Metagenome / Metatranscriptome Family F065501

Basic Information
Family ID	F065501
Family Type	Metagenome / Metatranscriptome
Number of Sequences	127
Average Sequence Length	43 residues
Representative Sequence	DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Number of Associated Samples	108
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.79 %
% of genes near scaffold ends (potentially truncated)	98.43 %
% of genes from short scaffolds (< 2000 bps)	89.76 %
Associated GOLD sequencing projects	103
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Most Common Taxonomy
Group	Bacteria (68.504 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (11.024 % of family members)
Environment Ontology (ENVO)	Unclassified (34.646 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (33.071 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF00753	Lactamase_B	5.51
PF03401	TctC	3.94
PF04545	Sigma70_r4	3.15
PF01521	Fe-S_biosyn	3.15
PF03795	YCII	1.57
PF12680	SnoaL_2	1.57
PF00440	TetR_N	1.57
PF08327	AHSA1	1.57
PF10282	Lactonase	1.57
PF13505	OMP_b-brl	1.57
PF07690	MFS_1	1.57
PF13167	GTP-bdg_N	0.79
PF02738	MoCoBD_1	0.79
PF02518	HATPase_c	0.79
PF13683	rve_3	0.79
PF07479	NAD_Gly3P_dh_C	0.79
PF00691	OmpA	0.79
PF12849	PBP_like_2	0.79
PF01926	MMR_HSR1	0.79
PF00528	BPD_transp_1	0.79
PF00300	His_Phos_1	0.79
PF01554	MatE	0.79
PF05231	MASE1	0.79
PF12697	Abhydrolase_6	0.79
PF00857	Isochorismatase	0.79
PF11294	DUF3095	0.79
PF13442	Cytochrome_CBB3	0.79
PF01527	HTH_Tnp_1	0.79
PF00326	Peptidase_S9	0.79
PF03466	LysR_substrate	0.79
PF13419	HAD_2	0.79
PF12244	DUF3606	0.79
PF00710	Asparaginase	0.79
PF12792	CSS-motif	0.79
PF00072	Response_reg	0.79
PF07152	YaeQ	0.79
PF05995	CDO_I	0.79
PF04536	TPM_phosphatase	0.79
PF00795	CN_hydrolase	0.79
PF01614	IclR	0.79
PF11752	DUF3309	0.79
PF04199	Cyclase	0.79
PF09423	PhoD	0.79
PF11871	DUF3391	0.79
PF01042	Ribonuc_L-PSP	0.79
PF00403	HMA	0.79
PF01738	DLH	0.79
PF09084	NMT1	0.79
PF00665	rve	0.79
PF04972	BON	0.79
PF00392	GntR	0.79
PF13360	PQQ_2	0.79
PF02826	2-Hacid_dh_C	0.79
PF00111	Fer2	0.79
PF00211	Guanylate_cyc	0.79
PF00378	ECH_1	0.79

COG ID	Name	Functional Category	% Frequency in 127 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.94
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	3.15
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	3.15
COG0252	L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D	Translation, ribosomal structure and biogenesis [J]	1.57
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.57
COG5553	Predicted metal-dependent enzyme of the double-stranded beta helix superfamily	General function prediction only [R]	0.79
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.79
COG4681	Uncharacterized conserved protein YaeQ, suppresses RfaH defect	Function unknown [S]	0.79
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.79
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.79
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.79
COG3447	Integral membrane sensor domain MASE1	Signal transduction mechanisms [T]	0.79
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.79
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.79
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.79
COG2608	Copper chaperone CopZ	Inorganic ion transport and metabolism [P]	0.79
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.79
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.79
COG1878	Kynurenine formamidase	Amino acid transport and metabolism [E]	0.79
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.79
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	0.79
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.79
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.79
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.79
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	69.29 %
Unclassified	root	N/A	30.71 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	68.50 %
Unclassified	root	N/A	30.71 %
Viruses	superkingdom	All Organisms → Viruses	0.79 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	68.50 %
Unclassified	root	N/A	30.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	51.97 %
Unclassified	root	N/A	30.71 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	30.71 %
Unclassified	root	N/A	30.71 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6.30 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.15 %
Zetaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria	0.79 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.71 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	14.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.51 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.72 %
unclassified Zetaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria	0.79 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	0.79 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.79 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.79 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.71 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	13.39 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2.36 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.57 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.57 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1.57 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	0.79 %
Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	0.79 %
Stappiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae	0.79 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.79 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.79 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.79 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.79 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.79 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.71 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	13.39 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	1.57 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.57 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1.57 %
Labrenzia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia	0.79 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.79 %
Methylocucumis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocucumis	0.79 %
Bordetella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella	0.79 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.79 %
Oleomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas	0.79 %
Ramlibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter	0.79 %
Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	0.79 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.79 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.79 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.71 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	13.39 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.57 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1.57 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.79 %
Methylocucumis oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocucumis → Methylocucumis oryzae	0.79 %
Oleomonas cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	0.79 %
unclassified Ramlibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter	0.79 %
unclassified Labrenzia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia	0.79 %
Bordetella pertussis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella pertussis	0.79 %
Burkholderia cepacia complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex	0.79 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.79 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.79 %
Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	0.79 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.79 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.79 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.71 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	13.39 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.57 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1.57 %
Labrenzia sp. OB1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. OB1	0.79 %
Ramlibacter sp. WS9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. WS9	0.79 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.79 %
Methylocucumis oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocucumis → Methylocucumis oryzae	0.79 %
Oleomonas cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	0.79 %
Bordetella pertussis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella pertussis	0.79 %
Burkholderia cepacia complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex	0.79 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.79 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.79 %
Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	0.79 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.79 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.79 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004052\|Ga0055490_10158239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	669	Open in IMG/M
3300004463\|Ga0063356_100270386	Not Available	2079	Open in IMG/M
3300005176\|Ga0066679_10089417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. OB1	1854	Open in IMG/M
3300005336\|Ga0070680_101738669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	540	Open in IMG/M
3300005540\|Ga0066697_10271291	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300005557\|Ga0066704_10240552	All Organisms → cellular organisms → Bacteria → Proteobacteria	1228	Open in IMG/M
3300005558\|Ga0066698_10444661	Not Available	885	Open in IMG/M
3300005568\|Ga0066703_10048093	All Organisms → cellular organisms → Bacteria	2378	Open in IMG/M
3300005713\|Ga0066905_100800157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	818	Open in IMG/M
3300005840\|Ga0068870_10716753	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300006032\|Ga0066696_10455191	Not Available	838	Open in IMG/M
3300006032\|Ga0066696_11030150	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300006847\|Ga0075431_100013489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	8253	Open in IMG/M
3300006852\|Ga0075433_11615678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	559	Open in IMG/M
3300006854\|Ga0075425_102494252	Not Available	572	Open in IMG/M
3300006871\|Ga0075434_100078517	All Organisms → cellular organisms → Bacteria → Proteobacteria	3296	Open in IMG/M
3300006876\|Ga0079217_10822816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	649	Open in IMG/M
3300006894\|Ga0079215_10037617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1787	Open in IMG/M
3300006894\|Ga0079215_10306253	All Organisms → cellular organisms → Bacteria → Proteobacteria	881	Open in IMG/M
3300006894\|Ga0079215_10319146	Not Available	869	Open in IMG/M
3300006904\|Ga0075424_100147924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. WS9	2488	Open in IMG/M
3300006954\|Ga0079219_10356008	All Organisms → cellular organisms → Bacteria	943	Open in IMG/M
3300007004\|Ga0079218_10023904	All Organisms → cellular organisms → Bacteria → Proteobacteria	3404	Open in IMG/M
3300007004\|Ga0079218_10316418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1278	Open in IMG/M
3300007004\|Ga0079218_13952309	Not Available	504	Open in IMG/M
3300007255\|Ga0099791_10201468	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300009012\|Ga0066710_101984040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	864	Open in IMG/M
3300009012\|Ga0066710_102906432	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300009053\|Ga0105095_10170116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocucumis → Methylocucumis oryzae	1192	Open in IMG/M
3300009087\|Ga0105107_10178247	Not Available	1492	Open in IMG/M
3300009087\|Ga0105107_11079992	Not Available	559	Open in IMG/M
3300009088\|Ga0099830_11229526	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300009089\|Ga0099828_11428768	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300009137\|Ga0066709_101586573	Not Available	938	Open in IMG/M
3300009137\|Ga0066709_101867865	Not Available	838	Open in IMG/M
3300009137\|Ga0066709_102528878	Not Available	691	Open in IMG/M
3300009153\|Ga0105094_10136656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1393	Open in IMG/M
3300009157\|Ga0105092_10845962	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300009171\|Ga0105101_10345750	Not Available	721	Open in IMG/M
3300010045\|Ga0126311_11250934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	615	Open in IMG/M
3300010045\|Ga0126311_11609223	Not Available	547	Open in IMG/M
3300010128\|Ga0127486_1032735	Not Available	711	Open in IMG/M
3300010399\|Ga0134127_10430239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1314	Open in IMG/M
3300010400\|Ga0134122_11848081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	637	Open in IMG/M
3300010401\|Ga0134121_10977955	Not Available	829	Open in IMG/M
3300011399\|Ga0137466_1056630	Not Available	613	Open in IMG/M
3300011413\|Ga0137333_1121948	Not Available	602	Open in IMG/M
3300011417\|Ga0137326_1018219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1515	Open in IMG/M
3300011428\|Ga0137456_1203261	Not Available	536	Open in IMG/M
3300011441\|Ga0137452_1224944	Not Available	636	Open in IMG/M
3300011441\|Ga0137452_1314396	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300012034\|Ga0137453_1051025	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300012140\|Ga0137351_1051689	Not Available	583	Open in IMG/M
3300012159\|Ga0137344_1094026	All Organisms → cellular organisms → Bacteria → Proteobacteria	554	Open in IMG/M
3300012160\|Ga0137349_1014408	All Organisms → cellular organisms → Bacteria	1196	Open in IMG/M
3300012199\|Ga0137383_11263405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	528	Open in IMG/M
3300012203\|Ga0137399_11592111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella pertussis	541	Open in IMG/M
3300012206\|Ga0137380_10126553	All Organisms → cellular organisms → Bacteria → Proteobacteria	2334	Open in IMG/M
3300012361\|Ga0137360_11133725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	676	Open in IMG/M
3300012362\|Ga0137361_10340687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1375	Open in IMG/M
3300012913\|Ga0157298_10330996	Not Available	553	Open in IMG/M
3300012918\|Ga0137396_10163805	Not Available	1624	Open in IMG/M
3300012922\|Ga0137394_11152532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	639	Open in IMG/M
3300012922\|Ga0137394_11258153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	603	Open in IMG/M
3300012930\|Ga0137407_10928834	Not Available	823	Open in IMG/M
3300014265\|Ga0075314_1096928	Not Available	634	Open in IMG/M
3300014271\|Ga0075326_1286963	Not Available	513	Open in IMG/M
3300014873\|Ga0180066_1075406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	686	Open in IMG/M
3300014877\|Ga0180074_1120030	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300014883\|Ga0180086_1088618	Not Available	778	Open in IMG/M
3300014885\|Ga0180063_1178513	Not Available	679	Open in IMG/M
3300017792\|Ga0163161_11500242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	592	Open in IMG/M
3300017930\|Ga0187825_10353001	Not Available	557	Open in IMG/M
3300017939\|Ga0187775_10114068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	923	Open in IMG/M
3300018422\|Ga0190265_10173349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2138	Open in IMG/M
3300018422\|Ga0190265_11100010	All Organisms → cellular organisms → Bacteria → Proteobacteria	915	Open in IMG/M
3300018422\|Ga0190265_11125713	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300018422\|Ga0190265_11215556	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300018432\|Ga0190275_10395128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1391	Open in IMG/M
3300018468\|Ga0066662_11823814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	636	Open in IMG/M
3300019238\|Ga0180112_1332268	All Organisms → cellular organisms → Bacteria → Proteobacteria	1063	Open in IMG/M
3300019361\|Ga0173482_10268306	Not Available	735	Open in IMG/M
3300020215\|Ga0196963_10454167	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	578	Open in IMG/M
3300021067\|Ga0196978_1048361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	796	Open in IMG/M
3300021080\|Ga0210382_10373833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	630	Open in IMG/M
3300021081\|Ga0210379_10144949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1008	Open in IMG/M
3300025160\|Ga0209109_10240802	Not Available	880	Open in IMG/M
3300025165\|Ga0209108_10066488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1979	Open in IMG/M
3300025917\|Ga0207660_11401595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	566	Open in IMG/M
3300025930\|Ga0207701_10618582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	921	Open in IMG/M
3300025960\|Ga0207651_10457571	All Organisms → cellular organisms → Bacteria	1096	Open in IMG/M
3300025986\|Ga0207658_11692854	Not Available	578	Open in IMG/M
3300026041\|Ga0207639_12267762	All Organisms → cellular organisms → Bacteria → Proteobacteria	504	Open in IMG/M
3300026089\|Ga0207648_12267152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	504	Open in IMG/M
3300026121\|Ga0207683_11591975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	602	Open in IMG/M
3300026295\|Ga0209234_1102276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1080	Open in IMG/M
3300026310\|Ga0209239_1039545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2182	Open in IMG/M
3300026343\|Ga0209159_1121936	All Organisms → Viruses → Predicted Viral	1097	Open in IMG/M
3300026542\|Ga0209805_1060108	All Organisms → cellular organisms → Bacteria	1871	Open in IMG/M
3300027395\|Ga0209996_1015676	All Organisms → cellular organisms → Bacteria → Proteobacteria	1036	Open in IMG/M
3300027471\|Ga0209995_1100159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	500	Open in IMG/M
3300027543\|Ga0209999_1022372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	1163	Open in IMG/M
3300027543\|Ga0209999_1025742	Not Available	1086	Open in IMG/M
3300027639\|Ga0209387_1111288	Not Available	681	Open in IMG/M
3300027663\|Ga0208990_1007435	Not Available	3634	Open in IMG/M
3300027713\|Ga0209286_1131575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	923	Open in IMG/M
3300027713\|Ga0209286_1328131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	529	Open in IMG/M
3300027731\|Ga0209592_1344518	Not Available	505	Open in IMG/M
3300027886\|Ga0209486_10240684	All Organisms → cellular organisms → Bacteria → Proteobacteria	1041	Open in IMG/M
3300027909\|Ga0209382_11755621	Not Available	606	Open in IMG/M
3300028536\|Ga0137415_10455434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1085	Open in IMG/M
3300028592\|Ga0247822_10429597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12	1034	Open in IMG/M
3300031226\|Ga0307497_10516735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	592	Open in IMG/M
3300031548\|Ga0307408_102093413	Not Available	545	Open in IMG/M
3300031820\|Ga0307473_10918260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	633	Open in IMG/M
3300031912\|Ga0306921_10195018	All Organisms → cellular organisms → Bacteria → Proteobacteria	2374	Open in IMG/M
3300031965\|Ga0326597_11412870	Not Available	673	Open in IMG/M
3300031995\|Ga0307409_102178698	Not Available	584	Open in IMG/M
3300032002\|Ga0307416_102248199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex	646	Open in IMG/M
3300032061\|Ga0315540_10073376	All Organisms → cellular organisms → Bacteria	1601	Open in IMG/M
3300032061\|Ga0315540_10088999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80	1428	Open in IMG/M
3300032075\|Ga0310890_10215313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1328	Open in IMG/M
3300032157\|Ga0315912_10073125	All Organisms → cellular organisms → Bacteria → Proteobacteria	2693	Open in IMG/M
3300032157\|Ga0315912_10537837	All Organisms → cellular organisms → Bacteria → Proteobacteria	930	Open in IMG/M
3300032180\|Ga0307471_100005619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7861	Open in IMG/M
3300033550\|Ga0247829_10260118	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300034676\|Ga0314801_069597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	735	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.46%
Host-Associated	Host-Associated	16.54%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.84%
Aquatic	Environmental → Aquatic	23.62%
Plants	Host-Associated → Plants	16.54%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.84%
Sediment	Environmental → Aquatic → Sediment	11.02%
Freshwater	Environmental → Aquatic → Freshwater	10.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.87%
Marine	Environmental → Aquatic → Marine	2.36%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	52.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	11.02%
Sediment	Environmental → Aquatic → Freshwater → Sediment	9.45%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.09%
Loam	Environmental → Terrestrial → Soil → Loam	3.15%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.36%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.57%
Sand	Environmental → Terrestrial → Soil → Sand	1.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.57%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.79%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.79%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.20%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	11.02%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	9.45%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.09%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.15%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.36%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.36%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.57%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.57%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.57%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	1.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.57%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.79%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	11.02%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.24%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	7.87%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	7.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.09%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.30%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.15%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.94%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.36%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.36%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.36%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	1.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.57%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.57%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.57%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.57%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.57%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.57%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.79%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.79%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.79%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010128	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011399	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2	Environmental	Open in IMG/M
3300011413	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2	Environmental	Open in IMG/M
3300011417	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2	Environmental	Open in IMG/M
3300011428	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2	Environmental	Open in IMG/M
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental	Open in IMG/M
3300012034	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2	Environmental	Open in IMG/M
3300012140	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2	Environmental	Open in IMG/M
3300012159	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2	Environmental	Open in IMG/M
3300012160	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014265	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2	Environmental	Open in IMG/M
3300014271	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2	Environmental	Open in IMG/M
3300014873	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D	Environmental	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300014883	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D	Environmental	Open in IMG/M
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019238	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021067	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental	Open in IMG/M
3300027663	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032061	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034676	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F065501

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0055490_101582393	3300004052	Natural And Restored Wetlands	ALLAVFVADYGKDEEYKGIAGQIAAFLAKPRKVKPCPPA*
Ga0063356_1002703863	3300004463	Arabidopsis Thaliana Rhizosphere	DGRALLANFVANYGKVEEFRGIAGQITTFLDKARKVKPCPPA*
Ga0066679_100894171	3300005176	Soil	LDGRALLANFVANYGKVEENKGIAGQITAFLDKARRLKPCPPA*
Ga0070680_1017386692	3300005336	Corn Rhizosphere	RAALANFVATYGKVDEFKGIAGQITVFLDKARKPKPCPPA*
Ga0066697_102712911	3300005540	Soil	ECRRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA*
Ga0066704_102405523	3300005557	Soil	LDGRALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCSPA*
Ga0066698_104446612	3300005558	Soil	LVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA*
Ga0066703_100480931	3300005568	Soil	LDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA*
Ga0066905_1008001571	3300005713	Tropical Forest Soil	NDGRAHLEYFVATWGNLEEFKGIAGQISAFLGKARKPRPCP*
Ga0068870_107167532	3300005840	Miscanthus Rhizosphere	LLVNFVDNYGKVEENKGIAGQITAFLGKARKVKPCPPA*
Ga0066696_104551911	3300006032	Soil	ERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKLCPPA*
Ga0066696_110301501	3300006032	Soil	ERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA*
Ga0075431_10001348910	3300006847	Populus Rhizosphere	VLENFVATYGKVDEFREIAGQITAFLARARKVKPCPPAS*
Ga0075433_116156783	3300006852	Populus Rhizosphere	ALLVNFVDNYGKVEENKGIAGRITAFLGKTRKVKPCPPA*
Ga0075425_1024942521	3300006854	Populus Rhizosphere	ECRRLEQERLDGRAVLENFVANYGKDEEFKGIGGRINAFLNEPRKARPCPPA*
Ga0075434_1000785171	3300006871	Populus Rhizosphere	ECRRLEQERLDGRAVRENFANYGKDEEFKGIGGRINAFLKEPRKAKPCR*
Ga0079217_108228161	3300006876	Agricultural Soil	QEQLEGRALLANFVANHGKVEEFQGIAGQISAFLDKAGNVKQCPPA*
Ga0079215_100376174	3300006894	Agricultural Soil	QERLDGRAVLAGFVASYGKVEEYKGIAGQITAFLNKARKAKPCPPA*
Ga0079215_103062534	3300006894	Agricultural Soil	QERLEGRAVLSNFVSNYGKDEEYTGIAGEISAFLGKARTEKPCPPA*
Ga0079215_103191461	3300006894	Agricultural Soil	GREVLENFVATYGTVDEFKGIAGQISAFLKKARKPKPCPPA*
Ga0075424_1001479244	3300006904	Populus Rhizosphere	VLENFVANYGKDEEFKGIGGRINAFLNEPRKARPCPPA*
Ga0079219_103560082	3300006954	Agricultural Soil	EQERLDGRAVLANFVATYGEVDEFKEIAGQITAFLDKARKVKPCPPA*
Ga0079218_100239041	3300007004	Agricultural Soil	CRRLEQERSEGRAMLENFVANYGKVDEFKGIGGQITAFLGKARKVKPCPPA*
Ga0079218_103164181	3300007004	Agricultural Soil	CRRLEQERSEGRAMLENFVANYGKVDEFKGIGGQITAFLGRARKVKPCPPA*
Ga0079218_139523092	3300007004	Agricultural Soil	GRALLENFVATYGKVDEFKGIAGQITAFLGKARKVKPCPPA*
Ga0099791_102014683	3300007255	Vadose Zone Soil	DGRALLVSFVDNYGKVEENKGIAGQITAFLAKARKAMPCPPA*
Ga0066710_1019840401	3300009012	Grasslands Soil	RALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA
Ga0066710_1029064322	3300009012	Grasslands Soil	ECRRLEQERLDGRALLVNFVDNYGKLEENKGIARQITAFLNKARKVKPCPPA
Ga0105095_101701163	3300009053	Freshwater Sediment	RLDGRALLENFVANYGKVEEFKGIAGQITAFLGKARKVKPCPPA*
Ga0105107_101782472	3300009087	Freshwater Sediment	RALLENFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0105107_110799922	3300009087	Freshwater Sediment	LDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0099830_112295262	3300009088	Vadose Zone Soil	DGRALLANFVATYGKVEEFKEIAGQITTFLDKARKVKPCPPG*
Ga0099828_114287684	3300009089	Vadose Zone Soil	RALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0066709_1015865731	3300009137	Grasslands Soil	RALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKLCPPA*
Ga0066709_1018678651	3300009137	Grasslands Soil	RRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA*
Ga0066709_1025288781	3300009137	Grasslands Soil	LLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA*
Ga0105094_101366561	3300009153	Freshwater Sediment	HLADFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0105092_108459622	3300009157	Freshwater Sediment	ERLDGRALLANFVATYGKVDEFKGIAGQISAFLNKARKVKPCPPAS*
Ga0105101_103457502	3300009171	Freshwater Sediment	CRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDEARKVKPCPPA*
Ga0126311_112509342	3300010045	Serpentine Soil	RLEQERSDGRALLANFVANYGKVEEFKGIAGQISAFLDKARKVKPCPPA*
Ga0126311_116092231	3300010045	Serpentine Soil	LLTSFVDKYGKVDEFKAIAGQISAFLAKARTVKPCPPA*
Ga0127486_10327352	3300010128	Grasslands Soil	VNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA*
Ga0134127_104302391	3300010399	Terrestrial Soil	ALLVNFVDNYGKVEENKGIAKQITKFLGKTGKAKACPPA*
Ga0134122_118480812	3300010400	Terrestrial Soil	LENFIATYGKVAEFKEPAGHIAAFLGKPRKAKPCAPAS*
Ga0134121_109779551	3300010401	Terrestrial Soil	SFVAKYGKVEEFTEIAGQISAFLEKPRKVKPCPPA*
Ga0137466_10566303	3300011399	Soil	RECRRLEQERLDGRALLANFVATYGKVEEFKDIAGQITAFLDKARKVKPCPPA*
Ga0137333_11219481	3300011413	Soil	ERLDGRALLENFVANYGKVEEFKGIAGQITAFLAKARKVKPCPPA*
Ga0137326_10182193	3300011417	Soil	FVATYGNVEEFKEIAGQITAFLDKARKVKPCPPA*
Ga0137456_12032612	3300011428	Soil	ERECRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0137452_12249441	3300011441	Soil	LLANFVATYGKVDEFKEIAGQIAAFLDKARKVKPCPPA*
Ga0137452_13143961	3300011441	Soil	NFVATYGKVDEFNVIAGQITAFLDKARKVKPCPPA*
Ga0137453_10510252	3300012034	Soil	CRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0137351_10516891	3300012140	Soil	QERNDGRALLANFVANYGKVEEFEEIAGQITAFLDKARKVKPCPPAG*
Ga0137344_10940262	3300012159	Soil	ERSDGRALLANFVAKYGKVEELKGIAGQISAFLDKAPKPKPCPPA*
Ga0137349_10144081	3300012160	Soil	CRRLEQERLDGRALLANFVATYGKVEEFKVIAGQITGFLDKARKVKPCPPTP*
Ga0137383_112634052	3300012199	Vadose Zone Soil	RLAQERLDGRALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA*
Ga0137399_115921112	3300012203	Vadose Zone Soil	LAQERLDGRALLVSFVDNYGKVEENKGIAGQITAFLDKARKVKPCPPA*
Ga0137380_101265531	3300012206	Vadose Zone Soil	ERECRRLEQERLDGRALLANFVANYGKVEEFKGIEGQITAFLDKVRKVKPCPPA*
Ga0137360_111337251	3300012361	Vadose Zone Soil	RLDGRALLANFVANYGKVEEFKGIAGQTTAFLDKVRKVKPCPPA*
Ga0137361_103406873	3300012362	Vadose Zone Soil	ALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0157298_103309961	3300012913	Soil	RLDGRMVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA*
Ga0137396_101638052	3300012918	Vadose Zone Soil	LLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0137394_111525321	3300012922	Vadose Zone Soil	LEQERLDGRAVLANFVANYGKVEEFKGIAGQTTAFLDKVRKVKPCPPA*
Ga0137394_112581532	3300012922	Vadose Zone Soil	ALLENFVATYGKVDEFKVIAGQITAFLDKARKVKPCPPA*
Ga0137407_109288342	3300012930	Vadose Zone Soil	DGRALLVNFVDNYGKVEEFKGIAGQITAFLNKARKVKPCPPE*
Ga0075314_10969282	3300014265	Natural And Restored Wetlands	LDGRAVLESFVATYGKVDEFKGIAGQITAFLAKARKVKPCPPA*
Ga0075326_12869631	3300014271	Natural And Restored Wetlands	RALLAVFVADYGKDEEFKGIAGQIAAFLAKPRKVKPCPPA*
Ga0180066_10754061	3300014873	Soil	RLDGRTLLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA*
Ga0180074_11200302	3300014877	Soil	ERLDGRALLANFVANYGKVEEFKGIAGQITALLDKTRKVKPCPPA*
Ga0180086_10886182	3300014883	Soil	LEQERLDGRALLENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA*
Ga0180063_11785132	3300014885	Soil	DGRALLANFVATYGKVEEFKEIAGQITAFLDKARKVKPCPPA*
Ga0163161_115002422	3300017792	Switchgrass Rhizosphere	RECRRLEQERLDGRALLENFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA
Ga0187825_103530012	3300017930	Freshwater Sediment	ADFVDKYGKVDEFKGIAGQITAFLGKPRKAKPCPPA
Ga0187775_101140683	3300017939	Tropical Peatland	NFVTSYGTVDEFKGIAGQIRAFLAKPRKEKACPPA
Ga0190265_101733493	3300018422	Soil	CRRLEQERSEGRALLENFVASYGKVDEFKGIGGQISAFLAKARKVKPCPPA
Ga0190265_111000102	3300018422	Soil	DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0190265_111257133	3300018422	Soil	DGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPAS
Ga0190265_112155563	3300018422	Soil	DGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPVP
Ga0190275_103951284	3300018432	Soil	LENFVATYGKVDEFKGIAAQISAFLGKARKVKPCPPA
Ga0066662_118238143	3300018468	Grasslands Soil	RALLVNFVDNYGKVEENKGIAGQITTFLAKARNVKPCPPA
Ga0180112_13322682	3300019238	Groundwater Sediment	RRLEQERSDGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPA
Ga0173482_102683062	3300019361	Soil	AEQERLDGRMVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA
Ga0196963_104541672	3300020215	Soil	QERSEGRALLGNFVATYGAVDEFKAIGGQISAFLAKARKAKPCPPAPS
Ga0196978_10483613	3300021067	Soil	LENFVATYGKVDEFTGIAGQISAFLAKPRKVKPCPPA
Ga0210382_103738331	3300021080	Groundwater Sediment	LLANFVATYGKVEEFKEIAGQISAFLDKARKVKPCPPA
Ga0210379_101449491	3300021081	Groundwater Sediment	ECRRLEQERLDGRALLANFVATYGKVDEFKEIAGQITAFLDKARKVKPCPPA
Ga0209109_102408021	3300025160	Soil	ECRRLEQERLDGRVLLANFVANYGKVEEFKGIAGQITTFLDKARKVKPCPPA
Ga0209108_100664885	3300025165	Soil	LEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0207660_114015951	3300025917	Corn Rhizosphere	LEQESSDGRAALANFVATYGKVDEFKGIAGQITVFLDKARKPKPCPPA
Ga0207701_106185821	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	QERSDGRALLENFVATYGKAEEFKGIAGQISAFLGKARKAKPCPPA
Ga0207651_104575711	3300025960	Switchgrass Rhizosphere	LLENFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA
Ga0207658_116928541	3300025986	Switchgrass Rhizosphere	VNFVDNYGKVEENKGIAGQIAAFLGRARKVKPCPPA
Ga0207639_122677621	3300026041	Corn Rhizosphere	MVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA
Ga0207648_122671522	3300026089	Miscanthus Rhizosphere	LLENFVATYGKAEEFKGIAGQIRAFLDKARKVKPCPPA
Ga0207683_115919752	3300026121	Miscanthus Rhizosphere	GRALLENFVATYGKAEEFKGIAGQISAFLGKARKAKPCPPA
Ga0209234_11022763	3300026295	Grasslands Soil	ECRRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA
Ga0209239_10395451	3300026310	Grasslands Soil	ALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA
Ga0209159_11219362	3300026343	Soil	DGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA
Ga0209805_10601081	3300026542	Soil	ALLVNFVDNYGKVEENKGIAGQITTFLAKARKMKACPPA
Ga0209996_10156763	3300027395	Arabidopsis Thaliana Rhizosphere	LLENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA
Ga0209995_11001591	3300027471	Arabidopsis Thaliana Rhizosphere	LENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA
Ga0209999_10223721	3300027543	Arabidopsis Thaliana Rhizosphere	LENFVATYGKVDEFKGIAGQIAAFLGKARKVKPCPPA
Ga0209999_10257423	3300027543	Arabidopsis Thaliana Rhizosphere	NFVANYGKVDEFKGIAGQITTFLGKARKVKPCPPA
Ga0209387_11112881	3300027639	Agricultural Soil	VLENFVATYGTVDEFKGIAGQISAFLKKARKPKPCPPA
Ga0208990_10074351	3300027663	Forest Soil	ANFVANYGKVEEFEGIAGQITAFLDKARKVKPCPPA
Ga0209286_11315751	3300027713	Freshwater Sediment	DFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0209286_13281312	3300027713	Freshwater Sediment	LDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0209592_13445181	3300027731	Freshwater Sediment	DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPT
Ga0209486_102406843	3300027886	Agricultural Soil	AQERSDGRELLANFVANYGKVDEFKGIAGQISAFLARARKVKPCPPA
Ga0209382_117556211	3300027909	Populus Rhizosphere	LLENFVANYGKVDEFKGIAGQISAFLGKARKVKPCPPA
Ga0137415_104554343	3300028536	Vadose Zone Soil	LLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0247822_104295971	3300028592	Soil	SAGREVLENFVATYGAVDEFKGIAGQISAFLKKARKPKPCPPA
Ga0307497_105167352	3300031226	Soil	RLEQERSDGRALLASFVAKYGKVDEFKEISGQISAFLDKARKPKPCPPAPK
Ga0307408_1020934132	3300031548	Rhizosphere	RLEQERSDGREVLENFVATYGTVDEFKGIAGQISAFLKKARKVKPCPPA
Ga0307473_109182601	3300031820	Hardwood Forest Soil	GRALLAKFVATYGEVDEFKEIAGQITAFLGKARKLKPCPPA
Ga0306921_101950184	3300031912	Soil	GRALLTNFVDNYGKIDENKGIAGQITAFLAKPRKAKPCAPA
Ga0326597_114128702	3300031965	Soil	ALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA
Ga0307409_1021786982	3300031995	Rhizosphere	CRRQEQERSDGRALLENFVATYGKVDEFKGIAGQISAFLGKARKVKPCPPA
Ga0307416_1022481992	3300032002	Rhizosphere	RLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLKKARKAKPCPPA
Ga0315540_100733761	3300032061	Salt Marsh Sediment	REGRALLASFVAKYGTVEEFKGIAGQISAFLDKPRKVKPCPPA
Ga0315540_100889991	3300032061	Salt Marsh Sediment	GRALLASFVAKYGTVEEFKGIAGQISAFLDKPRKVKPCPPA
Ga0310890_102153131	3300032075	Soil	ANFVATYGKVDEFKGIAGQISAFLGKARKAKPCPPA
Ga0315912_100731252	3300032157	Soil	GREVLANFVATYGKVAEFKGIAGQISAFLDKAVKPKPCPPAG
Ga0315912_105378373	3300032157	Soil	EKFVADYGKDEEFKGIAGQITAFLAKARKVKPCPPA
Ga0307471_1000056197	3300032180	Hardwood Forest Soil	LADFVANYGKVDEFKEIAGQITAFLNKARKVKPCPSTPPELPRP
Ga0247829_102601183	3300033550	Soil	NFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA
Ga0314801_069597_3_143	3300034676	Soil	QEQNEGRALLANFVATYGKVEEFKGIAGQITAFLDKARKVKPCPPA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign