| Basic Information | |
|---|---|
| Family ID | F065476 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTLLLLGLAVRGW |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.09 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.213 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (8.661 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.646 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.307 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00437 | T2SSE | 10.24 |
| PF05157 | T2SSE_N | 1.57 |
| PF07927 | HicA_toxin | 1.57 |
| PF15919 | HicB_lk_antitox | 1.57 |
| PF00848 | Ring_hydroxyl_A | 0.79 |
| PF00482 | T2SSF | 0.79 |
| PF02786 | CPSase_L_D2 | 0.79 |
| PF03548 | LolA | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.57 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.57 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.21 % |
| Unclassified | root | N/A | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12388488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300001593|JGI12635J15846_10083064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2338 | Open in IMG/M |
| 3300002917|JGI25616J43925_10033040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2286 | Open in IMG/M |
| 3300004092|Ga0062389_100772503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1139 | Open in IMG/M |
| 3300004629|Ga0008092_10476747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300005468|Ga0070707_100734478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300005471|Ga0070698_101842196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005533|Ga0070734_10448012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 736 | Open in IMG/M |
| 3300005536|Ga0070697_100033556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4134 | Open in IMG/M |
| 3300005536|Ga0070697_100924586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300005921|Ga0070766_10968654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 584 | Open in IMG/M |
| 3300006059|Ga0075017_100527125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300006162|Ga0075030_101645386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300006893|Ga0073928_10171679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
| 3300007258|Ga0099793_10029191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2329 | Open in IMG/M |
| 3300009143|Ga0099792_11048784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300009520|Ga0116214_1143520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300009623|Ga0116133_1152239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300009630|Ga0116114_1017883 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300009637|Ga0116118_1023343 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300009638|Ga0116113_1069444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300009665|Ga0116135_1413793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009700|Ga0116217_10778036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300009762|Ga0116130_1296636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300009792|Ga0126374_10504967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300010043|Ga0126380_11214015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010359|Ga0126376_10578789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300012203|Ga0137399_11030783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300012361|Ga0137360_11852804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300012532|Ga0137373_10883203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300012582|Ga0137358_10062256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2496 | Open in IMG/M |
| 3300012918|Ga0137396_11243623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012923|Ga0137359_11550279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012923|Ga0137359_11773650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012925|Ga0137419_10747217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300012971|Ga0126369_12776807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300014155|Ga0181524_10252306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300014162|Ga0181538_10060910 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300014168|Ga0181534_10263557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300014199|Ga0181535_10462332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300014490|Ga0182010_10619636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300014501|Ga0182024_10019407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12537 | Open in IMG/M |
| 3300014502|Ga0182021_10175929 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300015373|Ga0132257_102475360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300016270|Ga0182036_10001706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10423 | Open in IMG/M |
| 3300016387|Ga0182040_10840751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300017822|Ga0187802_10403146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300017823|Ga0187818_10045445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1885 | Open in IMG/M |
| 3300017823|Ga0187818_10232739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300017823|Ga0187818_10532874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300017935|Ga0187848_10452921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017941|Ga0187850_10119382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300017946|Ga0187879_10563908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300017946|Ga0187879_10797746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300017974|Ga0187777_10819379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300018025|Ga0187885_10534819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300018040|Ga0187862_10186923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
| 3300018042|Ga0187871_10606354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300018046|Ga0187851_10176552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300018046|Ga0187851_10535177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300018047|Ga0187859_10064878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1923 | Open in IMG/M |
| 3300018085|Ga0187772_10684713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300018085|Ga0187772_11068067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300018086|Ga0187769_10963367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300018086|Ga0187769_11302220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300018090|Ga0187770_11488841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300018482|Ga0066669_10335171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300019082|Ga0187852_1418372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300019194|Ga0184586_103354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300019882|Ga0193713_1039377 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300020580|Ga0210403_11238561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300021168|Ga0210406_10213475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1596 | Open in IMG/M |
| 3300021168|Ga0210406_10506623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300021559|Ga0210409_11404424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300021560|Ga0126371_13238862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300021860|Ga0213851_1123509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300021861|Ga0213853_10885221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300022840|Ga0224549_1051040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300025414|Ga0208935_1055697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300025442|Ga0208034_1018218 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300025448|Ga0208037_1009361 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300025457|Ga0208850_1066193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300025480|Ga0208688_1055179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300025500|Ga0208686_1018127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1850 | Open in IMG/M |
| 3300026298|Ga0209236_1258891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300026351|Ga0257170_1049409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300026494|Ga0257159_1091428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300026538|Ga0209056_10731734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027591|Ga0209733_1094505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300027591|Ga0209733_1174069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027625|Ga0208044_1029056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1898 | Open in IMG/M |
| 3300027629|Ga0209422_1009938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2341 | Open in IMG/M |
| 3300027635|Ga0209625_1114987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300027663|Ga0208990_1018901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2262 | Open in IMG/M |
| 3300027667|Ga0209009_1153671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300027767|Ga0209655_10199698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300027768|Ga0209772_10041037 | Not Available | 1364 | Open in IMG/M |
| 3300027812|Ga0209656_10380307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300027829|Ga0209773_10204797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300027898|Ga0209067_10619572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300028773|Ga0302234_10313218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300028779|Ga0302266_10103025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300028800|Ga0265338_10699270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300028909|Ga0302200_10015162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5184 | Open in IMG/M |
| 3300029917|Ga0311326_10023387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3762 | Open in IMG/M |
| 3300029953|Ga0311343_10839676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300029990|Ga0311336_10504051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300029995|Ga0302210_10040492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| 3300030020|Ga0311344_10653414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300030041|Ga0302274_10416895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300030058|Ga0302179_10321084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300030503|Ga0311370_11365686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300030618|Ga0311354_11952015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300030943|Ga0311366_11225969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300031231|Ga0170824_104277516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300031525|Ga0302326_13497377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031708|Ga0310686_108360659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300031711|Ga0265314_10122100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300031740|Ga0307468_100131106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300031792|Ga0318529_10432452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300032039|Ga0318559_10106760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300033158|Ga0335077_10907414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300033405|Ga0326727_10356718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300033405|Ga0326727_10573192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300033433|Ga0326726_10627696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300033803|Ga0314862_0005492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
| 3300033887|Ga0334790_210193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.36% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.36% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.36% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.57% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.57% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.57% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019194 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_123884881 | 3300000789 | Soil | MRLDINLATHAYEDSRQFWLRWGTGVAILGLVTLGLLI |
| JGI12635J15846_100830641 | 3300001593 | Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGLLALSTLLLL |
| JGI25616J43925_100330401 | 3300002917 | Grasslands Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLALLGLAVRGWTNAGRDRQNIAQLQSQ |
| Ga0062389_1007725032 | 3300004092 | Bog Forest Soil | MRLDINLATRPYEDAREFWLRWGVGVGLLGLVTLVLLGLAL |
| Ga0008092_104767471 | 3300004629 | Tropical Rainforest Soil | MRLDINLATRPYEDARQFWMQWGASVGLLALVTLALVAWAVHGWINAGRDRQTI |
| Ga0070707_1007344782 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LDSDFINMRLDINLATRPYEDAREFWVRWGLGVGLLGLLTLVLLGLAVRGWTNA |
| Ga0070698_1018421961 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLATHPYEDAREFWARWGLGVGLLGVLTLVLVTLAVHGWVKAG |
| Ga0070734_104480122 | 3300005533 | Surface Soil | MRLDINLASQPYEDAREFWMRWGTVVGALALVTLLLLTL |
| Ga0070697_1000335564 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLATHPYEDAGEFWARWGLAVGLLGVLTLVLITLAVHGWVKAGRDRQSIRHLQQQ |
| Ga0070697_1009245862 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTLALLGLAVRGWTNAGRDRHNIGQLQ |
| Ga0070766_109686542 | 3300005921 | Soil | MRLDINLATRPYEDAREFWMRWGLAVGLLGVLTLGLLAWAVQGWINAGRDRQDIAHLQ |
| Ga0075017_1005271252 | 3300006059 | Watersheds | MRLDINLATHPYEDAREFWTAWGAGIGVLALLTLLL |
| Ga0075030_1016453862 | 3300006162 | Watersheds | MRLDINLATRPYEDARQFWLRWGTGLAALGILTLALLAITA |
| Ga0073928_101716791 | 3300006893 | Iron-Sulfur Acid Spring | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTLVLLG |
| Ga0099793_100291913 | 3300007258 | Vadose Zone Soil | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTLLLLGLAVRGW |
| Ga0099792_110487841 | 3300009143 | Vadose Zone Soil | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTLVLLGLAVRGWTQAGRDR |
| Ga0116214_11435201 | 3300009520 | Peatlands Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLFLLGWAVQGWTKAGRDRH |
| Ga0116133_11522391 | 3300009623 | Peatland | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTVLLLALAVRGWIHAGRDRHEIAQLQ |
| Ga0116114_10178834 | 3300009630 | Peatland | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTVLLLGWAVQGW |
| Ga0116118_10233431 | 3300009637 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTVLLLVLAVQG |
| Ga0116113_10694441 | 3300009638 | Peatland | MRLDINLATRPYEDAREFWARWGLGVGALGVLTLFLLGLTVNGWTKAGRDRQDIA |
| Ga0116135_14137932 | 3300009665 | Peatland | MRLDINLATRPYEDAREFWARWGLGVGALGVLTLFLLGLTVNGWTKAGRDRQDIARLQ |
| Ga0116217_107780361 | 3300009700 | Peatlands Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLFLLGWAVQGWTK |
| Ga0116130_12966362 | 3300009762 | Peatland | MRLDINLATRAYEDAREFWARWGLGVGLLAVLTLFLLGLTVNDWT |
| Ga0126374_105049671 | 3300009792 | Tropical Forest Soil | MRLDINLATHAYEDSRQFWLRWGTGVGALGVLTLGLVI |
| Ga0126380_112140151 | 3300010043 | Tropical Forest Soil | MRLDINLATHVYEDSRQFWLRWGTGVGVLGVLTLGLVI |
| Ga0126376_105787891 | 3300010359 | Tropical Forest Soil | MRLDLNLATRRYEDAGGFWGRRGLAGGVLALLSLA |
| Ga0137399_110307831 | 3300012203 | Vadose Zone Soil | MRLDINLATHPYEDAREFWARWGLGVGLLGVVTLILVSFAVHGWVKAGRDRQ |
| Ga0137360_118528041 | 3300012361 | Vadose Zone Soil | MRLDINLAAHPYEDAREFWARWGLGVGLLGVLTLVLIT |
| Ga0137373_108832031 | 3300012532 | Vadose Zone Soil | MRLDINLATRPYEDARKFWSRWGLGVGLLGLLTVILLGLVIRGWVNAGRDRHTIARLQEQ |
| Ga0137358_100622563 | 3300012582 | Vadose Zone Soil | MRLDINLATHPYEDAREFWARWGLGVGLLGVLTLVLITLAVHGWVKAGRDRPSI |
| Ga0137396_112436232 | 3300012918 | Vadose Zone Soil | MRLDINLATRPYEDAREFWVRWVVGVGLLGLLTVVLLGLAV |
| Ga0137359_115502791 | 3300012923 | Vadose Zone Soil | MRLDINLATHPYEDAREFWARWGLGVGLLGVLTLVLITLAVHGWVKAGRDRQ |
| Ga0137359_117736501 | 3300012923 | Vadose Zone Soil | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTLLL |
| Ga0137419_107472171 | 3300012925 | Vadose Zone Soil | MRLNINLATRPYEDAREFWSRWGIGVGVLAVITLALLTLTVHGWVKAGRDRQS |
| Ga0126369_127768071 | 3300012971 | Tropical Forest Soil | MRLDLNLATRPYEDAGEFWTRWGATVSVLALFTLALV |
| Ga0181524_102523062 | 3300014155 | Bog | MRLDINLATRPYEDAREFWVRWGLGVGLLVVLTLVLL |
| Ga0181538_100609101 | 3300014162 | Bog | MRLDINLATRPYEDAREFWSRWGLGVGLLSLLTLLLLVLAERGWTHAGRDRH |
| Ga0181534_102635571 | 3300014168 | Bog | MRLDINLATHPYEDAREFWARWGVGVGLLAVLTIGLIGLVINGW |
| Ga0181535_104623321 | 3300014199 | Bog | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTVLLLGWAVQGWTKAGRDRHDIA |
| Ga0182010_106196362 | 3300014490 | Fen | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTLVLLSW |
| Ga0182024_100194071 | 3300014501 | Permafrost | MRLDINLATRPYEDAREFWGRWGLGVGLLAVSTLLLIAFSVQS |
| Ga0182021_101759291 | 3300014502 | Fen | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLV |
| Ga0132257_1024753601 | 3300015373 | Arabidopsis Rhizosphere | MRLDINLATRPYEDARQFWIRWGSSLGVLGLATIILVFAALSG |
| Ga0182036_1000170611 | 3300016270 | Soil | MRLDINLATRPYEDSREFWTRWGLVLGAVSVLTLALLAT |
| Ga0182040_108407512 | 3300016387 | Soil | MRLDINLATRPYEDSREFWTRWGLVLGAVSVLTLALLAITITGWYNA |
| Ga0187802_104031461 | 3300017822 | Freshwater Sediment | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTVLLLVLAVRGWIHA |
| Ga0187818_100454451 | 3300017823 | Freshwater Sediment | MRVDINLATRPYEDAREFWTRWGLAVGVLVLLTLALITVAAHGW |
| Ga0187818_102327391 | 3300017823 | Freshwater Sediment | MRLDLNLATRPYEDAREFWLRWGIGVGVLGLLTLILLGLAIRG |
| Ga0187818_105328742 | 3300017823 | Freshwater Sediment | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTVLLLVLAVRG |
| Ga0187848_104529211 | 3300017935 | Peatland | MRLDINLATHPYEDAREFWARWGLGVGLLGLLTLLLLGLTVSDWRKAGKDRHDIAE |
| Ga0187850_101193822 | 3300017941 | Peatland | MRLDINLATRPYEDAREFWTRWGLAVGLLGLLTALLLALAVRGW |
| Ga0187879_105639082 | 3300017946 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLALLTVLLLVLAVQG |
| Ga0187879_107977462 | 3300017946 | Peatland | MRLDINLATHPYEDAREFWARWGLGVGLLGLLTLLLLGLTVSDWRKAGKDRHDIA |
| Ga0187777_108193791 | 3300017974 | Tropical Peatland | MRLDINLATHPYEDAREFWARWGAGVGLLALVTLLLVGWTVRSWMDAGR |
| Ga0187885_105348192 | 3300018025 | Peatland | MRLDINLATRPYEDARQFWLRWGLGIGALAALTVFLLLWTVSEWKH |
| Ga0187862_101869231 | 3300018040 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTVLLLVLAV |
| Ga0187871_106063541 | 3300018042 | Peatland | MRLDINLATRPYEDAREFWVRWGSAVGLLGVLTLVLLGWAVEGWTKAGR |
| Ga0187851_101765522 | 3300018046 | Peatland | MRLDLNLATHPYEDAREFWARWGSGIGVLALLTLVLIGWTVRSWSN |
| Ga0187851_105351772 | 3300018046 | Peatland | MRLDINLATRPYEDAREFWGRWGLGVGLLALFTLALLGWAASGWQNAGRDRQ |
| Ga0187859_100648783 | 3300018047 | Peatland | MRLDLNLATHPYEDAREFWARWGSGIGVLALLTLVLI |
| Ga0187772_106847131 | 3300018085 | Tropical Peatland | MRLNINLATHPYEDAREFWARWGTAVALLAVVSVALLGWTVRSWVAAGRDRHNI |
| Ga0187772_110680671 | 3300018085 | Tropical Peatland | MRLDINLATHPYEDAREFWTRWGLAVGLLAVCTLALLAWTVHSWVDAGRDRRNIAQLQQL |
| Ga0187769_109633671 | 3300018086 | Tropical Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTALLLVLAVRGWIH |
| Ga0187769_113022201 | 3300018086 | Tropical Peatland | MRLNINLATRPYEDAREFWSRWGVAVGLLAVVTVFLLGWTARNWMAAGHDRHDI |
| Ga0187770_114888412 | 3300018090 | Tropical Peatland | MRLDINLATRPYEDAGIFWARWGAGVGLLALATLLLVGWTVRSWTN |
| Ga0066669_103351711 | 3300018482 | Grasslands Soil | MRVDINLATRPYEDAKEFWARWGLGVGLLGLLTLVLIGLAVHGWVKAGRD |
| Ga0187852_14183721 | 3300019082 | Peatland | MRLDINLATRPYEDAREFWARWGLGVGLLAVLTLFLLG |
| Ga0184586_1033541 | 3300019194 | Soil | MRLDINLATRPYEDAREFWTRWGLGVGLLALLTVLLLGWTVKA |
| Ga0193713_10393771 | 3300019882 | Soil | MRLDINLATRRYEDAREFWSRWGIGVGVLGVLTLALLILTVHGWVKAGRD |
| Ga0210403_112385612 | 3300020580 | Soil | MRLDINLATRPYEDAREFWGRWGVGVGLLAACTLLLLGFAVQSWLFAGR |
| Ga0210406_102134751 | 3300021168 | Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTLVLLGLAVRGWTQAG |
| Ga0210406_105066231 | 3300021168 | Soil | MRLNINLATRPYEDAREFWSRWGLGVGALGVVTLILIGLAVQI |
| Ga0210409_114044241 | 3300021559 | Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTVVLL |
| Ga0126371_132388621 | 3300021560 | Tropical Forest Soil | MRLDINLATRPYEDQRKFWLRWGIPLFLLGLVTLVLLYSMV |
| Ga0213851_11235092 | 3300021860 | Watersheds | MRLDINLATRPYEDAREFWSRWGLGVGLLGLLTLVLVGFA |
| Ga0213853_108852212 | 3300021861 | Watersheds | MRLDINLATHPYEDAREFWTRWGAGIGVLALLTLLLIGWTVRSWSAAGRDRHNIASLQ |
| Ga0224549_10510401 | 3300022840 | Soil | MRLDINLATTPYEDAREFWVRWGTGVGALAVLTLVLLALAVEGWTKAGR |
| Ga0208935_10556971 | 3300025414 | Peatland | MRLDINLATRPYEDAREFWGRWGLGVGLLALFTLALLGWAASGWQNAGRDRQN |
| Ga0208034_10182185 | 3300025442 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGVLTLVL |
| Ga0208037_10093611 | 3300025448 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGVLTLLLLGLAVRGWTNAGRDR |
| Ga0208850_10661932 | 3300025457 | Arctic Peat Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTLALLAVAARGWTH |
| Ga0208688_10551792 | 3300025480 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGVLTLLLLGLAV |
| Ga0208686_10181271 | 3300025500 | Peatland | MRLDINLATRPYEDAREFWTRWGLGVGLLGLLTVLLLVLAVQGWIHAGRDRHEIAQ |
| Ga0209236_12588912 | 3300026298 | Grasslands Soil | MRLDINLATHPYEDAREFWARWGLGVGLLGVLTLVLITLAVHGWVKA |
| Ga0257170_10494091 | 3300026351 | Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGVVTLVLLTLAVHGWVKAGRDRQT |
| Ga0257159_10914281 | 3300026494 | Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTLVLLG |
| Ga0209056_107317341 | 3300026538 | Soil | MRLNINLATRPYEDAREFWSRWGLGVGALGLVTLVLLTLAVHGWVKAGRDRQTILGLERQ |
| Ga0209733_10945051 | 3300027591 | Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGLLALSTLLLLGFAVRSWILA |
| Ga0209733_11740691 | 3300027591 | Forest Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGLLTLVLLGLAVRGWTNAGRDRHNIAQ |
| Ga0208044_10290563 | 3300027625 | Peatlands Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLFLLGWAVQGWTKAGRDRHDI |
| Ga0209422_10099383 | 3300027629 | Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGLLALSTLLLLGFAV |
| Ga0209625_11149872 | 3300027635 | Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGVLAVATLVL |
| Ga0208990_10189013 | 3300027663 | Forest Soil | MRLDINLATRRYEDAREFWTRWGLGVGLLGLLTLVLLGLAV |
| Ga0209009_11536712 | 3300027667 | Forest Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLALLGLAV |
| Ga0209655_101996981 | 3300027767 | Bog Forest Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTLFLLGWTIHSWQNAGRDRQNIAQL |
| Ga0209772_100410371 | 3300027768 | Bog Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGLLALFTLALLGWAASG |
| Ga0209656_103803072 | 3300027812 | Bog Forest Soil | MRLDINLATRPYEDAREFWARWGLGVGLLALLTVVLMALAVRGWIHAGRDRQTITRL |
| Ga0209773_102047971 | 3300027829 | Bog Forest Soil | MRLDINLATRPYEDAREFWLRWGLVVGVLGALTLALLVFAVRGWTEAGRDR |
| Ga0209067_106195722 | 3300027898 | Watersheds | MRLDINLATRPYEDAREFWSRWGVGVGVLGLLTLILLG |
| Ga0302234_103132181 | 3300028773 | Palsa | MRLDINLATRPYEDAREFWARWGLGVGLLAILTLFLIGLAVN |
| Ga0302266_101030252 | 3300028779 | Bog | MRLDINLATHPYEDAREFWARWGLGVGLLALLTIGL |
| Ga0265338_106992701 | 3300028800 | Rhizosphere | MRLDINLATRPYEDAREFWLRWGSGVGLLAVLTLVLLGLT |
| Ga0302200_100151621 | 3300028909 | Bog | MRLDINLATHPYEDAREFWARWGLGVGLLALLTIGLLA |
| Ga0311326_100233874 | 3300029917 | Bog | MRLDINLATRPYEDAREFWSRWGLGVGLLAVLTLVLLG |
| Ga0311343_108396762 | 3300029953 | Bog | MRLDINLATRPYEDAREFWARWGLGVGALAVLTLFLLG |
| Ga0311336_105040512 | 3300029990 | Fen | MRLDINLATRPYEDAAEFWARWGLGVGVLALATLLLLGW |
| Ga0302210_100404923 | 3300029995 | Fen | MRLDINLATRPYEDAAEFWARWGLGVGVLALATLLLL |
| Ga0311344_106534141 | 3300030020 | Bog | MRLDINLATRPYEDAREFWARWGLGVGALAVLTLFLL |
| Ga0302274_104168952 | 3300030041 | Bog | MRLDINLATRPYEDAREFWARWGLGVGALAVLTLFLLGLTV |
| Ga0302179_103210842 | 3300030058 | Palsa | MRLDINLATRPYEDAREFWVRWGLGVALLALLTLGLLGLAVKGWTKA |
| Ga0311370_113656862 | 3300030503 | Palsa | MRLDINLATRPYEDARKFWGRWGLGVGLVGILTLLLLSFTVNEWRNAGKDR |
| Ga0311354_119520151 | 3300030618 | Palsa | MRLDINLATRPYEDAREFWVRWGSGVGLLAVLTLLLLG |
| Ga0311366_112259692 | 3300030943 | Fen | MRLDINLATRPYEDAREFWARWGLGVGLLGVLTLVLLGLAVRGWIKAGRDRHNI |
| Ga0170824_1042775161 | 3300031231 | Forest Soil | MRLDINLATRPYEDAREFWGRWGLGVGLLAVLTIGLLGMTVRGWINA |
| Ga0302326_134973772 | 3300031525 | Palsa | MRLNINLATSPYEDAREFWVRWGSAVAVLALITVALLGWTTRS |
| Ga0310686_1083606591 | 3300031708 | Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGMLTLFLLVMAVR |
| Ga0265314_101221001 | 3300031711 | Rhizosphere | MRLDINLATRPYEDAREFWSRWGVGVGALGVLTLVLLGWAITGWTNAGRD |
| Ga0307468_1001311061 | 3300031740 | Hardwood Forest Soil | MRLDINLATRPYEDAREFWARWGLGVGLLGVVTLLLLGLAVRGWTHAG |
| Ga0318529_104324522 | 3300031792 | Soil | MRLDINLATRPYEDSREFWTRWGLVLGAVSVLTLALLAITITGWY |
| Ga0318559_101067601 | 3300032039 | Soil | MRLDINLATRPYEDSREFWTRWGLVLGAVSVLTLALLAITITGWYN |
| Ga0335077_109074142 | 3300033158 | Soil | MRLNINLATHPYEDAREFWVKWGSAVGVLALLTLALLGWTVRGWINAG |
| Ga0326727_103567182 | 3300033405 | Peat Soil | MRLDINLATRPYEDAREFWVRWGLGVGLLGVLTLVLLSWTVRGWT |
| Ga0326727_105731921 | 3300033405 | Peat Soil | MRLDINLATIPYEDAREFWLRWGLGVGLLGVVTLVLLGWAVRGWTNAGRDRH |
| Ga0326726_106276961 | 3300033433 | Peat Soil | MRLDLNLATRPYEDAREFWLRWGIGVGLLGLLTLILLGLSIRGWVNAGRD |
| Ga0314862_0005492_2_124 | 3300033803 | Peatland | MRLDINLATRPYEDAGEFWMRWGTAVGLLLVLTLTLLGWTT |
| Ga0334790_210193_3_173 | 3300033887 | Soil | MRLDINLATHPYEDAREFWARWGLGVGLLAALTLFLLGLAVNDWRNAGRDRREIARL |
| ⦗Top⦘ |