Metagenome Family F065358

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F065358
Family Type	Metagenome
Number of Sequences	127
Average Sequence Length	44 residues
Representative Sequence	MIPNPGYQGTQNFNPQMGQQLQRNPNSNADELLLRVTEMMKN
Number of Associated Samples	62
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.64 %
% of genes near scaffold ends (potentially truncated)	48.03 %
% of genes from short scaffolds (< 2000 bps)	96.06 %
Associated GOLD sequencing projects	62
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (85.039 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.063 % of family members)
Environment Ontology (ENVO)	Unclassified (96.850 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (96.850 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF03732	Retrotrans_gag	5.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
All Organisms	root	All Organisms	14.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
cellular organisms	root	All Organisms → cellular organisms	14.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	14.17 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	14.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	14.17 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	14.17 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	14.17 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	14.17 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	14.17 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	7.09 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	7.09 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	7.09 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	7.09 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	7.09 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.04 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	2.36 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005840\|Ga0068870_10702827	Not Available	698	Open in IMG/M
3300009176\|Ga0105242_12527123	Not Available	562	Open in IMG/M
3300013297\|Ga0157378_12311330	Not Available	589	Open in IMG/M
3300014745\|Ga0157377_11762256	Not Available	502	Open in IMG/M
3300015267\|Ga0182122_1021607	Not Available	701	Open in IMG/M
3300015268\|Ga0182154_1032077	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	635	Open in IMG/M
3300015268\|Ga0182154_1036119	Not Available	615	Open in IMG/M
3300015268\|Ga0182154_1054287	Not Available	549	Open in IMG/M
3300015269\|Ga0182113_1031088	Not Available	708	Open in IMG/M
3300015269\|Ga0182113_1038403	Not Available	665	Open in IMG/M
3300015269\|Ga0182113_1088967	Not Available	517	Open in IMG/M
3300015274\|Ga0182188_1046020	Not Available	546	Open in IMG/M
3300015275\|Ga0182172_1027086	Not Available	676	Open in IMG/M
3300015276\|Ga0182170_1016464	Not Available	774	Open in IMG/M
3300015276\|Ga0182170_1028403	Not Available	670	Open in IMG/M
3300015276\|Ga0182170_1034644	Not Available	635	Open in IMG/M
3300015276\|Ga0182170_1072300	Not Available	513	Open in IMG/M
3300015279\|Ga0182174_1014208	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	834	Open in IMG/M
3300015279\|Ga0182174_1068168	Not Available	540	Open in IMG/M
3300015283\|Ga0182156_1033714	Not Available	665	Open in IMG/M
3300015283\|Ga0182156_1080706	Not Available	516	Open in IMG/M
3300015285\|Ga0182186_1033594	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	655	Open in IMG/M
3300015286\|Ga0182176_1034451	Not Available	669	Open in IMG/M
3300015286\|Ga0182176_1075212	Not Available	524	Open in IMG/M
3300015287\|Ga0182171_1024690	Not Available	724	Open in IMG/M
3300015287\|Ga0182171_1032591	Not Available	672	Open in IMG/M
3300015287\|Ga0182171_1088121	Not Available	502	Open in IMG/M
3300015289\|Ga0182138_1037670	Not Available	647	Open in IMG/M
3300015291\|Ga0182125_1007980	Not Available	1009	Open in IMG/M
3300015291\|Ga0182125_1054227	Not Available	595	Open in IMG/M
3300015291\|Ga0182125_1055194	Not Available	592	Open in IMG/M
3300015291\|Ga0182125_1079479	Not Available	530	Open in IMG/M
3300015292\|Ga0182141_1046375	Not Available	620	Open in IMG/M
3300015294\|Ga0182126_1047342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	621	Open in IMG/M
3300015295\|Ga0182175_1096382	Not Available	505	Open in IMG/M
3300015296\|Ga0182157_1037533	Not Available	680	Open in IMG/M
3300015296\|Ga0182157_1084274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	536	Open in IMG/M
3300015299\|Ga0182107_1053289	Not Available	618	Open in IMG/M
3300015299\|Ga0182107_1070221	Not Available	569	Open in IMG/M
3300015299\|Ga0182107_1100650	Not Available	508	Open in IMG/M
3300015300\|Ga0182108_1026361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	762	Open in IMG/M
3300015300\|Ga0182108_1043224	Not Available	662	Open in IMG/M
3300015300\|Ga0182108_1084545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	541	Open in IMG/M
3300015302\|Ga0182143_1065335	Not Available	581	Open in IMG/M
3300015302\|Ga0182143_1096935	Not Available	514	Open in IMG/M
3300015303\|Ga0182123_1068901	Not Available	560	Open in IMG/M
3300015303\|Ga0182123_1094553	Not Available	509	Open in IMG/M
3300015303\|Ga0182123_1096755	Not Available	506	Open in IMG/M
3300015304\|Ga0182112_1036256	Not Available	691	Open in IMG/M
3300015304\|Ga0182112_1066285	Not Available	581	Open in IMG/M
3300015304\|Ga0182112_1093684	Not Available	522	Open in IMG/M
3300015305\|Ga0182158_1058925	Not Available	599	Open in IMG/M
3300015307\|Ga0182144_1054346	Not Available	621	Open in IMG/M
3300015307\|Ga0182144_1075043	Not Available	564	Open in IMG/M
3300015308\|Ga0182142_1021373	Not Available	828	Open in IMG/M
3300015308\|Ga0182142_1087684	Not Available	548	Open in IMG/M
3300015308\|Ga0182142_1112596	Not Available	506	Open in IMG/M
3300015314\|Ga0182140_1007000	Not Available	1128	Open in IMG/M
3300015322\|Ga0182110_1056663	Not Available	643	Open in IMG/M
3300015322\|Ga0182110_1070222	Not Available	603	Open in IMG/M
3300015322\|Ga0182110_1083358	Not Available	572	Open in IMG/M
3300015322\|Ga0182110_1094724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	549	Open in IMG/M
3300015323\|Ga0182129_1085474	Not Available	553	Open in IMG/M
3300015323\|Ga0182129_1104778	Not Available	519	Open in IMG/M
3300015341\|Ga0182187_1195868	Not Available	506	Open in IMG/M
3300015341\|Ga0182187_1196174	Not Available	506	Open in IMG/M
3300015344\|Ga0182189_1149169	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	593	Open in IMG/M
3300015344\|Ga0182189_1161024	Not Available	576	Open in IMG/M
3300015344\|Ga0182189_1168751	Not Available	565	Open in IMG/M
3300015345\|Ga0182111_1187496	Not Available	558	Open in IMG/M
3300015345\|Ga0182111_1210505	Not Available	533	Open in IMG/M
3300015346\|Ga0182139_1207572	Not Available	537	Open in IMG/M
3300015347\|Ga0182177_1210742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	536	Open in IMG/M
3300015351\|Ga0182161_1050987	Not Available	953	Open in IMG/M
3300015351\|Ga0182161_1079695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	808	Open in IMG/M
3300015351\|Ga0182161_1104605	Not Available	728	Open in IMG/M
3300015351\|Ga0182161_1169109	Not Available	605	Open in IMG/M
3300015351\|Ga0182161_1220687	Not Available	543	Open in IMG/M
3300015355\|Ga0182159_1181903	Not Available	669	Open in IMG/M
3300015355\|Ga0182159_1290161	Not Available	546	Open in IMG/M
3300015355\|Ga0182159_1337729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	511	Open in IMG/M
3300015361\|Ga0182145_1116800	Not Available	597	Open in IMG/M
3300017404\|Ga0182203_1085340	Not Available	623	Open in IMG/M
3300017407\|Ga0182220_1017601	Not Available	825	Open in IMG/M
3300017409\|Ga0182204_1115514	Not Available	508	Open in IMG/M
3300017410\|Ga0182207_1024637	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	949	Open in IMG/M
3300017410\|Ga0182207_1076489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	666	Open in IMG/M
3300017410\|Ga0182207_1100661	Not Available	609	Open in IMG/M
3300017410\|Ga0182207_1117754	Not Available	578	Open in IMG/M
3300017410\|Ga0182207_1118069	Not Available	577	Open in IMG/M
3300017410\|Ga0182207_1119662	Not Available	575	Open in IMG/M
3300017410\|Ga0182207_1129050	Not Available	560	Open in IMG/M
3300017411\|Ga0182208_1092432	Not Available	560	Open in IMG/M
3300017411\|Ga0182208_1127190	Not Available	505	Open in IMG/M
3300017413\|Ga0182222_1030157	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	700	Open in IMG/M
3300017413\|Ga0182222_1049081	Not Available	618	Open in IMG/M
3300017415\|Ga0182202_1081137	Not Available	599	Open in IMG/M
3300017415\|Ga0182202_1122590	Not Available	524	Open in IMG/M
3300017415\|Ga0182202_1126337	Not Available	519	Open in IMG/M
3300017415\|Ga0182202_1131082	Not Available	512	Open in IMG/M
3300017417\|Ga0182230_1102962	Not Available	529	Open in IMG/M
3300017420\|Ga0182228_1085833	Not Available	583	Open in IMG/M
3300017425\|Ga0182224_1039511	Not Available	787	Open in IMG/M
3300017427\|Ga0182190_1139792	Not Available	532	Open in IMG/M
3300017430\|Ga0182192_1143968	Not Available	536	Open in IMG/M
3300017433\|Ga0182206_1047847	Not Available	736	Open in IMG/M
3300017433\|Ga0182206_1058712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	691	Open in IMG/M
3300017433\|Ga0182206_1076568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	636	Open in IMG/M
3300017433\|Ga0182206_1077260	Not Available	634	Open in IMG/M
3300017436\|Ga0182209_1120415	Not Available	567	Open in IMG/M
3300017442\|Ga0182221_1150139	Not Available	523	Open in IMG/M
3300017443\|Ga0182193_1046564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	815	Open in IMG/M
3300017680\|Ga0182233_1087445	Not Available	569	Open in IMG/M
3300017683\|Ga0182218_1113813	Not Available	553	Open in IMG/M
3300017683\|Ga0182218_1133897	Not Available	525	Open in IMG/M
3300017685\|Ga0182227_1085728	Not Available	598	Open in IMG/M
3300017689\|Ga0182231_1114469	Not Available	525	Open in IMG/M
3300017690\|Ga0182223_1022751	Not Available	797	Open in IMG/M
3300017690\|Ga0182223_1058967	Not Available	619	Open in IMG/M
3300017690\|Ga0182223_1100632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	534	Open in IMG/M
3300017690\|Ga0182223_1114411	Not Available	515	Open in IMG/M
3300021060\|Ga0182232_1082861	Not Available	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.06%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.79%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068870_107028271	3300005840	Miscanthus Rhizosphere	NPGYQGTWDFNPQMGQQVQRNPNSNADELLLRVIEMMKN*
Ga0105242_125271231	3300009176	Miscanthus Rhizosphere	MMPNLGYQGTRDFNPQMGQQVQRNPNPQADELLLKVIEMMKN*
Ga0157378_123113301	3300013297	Miscanthus Rhizosphere	MIPNLGYQGTGNFNSQMGEYLQRNPDSNADELLLRVTEMMKNQFG
Ga0157377_117622561	3300014745	Miscanthus Rhizosphere	MISNPGYQGTQNFNLQMGQQLPRNRNSNADELLLKVTEIMKN*
Ga0182122_10216071	3300015267	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQGNLGSSADELLLRVTEIMKS*
Ga0182154_10320771	3300015268	Miscanthus Phyllosphere	MIPNPGYRGTQNFNPQMGQQLQRNPNSNADELLLRVTEMMKN*
Ga0182154_10361192	3300015268	Miscanthus Phyllosphere	MILNPEYQGTQNFNPQMGQKLPRNSNSNADELLLRVTEMMKNQFGLKPKG*
Ga0182154_10542872	3300015268	Miscanthus Phyllosphere	MIPNLGYQGTRNFNLQMGQRLQRNPDSTADELLLRV
Ga0182113_10310881	3300015269	Miscanthus Phyllosphere	MIPNPRYQGTQNFNPQMGQQLQRNPDSNADELLLGVTEM
Ga0182113_10384032	3300015269	Miscanthus Phyllosphere	MIPNPGYQDTRDFNPQMGQQLQRNPNSNADELLLRVTEMMKNQFGLKMKE*
Ga0182113_10889671	3300015269	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPRMGQQLQRNPDSSADELLLRVTEMM
Ga0182188_10460201	3300015274	Miscanthus Phyllosphere	MMPNPGYQGTRDFNPQMGQQVQRNPNLQADELLLRVTEMMKN*
Ga0182172_10270862	3300015275	Miscanthus Phyllosphere	MTPNPGYQGTPNFNPQMGQQLSRNSNSNADELLLRVVSAIK
Ga0182172_10442611	3300015275	Miscanthus Phyllosphere	RYQGIQNFNPQMGQQLLQNPNSNADELLLKVTEMMKNQFSLKPKGQTFSYK*
Ga0182170_10164641	3300015276	Miscanthus Phyllosphere	MIPNPGYQATHNFNLQMGQQLPRNPNSNADELLLRVTKIIKN*
Ga0182170_10284032	3300015276	Miscanthus Phyllosphere	MIPNPGYQGIQNFNPQMGQQLQRNLNSNADELLLRV
Ga0182170_10346441	3300015276	Miscanthus Phyllosphere	MIPNPEYQDTRNFNPQMGQQLQRNPNSNADELLLRVIEMMKN*
Ga0182170_10723002	3300015276	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPQMGQQLPRNLNSNTNELLLRVTKIMKNQFGLK
Ga0182174_10142081	3300015279	Miscanthus Phyllosphere	MIPNSVYQGTQNLNLQMGEQLPRNPNSNADELLLRVTEMMKNQFGLKPKG*
Ga0182174_10681681	3300015279	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGQQLPRNSNSNADELLLRVTEMMKN*
Ga0182156_10337141	3300015283	Miscanthus Phyllosphere	MIPNLGYQGTQNFNLQMGQQLPRNRNSNADELLLKVTEIMKN*
Ga0182156_10807061	3300015283	Miscanthus Phyllosphere	MIPNLGYQGTRNFNPQMGQQVQRNPNPQADELLLKVTEMMKNQFG*
Ga0182186_10335941	3300015285	Miscanthus Phyllosphere	MILNPGYQGTQNFNPQMGQQLPRNPNSNIDELLFRVTKMMKNQFRLKPKG*
Ga0182176_10344511	3300015286	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPDSNTDELLLRETEMMKN*
Ga0182176_10752122	3300015286	Miscanthus Phyllosphere	MMPNPGYQSSQDFNPPMGQQVQRNPNPQADELLLRVTEMMKN*
Ga0182171_10246901	3300015287	Miscanthus Phyllosphere	MILNPVYQGTRDFNPQMGQQVQRNSNSNADELLLKVTEMMKNQF
Ga0182171_10325912	3300015287	Miscanthus Phyllosphere	MIPNLGYEGTQNFNPQMGQQLQRNLNSNADELLLRVTKMVKNQFGLKPKG*
Ga0182171_10881211	3300015287	Miscanthus Phyllosphere	LNPGYQGTRDFNPQIGQQVPRNPNLQDDELLLKVTEMMKN*
Ga0182138_10376702	3300015289	Miscanthus Phyllosphere	MISNPGYQGTWNFNPQMGQQVQRNPNSNADELLLRVTEMMKNQFGLKPKGQ
Ga0182125_10079802	3300015291	Miscanthus Phyllosphere	MIRNPVYQGTQNFNPQMGQQLQRNPNSNADELLLRVTKMMKNQFGLKPKG*
Ga0182125_10542271	3300015291	Miscanthus Phyllosphere	MIPNPRYEGTQNFNPQMGQQLQSNPNSNADELLLRLTKMMKN*
Ga0182125_10551942	3300015291	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGQQLPRNSNSNVDELLLKVT
Ga0182125_10794792	3300015291	Miscanthus Phyllosphere	MILNPGYQGTQNFNLQMGQQLPRNLNSNADELLLRVTEMMKN*
Ga0182141_10463752	3300015292	Miscanthus Phyllosphere	MIPNPRYQGTRDFHPQMGQQVQRNQNPQAGELLLRVTEMMKNQFGLKPK
Ga0182126_10473421	3300015294	Miscanthus Phyllosphere	LNPGYQGIRNFNPQMGQQLLRNLNSNTDELLLRVTEMMKNQFSLKPKG*
Ga0182175_10963821	3300015295	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPQMGQQLLRNPNSNADELLLKITEMMKN*
Ga0182157_10375331	3300015296	Miscanthus Phyllosphere	MIPNLGYQDTQNFNLQMGQQLPRNPNSNADELLLRVTEMMKN*
Ga0182157_10842742	3300015296	Miscanthus Phyllosphere	MIPNLGYQGTWDFNPQMGQQVPRNLNPQADELLLKVTEMMKN*
Ga0182107_10532891	3300015299	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPQMGQQLWRNPNSNTDELLFRVTEMMNNQFG
Ga0182107_10702211	3300015299	Miscanthus Phyllosphere	MIPNPGYQGTRNFNPQMGQQLQRNPDSNADELLLRVTEMMKNQFGLKPKG*
Ga0182107_11006501	3300015299	Miscanthus Phyllosphere	MILNPGYQGTRDFNPQMGQQVQRNSKPQADELLLKVTEMM
Ga0182108_10263611	3300015300	Miscanthus Phyllosphere	MIPNPGYQDTWDFNPQMGQQVQRNPNLQADELLLRVTEMMKN*
Ga0182108_10432241	3300015300	Miscanthus Phyllosphere	MIPNLGYQGTRNFNLQMGQQLQRNLDSSADELLLKVTEMMKN*
Ga0182108_10845452	3300015300	Miscanthus Phyllosphere	MIPNPRYQGTQNFNLQMGQQLPRNSNSNADELLLRVTKMMKN*
Ga0182143_10373402	3300015302	Miscanthus Phyllosphere	MISNLGYQGTWDFNPQMGQQVQRNLNPNADDLLLRVTEMMKNQFGLKPKG*
Ga0182143_10653351	3300015302	Miscanthus Phyllosphere	MILNPGYQGTQNFNLQMGHQLPRNPNSNIDELLLRVTEMMKN*
Ga0182143_10888801	3300015302	Miscanthus Phyllosphere	MIPNMGYQGTRNFNPQMGQQLQRDSNANSNADELLLRVIEMLKNQFGLKPKG*
Ga0182143_10969351	3300015302	Miscanthus Phyllosphere	MIPNLGYEGTQNFNPQMGQQLQRNPNSNVDELLLRVIEMMNNQFSLKSKG*
Ga0182123_10689011	3300015303	Miscanthus Phyllosphere	PNPGYQGTQNFNPQMGQPLQRNPNLNADELLLRVTEMMRN*
Ga0182123_10945531	3300015303	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMDQQLQRNLNSNADELLLR
Ga0182123_10967551	3300015303	Miscanthus Phyllosphere	MILNLGYQGTQNFNLQMGQQLPRNSNSNANELLLRVTEKMKNKFSLKPKG*
Ga0182112_10362561	3300015304	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQVQRDPNSNADDLLLRVTEMIKNQFS*
Ga0182112_10662851	3300015304	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPNSNVDELLLRAAE
Ga0182112_10936842	3300015304	Miscanthus Phyllosphere	MIPNPGYQGIQNFNLQMRQQLPRNSNLNADELLLRVTE
Ga0182158_10589251	3300015305	Miscanthus Phyllosphere	MIPNPGYQGTHNLNLHMGQQLLGNSNSNADELLFRVTEMMKN*
Ga0182144_10543461	3300015307	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLPRNPNSNADELLLRVTEMMKNQFGLKPKG*
Ga0182144_10750432	3300015307	Miscanthus Phyllosphere	MISNPRYQGTQNFNPRTGQQLQRNPNSNADELLLRVTEMMKNQF
Ga0182142_10213731	3300015308	Miscanthus Phyllosphere	MDYNTLHMMPNPGYQDTRDFNPQMSQQVQRNPNSNADELLLRVTEMMKN*
Ga0182142_10876841	3300015308	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGQQLPRNPNSNADELLLRVTEMMKNQFGLKPKG*
Ga0182142_11125961	3300015308	Miscanthus Phyllosphere	MITNLGYQVTQNFNLHMGEQLPRNPNSNVDELLLRVTEMMKN
Ga0182140_10070002	3300015314	Miscanthus Phyllosphere	MIPNLGYQGTQNFNVQMGQQLLGNPNLNADELMLRVIEM
Ga0182110_10566632	3300015322	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPNSNVDDLLLRVTEMMKN*
Ga0182110_10702221	3300015322	Miscanthus Phyllosphere	MIPNSGYQGTQNFNLQMGQQLPRNSNSNADELLLRVTEMMKNKFGLKPKG*
Ga0182110_10833582	3300015322	Miscanthus Phyllosphere	MMPNPGYQGTRDFNAQMGQQAQRNPKSNADELLLRVTKM
Ga0182110_10947242	3300015322	Miscanthus Phyllosphere	NLGYQGTWDFNPQMGQQVPRNPNPQANELLLKVTEMMKN*
Ga0182129_10854741	3300015323	Miscanthus Phyllosphere	MIPNPGYQGTHDFNPQMGQQVQRNPNSNADELLLRVTEM
Ga0182129_11047781	3300015323	Miscanthus Phyllosphere	YNTLYMIPNLGYHGTQNFNPQMGQQLQRNPNSNADELFLRITEMMKN*
Ga0182187_11958682	3300015341	Miscanthus Phyllosphere	VIPNPGYQGTQNFNLQMGQQLPRNPNSKDHELLLIVTNMIK
Ga0182187_11961741	3300015341	Miscanthus Phyllosphere	YNTLNMIPNLGYQGTQNFNLQMGQQLPRNSNSNADELLLRVIEMMKN*
Ga0182189_11491691	3300015344	Miscanthus Phyllosphere	IPNLGYQGTQNFNPQMGQQLQRNLNSNLDELLLRVTKMMKN*
Ga0182189_11610241	3300015344	Miscanthus Phyllosphere	MISNPGYQGTHNFNLQMGQQLPRNSNSNVDELLLRVT
Ga0182189_11687511	3300015344	Miscanthus Phyllosphere	MIPNPGYQGTQNFNMQMGQQLPRNSNSNADELLLRVTKMMKN*
Ga0182111_11874961	3300015345	Miscanthus Phyllosphere	MIPNPRYQGTQNFNPQMGHQLQRNSNSNADELLLRVT
Ga0182111_12105051	3300015345	Miscanthus Phyllosphere	MISNPVYQGTQNFNPQMGQQLQGNPISNADELLLRVTKMIKN*
Ga0182139_12075722	3300015346	Miscanthus Phyllosphere	MIPNPRYQGTGNFNPQMGQQLQRNPDSSADELLLRVTEMMKNQFGLKPKG
Ga0182177_12107421	3300015347	Miscanthus Phyllosphere	MMPNPGYQGTRDFNPQMGQQVQRNPNPQADELLLKVTEMMKN*
Ga0182161_10509871	3300015351	Miscanthus Phyllosphere	LHMIPNLGYQGTQNFNPQMGQQLPRNINSNADELLLRVTEIMKN*
Ga0182161_10796951	3300015351	Miscanthus Phyllosphere	LHMILHPGYRGTQNFNPQMGQQLQRNPNSNTDELLLRVTKMMKNQFGLKPKE*
Ga0182161_11046051	3300015351	Miscanthus Phyllosphere	MIPNPVYQGTQNFNLQMGQQLPRNSNSNADELLLRVTEMMKN*
Ga0182161_11691091	3300015351	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGQQLPRNPNSNADELLLRVTEMMKK*
Ga0182161_12206872	3300015351	Miscanthus Phyllosphere	MIPNPGYQGTWDFNPQMGQQVPRNPNPQADELLLKVTEMM
Ga0182159_11819031	3300015355	Miscanthus Phyllosphere	MIPHPRYQGTQNFNLQMGQQLPRNPNSNADELLLRVTEMMKK*
Ga0182159_12901611	3300015355	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPQIGQQLQRNSNSNADELLLRVTEMMKN*
Ga0182159_13377291	3300015355	Miscanthus Phyllosphere	MISNPGHQGTQNFNRQMGQQLQENPNLNADELLLRVTEMMKN*
Ga0182145_11168001	3300015361	Miscanthus Phyllosphere	MIPNPGYQGTRDFNPHMGQQVQRNPNSNADELLLRVNEMMKN*
Ga0182203_10853402	3300017404	Miscanthus Phyllosphere	MILNLGYQGTRDFNPQMGQQVQSNPNSKADELLLMVTEMMKN
Ga0182203_11497591	3300017404	Miscanthus Phyllosphere	MISNTGYQGTQNFNLQMDQQLSRNPNSNADELLPRVTEMMKN
Ga0182220_10176011	3300017407	Miscanthus Phyllosphere	MIPNPGYQGTRNFNPQMGQQVRRNLNSNADELLLRVTE
Ga0182204_11155141	3300017409	Miscanthus Phyllosphere	MPNLGYQGTQNFNPQMGQQLQRNPDSSTDELLLRVTEMMKNQF
Ga0182207_10246372	3300017410	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGWQLPRNSNSNADELLLRVTEMIKNQLV
Ga0182207_10764892	3300017410	Miscanthus Phyllosphere	MISNPGYQGTWDFNPQMGQQVQRTPNSNADELLLRVSEMMKH
Ga0182207_11006611	3300017410	Miscanthus Phyllosphere	MIPNLGYQGTRNFNLQMGQQLQRNLDSSADELLLKVTEMM
Ga0182207_11177541	3300017410	Miscanthus Phyllosphere	MIPNLGYQGTQNFNPQMGQQLPRNQNSNADEWLLRVTKMMKN
Ga0182207_11180691	3300017410	Miscanthus Phyllosphere	MIPNPGYQGTRNFNPQMGQQLQRNPDLNADVLLLRVTEMMKNQFGLKPKG
Ga0182207_11196622	3300017410	Miscanthus Phyllosphere	MPNLGYQGTRVFNPQMGQQVQRNPNLQADELLLRVTEMM
Ga0182207_11290501	3300017410	Miscanthus Phyllosphere	MIPNPRYQGTRNFNPEMGQQLQRDSNSNTDELLLRVTE
Ga0182207_11358851	3300017410	Miscanthus Phyllosphere	MILNLGYQGTRDFNPQMGQQVQGNPNSHADELLLKVTEMMKNQFGLKPKGL
Ga0182208_10924321	3300017411	Miscanthus Phyllosphere	LHMILNLGYQVTWDFNPQMGQQVRRNPNSNANELLLRVTEMMKN
Ga0182208_11271901	3300017411	Miscanthus Phyllosphere	GYQGTKNFNLQMGQQLPRNSNSNDDELLLRVAEMMKISLV
Ga0182222_10301572	3300017413	Miscanthus Phyllosphere	MITNSGYQGTLNFNPQKGQQLPRNSNSNADELLLRVTEMMKNKFGLKPKG
Ga0182222_10490811	3300017413	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMDQQLQRNPYSNANELLLIVTEMMKNQ
Ga0182202_10811371	3300017415	Miscanthus Phyllosphere	MIPNPGYHGTQDFNPQMGQQAQRNPSSHADELLLKVTE
Ga0182202_11225901	3300017415	Miscanthus Phyllosphere	MIPNLGYQGTRNFNPQMGQQLQRNPDSNADELLPRVTEMMKN
Ga0182202_11263371	3300017415	Miscanthus Phyllosphere	YQGTRDFNPQMGHQVQRNPNPQANELRLRVTEMMKN
Ga0182202_11310821	3300017415	Miscanthus Phyllosphere	MIPNPGYQGIRNFNPQMGQQLQRNPDSSANELLLRVTEMIKNQFGLKPKG
Ga0182230_11029622	3300017417	Miscanthus Phyllosphere	MLPNPGNQGTQNFNPRMGQQLQRNLDSNADELLLRVTEMMKNQFGLKPKE
Ga0182228_10858331	3300017420	Miscanthus Phyllosphere	MIPNPGYQGTLNFNPQMGQQLQMNLDSSADELLLRVTEMMKN
Ga0182224_10395112	3300017425	Miscanthus Phyllosphere	MIPNPRYQGTQNFNLQMGQQLPRNSNSNADELLLRVTEMMKNKFGLKPKG
Ga0182190_11397921	3300017427	Miscanthus Phyllosphere	MIPNLGYEGTHNFNLQMGQQLPRNSNSNTDGLLLRVTKMMKN
Ga0182192_11439682	3300017430	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPRMGQQLQRNPNSNADELLLRVTEMMKN
Ga0182206_10478472	3300017433	Miscanthus Phyllosphere	GSDHNTLNMIPNPGCQGTQNFNLQMGQQLPRNPNSNADELLLRVTEMMKNQFGLKPKG
Ga0182206_10587121	3300017433	Miscanthus Phyllosphere	QGTXNFNTQMGQQLQRNPDSNADELLLRVTEMMKNQFGLKLKG
Ga0182206_10765681	3300017433	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPNSNADELLLRVTEMMKN
Ga0182206_10772601	3300017433	Miscanthus Phyllosphere	MPNPGYQGTRDFNPQIGQQVSRNPNSQADELLLKVTEMMKNQFGL
Ga0182209_11204151	3300017436	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPDSNADELLLKVTEMMKN
Ga0182221_11501391	3300017442	Miscanthus Phyllosphere	MIPNLGYQSTQNFNLQMGQQLPRNSNSNDDELLLRVTKMMKNQFWF
Ga0182193_10465641	3300017443	Miscanthus Phyllosphere	MDYNTLHMMPNPGYQGTRDFNPQMGQQVPRNPNSQADELLLKVTEMMKN
Ga0182233_10874451	3300017680	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPNXNAYELFLRVTEM
Ga0182218_11138131	3300017683	Miscanthus Phyllosphere	YQGTQNFNPQMGQQLLRNSNSNADELLLRVTKMMKNQFGLKPKG
Ga0182218_11338971	3300017683	Miscanthus Phyllosphere	NIIPNLGYQSTHNFNLQIGQQLPRNSNSNANELLLRVTKMIKN
Ga0182227_10857281	3300017685	Miscanthus Phyllosphere	ILNLGYQGTQNFNPQMGQQRNPDSNADELLLRVTEVMKN
Ga0182231_11144692	3300017689	Miscanthus Phyllosphere	MIPNPGYQGTWDFNPQMGQQIPRNPNPQANELLLK
Ga0182223_10227512	3300017690	Miscanthus Phyllosphere	MIPNPGYQGTQNFNLQMGQQLPRNPNSNADELLLRVTKMMKN
Ga0182223_10589672	3300017690	Miscanthus Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQRNPNSNADELLLRVTEMMKNQFGLKPKGQT
Ga0182223_11006322	3300017690	Miscanthus Phyllosphere	MIPNPGYQGTRNFNPQMGEQLQRNPDSSADELLLRVTEMIKNQFGLKPKG
Ga0182223_11144112	3300017690	Miscanthus Phyllosphere	MPNPGYQGTRDFNPQMGQQIPRNPNPQADELLLKVIEMMKNQFGLKPKWLT
Ga0182232_10828611	3300021060	Phyllosphere	MIPNPGYQGTQNFNPQMGQQLQSNSNSNADELLLRV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F065358

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences