300008113 | Freshwater, Plankton | MKTSWWYESGMAAQAAHELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGL* |
| Ga0114350_10265077 | 3300008116 | Freshwater, Plankton | MKTNWWIDSGMAAQAAQELVWFVVIVVVGIGVVIWLDIRKDK* |
| Ga0114350_11022763 | 3300008116 | Freshwater, Plankton | MKTSWWYESGLAAAAAQELVWFVVFCFILIGVAIWLDMRK* |
| Ga0114350_11656253 | 3300008116 | Freshwater, Plankton | MKTSWWIESGYAAEAAKELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD* |
| Ga0114355_11975361 | 3300008120 | Freshwater, Plankton | QAAHELVWFVVLIVVGIGVVIWRDIRNEKKEKKDD* |
| Ga0114355_12183402 | 3300008120 | Freshwater, Plankton | MKTNWWIDSGMAAQAAQELVWFVVLVVVGIGVVIWLDMRKDK* |
| Ga0114841_102671912 | 3300008259 | Freshwater, Plankton | MKTSWWYESGAAAQAAQELVWFVVLVFVGIGLVIWHDIRKEKPKPKRKEHNNGL* |
| Ga0114363_10126428 | 3300008266 | Freshwater, Plankton | MKTSWWYESGAAAQAAQELVWFVVLVVVGIGVVIWRDMRNEKKEKKDD* |
| Ga0114363_10326934 | 3300008266 | Freshwater, Plankton | MKTNWWIDSGMASQAAHELVWFVVLVVVGIGVVIWLDIRNDK* |
| Ga0114363_10393402 | 3300008266 | Freshwater, Plankton | MKTNWWVDSGMAAQAAQELVWFVVIVVVGIGVVIWLDMRKDK* |
| Ga0114363_10623823 | 3300008266 | Freshwater, Plankton | MKTAWWYESGMAAQAAHELVWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGL* |
| Ga0114363_10739515 | 3300008266 | Freshwater, Plankton | MKTNWWIDSGMAAQAAQELVWFVVIVVVGIGVVIWLDMRKDK* |
| Ga0114363_11049362 | 3300008266 | Freshwater, Plankton | MKTNWWIDSGMASQAAHELVWFVVIVVIGIGVVIWLDIRNDK* |
| Ga0114876_10924952 | 3300008448 | Freshwater Lake | MKTTWWYESGQAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI* |
| Ga0114876_11549452 | 3300008448 | Freshwater Lake | MKTAWWYESGMAAQELVWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGI* |
| Ga0114880_10087667 | 3300008450 | Freshwater Lake | MKTNWWIDSGMAAQAAHELVWFVVLVVVGIGVVIWLDIRKDK* |
| Ga0114880_11760503 | 3300008450 | Freshwater Lake | MKTNYWYESGLAAQAAQELVWFVVIVFVGIGLLAWRD |
| Ga0105103_100704107 | 3300009085 | Freshwater Sediment | MKTNWWVESGMAAQAAQELVWFVVIVVVGIGIMAWRDMRK |
| Ga0105102_106294451 | 3300009165 | Freshwater Sediment | QMKTSWWIESGMAAQAAQELMWFVVLVVVGIGVVIWFDMRNDK* |
| Ga0105104_100297857 | 3300009168 | Freshwater Sediment | MKTVWWIESGMAAQAAQELVWFVVLVFVGIGLVIWHDIRKEKPKPKRKEHNNGL* |
| Ga0105097_107253161 | 3300009169 | Freshwater Sediment | MKTSWWIESGMAAQAAQELVWFVVLVVVGIGVVIWFDMRNDK* |
| Ga0129333_100145316 | 3300010354 | Freshwater To Marine Saline Gradient | MKTAWWYESGQAAQAAQELVWFVVLVVVGIGVVIWRDIRNEKKEKKDD* |
| Ga0129333_100818942 | 3300010354 | Freshwater To Marine Saline Gradient | MKTSWWIESGAASQAAHELMWFVIIVVVGIGVVIWLDMRKDK* |
| Ga0129333_101655878 | 3300010354 | Freshwater To Marine Saline Gradient | MINKMNWWYESGQAAEAAQELVWFVVIVFVGVGVILWLNDRKNK* |
| Ga0129333_102421913 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTWWYESGQAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGL* |
| Ga0129333_103718871 | 3300010354 | Freshwater To Marine Saline Gradient | MKTSWWYESGQAAQAAQELVWFVVLVFIGIGVVIWLDIRKEKPKRKEHKDGL* |
| Ga0129333_106567362 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTWWYESGAAAQAAQELVWFVVLVFVGIGLVIWHDMRKEKPKPKRKEHNNGL* |
| Ga0129336_101146823 | 3300010370 | Freshwater To Marine Saline Gradient | MKTTWWYESGQAAQAAQELVWFVVLVFIGIGVVIWLDIRKEKPKRKEHKDGL* |
| Ga0129336_103979701 | 3300010370 | Freshwater To Marine Saline Gradient | IESGAASQAAHELMWFVIIVVVGIGVVIWLDMRKDK* |
| (restricted) Ga0172367_100013667 | 3300013126 | Freshwater | MKINWWVDSGLASQAAHELMWFVIIVFVGLGVVIWLDMRKDK* |
| (restricted) Ga0172367_1001290311 | 3300013126 | Freshwater | MKINWWVDSGLASQAAHELAWFVILVFVGLGVMIWRDIQKEKKEKKDD* |
| Ga0177922_102636715 | 3300013372 | Freshwater | MKTTWWYESGLAAQAAQELMWFVVIVVVGIGVMAWRDM |
| Ga0177922_107170092 | 3300013372 | Freshwater | MKTNWWYESGAAAQAAQQLMWFVVLVVVGIGVVIWFDMRNDK* |
| Ga0181363_10552742 | 3300017707 | Freshwater Lake | MKTNWWIESGYAAEAAKELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0181352_10268403 | 3300017747 | Freshwater Lake | MKTSWWIDSGMASQAAHELMWFVIIVVVGIGVVIWLDMRKDK |
| Ga0181352_10868311 | 3300017747 | Freshwater Lake | MNWWYESGQAAQAAQELVWFVVIIFVGIGVVIWLNDRKK |
| Ga0181352_10980301 | 3300017747 | Freshwater Lake | MKTNWWIESGMASEAAHELVWFVVLVFVGIGLVIWNDIRKGD |
| Ga0181352_11776852 | 3300017747 | Freshwater Lake | MKTSWWIESGAASQAAHELMWFVLIVVVGVGVVIWLDMRNDK |
| Ga0181352_12053312 | 3300017747 | Freshwater Lake | MKTSWWYESGLAAQAAQELVWFVVLVFVGIGLVIWHDIRKEKPKPKRKEHNNGL |
| Ga0181344_10116853 | 3300017754 | Freshwater Lake | MKTNWWYESGAASQAAHELMWFVVLVVVGIGVVIWFDMRNDK |
| Ga0181344_10527134 | 3300017754 | Freshwater Lake | MKTNWWVESGYAAEAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0181344_11602084 | 3300017754 | Freshwater Lake | MKTNWWSESGLAAQAAQDLVWFRVLVFVGIGLLIWRDM |
| Ga0181344_12304331 | 3300017754 | Freshwater Lake | MKTSWWIESGAASQAAHELMWFVIIVVVGIGVVIWLDMRKDK |
| Ga0181343_12085221 | 3300017766 | Freshwater Lake | MINKTNWWYESGQAAEAAQELVWFVVIVFVGGGLVLWINDRKNK |
| Ga0181355_12161312 | 3300017785 | Freshwater Lake | MRTSWWYESGAAAQAAQELMWFVVLVVVGIGVVIWFDMRNDK |
| Ga0211729_102695001 | 3300020172 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLVVVGIGVVIWRDIRNEKKERKDD |
| Ga0211729_111286091 | 3300020172 | Freshwater | MKTNWWIESGMASQAAHELVWFVVIVVVGIGVVIWLDMRNDK |
| Ga0208359_10303773 | 3300020541 | Freshwater | MKTAWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI |
| Ga0208465_10270692 | 3300020570 | Freshwater | MKTTWWIESGYAAEAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0222714_100354654 | 3300021961 | Estuarine Water | IDSGMAAQAAQELVWFVVLVVVGIGVVIWLDIRKDK |
| Ga0222714_100630849 | 3300021961 | Estuarine Water | MKTSWWYESGLAAAAAQELVWFVVFCFILIGVAIWLDMRK |
| Ga0222714_100688964 | 3300021961 | Estuarine Water | MKTSWWYESGQAAQAAQGLVWFVVLVVVGIGVVIWRDIRNEKKEKKDD |
| Ga0222714_101053454 | 3300021961 | Estuarine Water | MKTTWWYESGQAAQAAQELVWFVVLVFIGIGVVIWLDIRKEKPKRKEHKDGL |
| Ga0222714_101108441 | 3300021961 | Estuarine Water | MKTNWWIDSGMAAQAAQELVWFVVLVVVGIGVVIWLDIRKDK |
| Ga0181353_10078401 | 3300022179 | Freshwater Lake | EMKTSWWYESGLAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHNDGI |
| Ga0181353_10177673 | 3300022179 | Freshwater Lake | MKTNWWVDSGMAAQAAQELVWFVVIVVVGIGIVIWLDMRKDK |
| Ga0181353_10573374 | 3300022179 | Freshwater Lake | KTNWWIESGYAAEAAKELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0181353_10594292 | 3300022179 | Freshwater Lake | MKTSWWYESGMAAEAARELVWFVVIVFVGIGLLIWNDIKKDKRDGKK |
| Ga0181353_10776953 | 3300022179 | Freshwater Lake | MKTSWWIDSGAAAQAAHELMWFVVLVVVGIGVVIWFDMRNDK |
| Ga0181353_11078673 | 3300022179 | Freshwater Lake | YESGAAAQAAHELVWFVVLVVVGIGVVIWRDIRNEKKEKKDD |
| Ga0181353_11145663 | 3300022179 | Freshwater Lake | MKTSWWIDSGMASQAAHELMWFVIIVVVGIGVVIW |
| Ga0181353_11231782 | 3300022179 | Freshwater Lake | MKTSWWYESGLAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI |
| Ga0181353_11397511 | 3300022179 | Freshwater Lake | MKTNWWIDSGMASQAAHELVWFVVIVVVGIGVVIWLDIRNDK |
| Ga0181353_11561641 | 3300022179 | Freshwater Lake | MKTNWWIDSGMASQAAHELVWFVVIVVIGIGVVIWLDMRKDK |
| Ga0181354_11123164 | 3300022190 | Freshwater Lake | MKTSWWYESGLAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHNDGI |
| Ga0255156_10800192 | 3300026478 | Freshwater | MSDQWWVQSGMAAQAAKELWWFVVLVYIGIGIAIWRDK |
| Ga0208974_10098942 | 3300027608 | Freshwater Lentic | MKTAWWYESGAAAQAAQELVWFVVIVVVGIGVMAWRDMRKEKPKRKEHNDGI |
| Ga0208975_11652174 | 3300027659 | Freshwater Lentic | MKTTWWYESGLAAQAAQELMWFVVIVVVGIGVMAWRDMRKEKPK |
| (restricted) Ga0247833_10493168 | 3300027730 | Freshwater | MKTSWWYESGMAAAAAQELVWFVVACFILIGVAIWLDMRK |
| Ga0209593_101290272 | 3300027743 | Freshwater Sediment | MKTVWWIESGMAAQAAQELVWFVVLVFVGIGLVIWHDIRKEKPKPKRKEHNNGL |
| Ga0209358_102710003 | 3300027804 | Freshwater Lake | MKTNWWIESGYAAEAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0209358_104891852 | 3300027804 | Freshwater Lake | MKTVWWYESGLAAQAAQELVWFVVIVVVGIGVMAWRDMRKEKPKRKEHNDGL |
| Ga0209668_110987591 | 3300027899 | Freshwater Lake Sediment | MKTNWWIESGAASQAAHELMWFVVLVVVGIGVVIWFDMRNDK |
| (restricted) Ga0247834_12381743 | 3300027977 | Freshwater | MKTSWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGI |
| Ga0247723_10146234 | 3300028025 | Deep Subsurface Sediment | MKTSWWYESGMAAEAAQGLVWFVVIVFVGIGLFIWNDIRKDKRDGKK |
| Ga0247723_10549681 | 3300028025 | Deep Subsurface Sediment | MKTNWWIESGAAAQAAQGLVWFVVLVVVGIGVVIWLDMRKDK |
| (restricted) Ga0247835_11308094 | 3300028114 | Freshwater | MKTSWWYESGMAAAAAQELVWFVVACFILIGVAIWLDM |
| (restricted) Ga0247835_12300091 | 3300028114 | Freshwater | MKTNWWVDSGMAAQAAQELVWFVVIVVVGIGVVIWLDMRKDK |
| (restricted) Ga0247831_10650171 | 3300028559 | Freshwater | MKTSWWYDSGMAAQAAQELVWFVVIVFVGIGLLIWRDMKKEGKQQD |
| (restricted) Ga0247843_10212914 | 3300028569 | Freshwater | MKTSWWYESGMAAAAAQELVWFVVFCFILIGVAIWLDMRK |
| (restricted) Ga0247843_10475844 | 3300028569 | Freshwater | MKTSWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI |
| Ga0315907_100796234 | 3300031758 | Freshwater | MKTNWWIDSGMAAQAAHELVWFVVLVVVGIGVVIWLDIRKDK |
| Ga0315907_101353578 | 3300031758 | Freshwater | MKTSWWYESGMAAEAAQELVWFVVIVFVGIGLLIWNDIRKDKRDGKK |
| Ga0315907_102506773 | 3300031758 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLVFVGIGLVIWHDIRKEKPKPKRKEHNNGL |
| Ga0315907_109547622 | 3300031758 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLVVVGIGVVIWRDIRNEKKEKKDD |
| Ga0315907_111405092 | 3300031758 | Freshwater | MKTSWWIESGYAAEAAKELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0315900_102982074 | 3300031787 | Freshwater | IEMKTSWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMKKEKPKRKEHKDGI |
| Ga0315900_108750961 | 3300031787 | Freshwater | MKTNYWYDSGLAAQAAQELVWFVVIVFVGIGLLAWRDIRNEA |
| Ga0315909_100222517 | 3300031857 | Freshwater | MKTNWWIDSGMASQAAHELMWFVIIVVVGIGVVIWLDMRKDK |
| Ga0315909_100516103 | 3300031857 | Freshwater | MKTNWWIDSGMASQAAHELVWFVVLVVVGIGVVIWLDIRNDK |
| Ga0315909_101142296 | 3300031857 | Freshwater | MKTNWWIDSGMAAQAAQELVWFVVIVVVGIGVVIWLDIRKDK |
| Ga0315909_102767553 | 3300031857 | Freshwater | MKTAWWYESGMAAQAAQELMWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGL |
| Ga0315909_103032074 | 3300031857 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLVVVGIGVVIWRDMRNEKKEKKDD |
| Ga0315909_104533292 | 3300031857 | Freshwater | MKTAWWYESGAAAQAAHELVWFVVLVVVGIGVVIWRDIRNEKKEKKDD |
| Ga0315909_107967342 | 3300031857 | Freshwater | MKTNWWIESGAAAQAAQELVWFVVLVIVGIGVVIWLDMRKDK |
| Ga0315904_102691473 | 3300031951 | Freshwater | MKTNWWIESGMASQAAHELVWFVVLVFVGIGVLIWHDIRKEDKPKRKRGE |
| Ga0315904_106400331 | 3300031951 | Freshwater | KGGEMKTNWWIDSGMASQAAHELVWFVVLVVVGIGVVIWLDIRNDK |
| Ga0315904_108859731 | 3300031951 | Freshwater | MKTAWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGL |
| Ga0315904_110120121 | 3300031951 | Freshwater | MKTAWWYESGAAAQAAHELVWFVVLVVVGIGVVIWRDIRNEKKERKDD |
| Ga0315904_114088573 | 3300031951 | Freshwater | MKTNWWIDSGMASQAAHELVWFVVIVVIGIGVVIWLDI |
| Ga0315906_107134781 | 3300032050 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLVFVGIGVVIWHDIRKEKPKPKRKEHNNGL |
| Ga0334986_0056197_114_242 | 3300034012 | Freshwater | MKTSWWIESGMAAQAAQELMWFVVLVVVGIGVVIWFDMRNDK |
| Ga0334986_0094709_778_900 | 3300034012 | Freshwater | MKTSWWYESGAASEAARELAWFVVFCIILIGVAIWLDMRK |
| Ga0334995_0388987_438_566 | 3300034062 | Freshwater | MKTSWWIESGAASQAAHELMWFVVIVVVGVGVVIWLDMRNDK |
| Ga0335028_0625620_383_529 | 3300034071 | Freshwater | MKTAWWYESGAAAQAAQELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0335010_0462276_569_676 | 3300034092 | Freshwater | EAARELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0335010_0586027_1_105 | 3300034092 | Freshwater | MKTSWWYESGAAAQAAQELVWFVVLIVVGIGVVIW |
| Ga0335025_0589325_99_245 | 3300034096 | Freshwater | MKTAWWYESGYAAEAAKELVWFVVLIVVGIGVVIWRDMRNEKKEKKDD |
| Ga0335027_0724687_482_586 | 3300034101 | Freshwater | MKTNWWIESGLAAQAAQDLVWFIVLVFVGIGLLIW |
| Ga0335027_0754511_201_353 | 3300034101 | Freshwater | MKTVWWVESGMASEAAHELMWFVVLVFVGIGVLIWHDIKKEDKPNRKRGE |
| Ga0335036_0429116_263_391 | 3300034106 | Freshwater | MKTNWWVESGMAAQAAQELVWFVVIVVVGIGVVIWLDMRKDK |
| Ga0335051_0031004_2227_2385 | 3300034109 | Freshwater | MKTTWWYESGMAAQAAQELVWFVVIVVVGIGVMAWRDMQKEKPKRKEHKDGI |
| Ga0335063_0589611_3_119 | 3300034111 | Freshwater | MKTSWWYESGAASEAARELAWFVLFCIILIGVAIWLDMR |
| Ga0335066_0209889_1_117 | 3300034112 | Freshwater | MKTSWWYESGAASEAAHELVWFVLFCIILIGVAIWLDMR |
| Ga0335039_0646477_331_477 | 3300034355 | Freshwater | MKTAWWYESGAAAQAAHELVWFVVLVVVGIGVVIWRDIRKEKKERKDD |
| ⦗Top⦘ |