NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F065333

Metagenome Family F065333

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065333
Family Type Metagenome
Number of Sequences 127
Average Sequence Length 147 residues
Representative Sequence MKRKFLILVNCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Number of Associated Samples 88
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.76 %
% of genes near scaffold ends (potentially truncated) 44.88 %
% of genes from short scaffolds (< 2000 bps) 77.95 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(14.961 % of family members)
Environment Ontology (ENVO) Unclassified
(52.756 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.433 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 18.78%    β-sheet: 35.36%    Coil/Unstructured: 45.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00589Phage_integrase 2.36
PF07603DUF1566 1.57
PF01661Macro 1.57
PF02036SCP2 1.57
PF04845PurA 1.57
PF07589PEP-CTERM 1.57
PF01182Glucosamine_iso 1.57
PF17152CHASE8 0.79
PF06835LptC 0.79
PF00801PKD 0.79
PF07592DDE_Tnp_ISAZ013 0.79
PF06081ArAE_1 0.79
PF13533Biotin_lipoyl_2 0.79
PF00069Pkinase 0.79
PF12704MacB_PCD 0.79
PF00291PALP 0.79
PF03699UPF0182 0.79
PF02371Transposase_20 0.79
PF01339CheB_methylest 0.79
PF00041fn3 0.79
PF00155Aminotran_1_2 0.79
PF02613Nitrate_red_del 0.79
PF01475FUR 0.79
PF13426PAS_9 0.79
PF13635DUF4143 0.79
PF13432TPR_16 0.79
PF01555N6_N4_Mtase 0.79
PF02253PLA1 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.15
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 1.57
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 1.57
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 1.57
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.79
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.79
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.79
COG1615Uncharacterized membrane protein, UPF0182 familyFunction unknown [S] 0.79
COG2180Nitrate reductase assembly protein NarJ, required for insertion of molybdenum cofactorPosttranslational modification, protein turnover, chaperones [O] 0.79
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.79
COG2829Outer membrane phospholipase ACell wall/membrane/envelope biogenesis [M] 0.79
COG3547TransposaseMobilome: prophages, transposons [X] 0.79
COG4129Uncharacterized membrane protein YgaE, UPF0421/DUF939 familyFunction unknown [S] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10031281All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3107Open in IMG/M
3300003432|JGI20214J51088_10429284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium875Open in IMG/M
3300003432|JGI20214J51088_10469485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium823Open in IMG/M
3300003541|JGI20214J51650_10228049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1286Open in IMG/M
3300003541|JGI20214J51650_10931572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium606Open in IMG/M
3300003541|JGI20214J51650_11025150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium576Open in IMG/M
3300003861|Ga0031654_10020977All Organisms → cellular organisms → Bacteria → Proteobacteria1900Open in IMG/M
3300003861|Ga0031654_10054609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1121Open in IMG/M
3300009552|Ga0116138_1033044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1539Open in IMG/M
3300009617|Ga0116123_1046312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1253Open in IMG/M
3300009621|Ga0116116_1031501All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300009639|Ga0116122_1052215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1381Open in IMG/M
3300009639|Ga0116122_1070548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1157Open in IMG/M
3300009641|Ga0116120_1256646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium548Open in IMG/M
3300010339|Ga0074046_10322486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales945Open in IMG/M
3300011431|Ga0137438_1164507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium681Open in IMG/M
3300014151|Ga0181539_1182012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium818Open in IMG/M
3300014165|Ga0181523_10793318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium516Open in IMG/M
3300014169|Ga0181531_10022706All Organisms → cellular organisms → Bacteria3605Open in IMG/M
3300014490|Ga0182010_10877035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium511Open in IMG/M
3300014494|Ga0182017_10751413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium589Open in IMG/M
3300014496|Ga0182011_10086245All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2196Open in IMG/M
3300014496|Ga0182011_10708913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium634Open in IMG/M
3300014498|Ga0182019_10134729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1551Open in IMG/M
3300014498|Ga0182019_10214262All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1252Open in IMG/M
3300014498|Ga0182019_10318270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1042Open in IMG/M
3300014498|Ga0182019_10752018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium694Open in IMG/M
3300014502|Ga0182021_10018459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter8273Open in IMG/M
3300014502|Ga0182021_10151457All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2699Open in IMG/M
3300014502|Ga0182021_11741908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium750Open in IMG/M
3300014502|Ga0182021_11990608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium699Open in IMG/M
3300014502|Ga0182021_13194874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium547Open in IMG/M
3300014654|Ga0181525_10659602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium585Open in IMG/M
3300014838|Ga0182030_10001449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales48874Open in IMG/M
3300014839|Ga0182027_10091546All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3682Open in IMG/M
3300014839|Ga0182027_10230864All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2128Open in IMG/M
3300014839|Ga0182027_10467121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1385Open in IMG/M
3300014839|Ga0182027_11185614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium769Open in IMG/M
3300014839|Ga0182027_11291284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium728Open in IMG/M
3300014839|Ga0182027_11470612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium671Open in IMG/M
3300017931|Ga0187877_1117365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1095Open in IMG/M
3300017935|Ga0187848_10010044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter5570Open in IMG/M
3300017935|Ga0187848_10181726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium912Open in IMG/M
3300017940|Ga0187853_10332792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium681Open in IMG/M
3300017944|Ga0187786_10133902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium877Open in IMG/M
3300017944|Ga0187786_10180961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium786Open in IMG/M
3300017944|Ga0187786_10330329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium637Open in IMG/M
3300017944|Ga0187786_10517665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium544Open in IMG/M
3300017946|Ga0187879_10251252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300017947|Ga0187785_10000235All Organisms → cellular organisms → Bacteria21776Open in IMG/M
3300018013|Ga0187873_1065306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1519Open in IMG/M
3300018014|Ga0187860_1022454All Organisms → cellular organisms → Bacteria3603Open in IMG/M
3300018016|Ga0187880_1091461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1516Open in IMG/M
3300018016|Ga0187880_1122587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1253Open in IMG/M
3300018020|Ga0187861_10108234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1330Open in IMG/M
3300018021|Ga0187882_1191828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium809Open in IMG/M
3300018024|Ga0187881_10107857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1252Open in IMG/M
3300018025|Ga0187885_10438150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium584Open in IMG/M
3300018033|Ga0187867_10750927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium531Open in IMG/M
3300018035|Ga0187875_10000064All Organisms → cellular organisms → Bacteria92518Open in IMG/M
3300018047|Ga0187859_10092984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1587Open in IMG/M
3300018090|Ga0187770_10947438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium692Open in IMG/M
3300021602|Ga0194060_10584368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium518Open in IMG/M
3300022516|Ga0224542_1035139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium642Open in IMG/M
3300022555|Ga0212088_10659132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium632Open in IMG/M
3300022593|Ga0236338_1086899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium655Open in IMG/M
3300023075|Ga0224520_1108712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium614Open in IMG/M
3300023088|Ga0224555_1026445All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2579Open in IMG/M
3300023090|Ga0224558_1210644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium579Open in IMG/M
3300024233|Ga0224521_1012304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1993Open in IMG/M
3300024240|Ga0224522_1047974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1047Open in IMG/M
3300025162|Ga0209083_1307525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium562Open in IMG/M
3300025439|Ga0208323_1026609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales1187Open in IMG/M
3300025448|Ga0208037_1043933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium889Open in IMG/M
3300025454|Ga0208039_1031169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1047Open in IMG/M
3300025474|Ga0208479_1075408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium637Open in IMG/M
3300025852|Ga0209124_10331084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium567Open in IMG/M
3300027854|Ga0209517_10000060All Organisms → cellular organisms → Bacteria175537Open in IMG/M
3300027902|Ga0209048_10000045All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas114682Open in IMG/M
3300027902|Ga0209048_10021886All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis5533Open in IMG/M
3300027902|Ga0209048_10658244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium693Open in IMG/M
3300028556|Ga0265337_1014957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2557Open in IMG/M
3300028556|Ga0265337_1016932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2347Open in IMG/M
3300028558|Ga0265326_10111664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium777Open in IMG/M
3300028800|Ga0265338_10005286All Organisms → cellular organisms → Bacteria16902Open in IMG/M
3300028800|Ga0265338_10006081All Organisms → cellular organisms → Bacteria15499Open in IMG/M
3300028800|Ga0265338_10098258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2396Open in IMG/M
3300028800|Ga0265338_10396214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium985Open in IMG/M
3300029984|Ga0311332_10369165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1110Open in IMG/M
3300029987|Ga0311334_10795433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium778Open in IMG/M
3300029987|Ga0311334_11473407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium576Open in IMG/M
3300029990|Ga0311336_10563446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium970Open in IMG/M
3300030000|Ga0311337_11055234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium709Open in IMG/M
3300030000|Ga0311337_11496303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium592Open in IMG/M
3300030114|Ga0311333_11845779All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium526Open in IMG/M
3300030294|Ga0311349_10741766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium926Open in IMG/M
3300031232|Ga0302323_100598631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1194Open in IMG/M
3300031344|Ga0265316_10659393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium739Open in IMG/M
3300031344|Ga0265316_10663021All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium737Open in IMG/M
3300031712|Ga0265342_10262059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium920Open in IMG/M
3300031726|Ga0302321_101664909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium738Open in IMG/M
3300031902|Ga0302322_102352767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium656Open in IMG/M
3300032770|Ga0335085_11398477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium734Open in IMG/M
3300032783|Ga0335079_10051198All Organisms → cellular organisms → Bacteria → Proteobacteria4729Open in IMG/M
3300032805|Ga0335078_12485521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium535Open in IMG/M
3300032828|Ga0335080_10561167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1205Open in IMG/M
3300032828|Ga0335080_11355981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium709Open in IMG/M
3300032829|Ga0335070_10353363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1414Open in IMG/M
3300032897|Ga0335071_10008777All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetoovum → Candidatus Magnetoovum chiemensis10359Open in IMG/M
3300032897|Ga0335071_10257331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1699Open in IMG/M
3300032897|Ga0335071_10638686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1015Open in IMG/M
3300033004|Ga0335084_10411808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1393Open in IMG/M
3300033004|Ga0335084_10707886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1026Open in IMG/M
3300033004|Ga0335084_12126791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium545Open in IMG/M
3300033158|Ga0335077_10632360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1112Open in IMG/M
3300033402|Ga0326728_10145761All Organisms → cellular organisms → Bacteria2591Open in IMG/M
3300033405|Ga0326727_10498312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1061Open in IMG/M
3300033433|Ga0326726_10039023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4145Open in IMG/M
3300033433|Ga0326726_11498243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium657Open in IMG/M
3300033433|Ga0326726_12320023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium521Open in IMG/M
3300033798|Ga0334821_065018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium725Open in IMG/M
3300033820|Ga0334817_022936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1279Open in IMG/M
3300033890|Ga0334810_039185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1175Open in IMG/M
3300033891|Ga0334811_174234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium526Open in IMG/M
3300034070|Ga0334822_008138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2701Open in IMG/M
3300034091|Ga0326724_0021706All Organisms → cellular organisms → Bacteria5550Open in IMG/M
3300034281|Ga0370481_0000143All Organisms → cellular organisms → Bacteria30238Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen14.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.24%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil8.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere7.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.72%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.72%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.15%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.94%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland3.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.57%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.57%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.57%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.79%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.79%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.79%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.79%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.79%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300022516Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022593Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300024240Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1003128133300000567Peatlands SoilMKTKFIIPVTCLMVLALCGCVSTLIGEKVASTATPPHIANFNFDLSTPGADAGRLTVQFRQPTYQLSVEKYAVKIDSLPPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKREIVIIEDQEQKLKYTGPYRLFGQGDVEVIQ*
JGI20214J51088_1042928413300003432WetlandWFFKNNFSYDKSRDVILSIHNRGEIKMKRKFIVLVKCLILMSLCGCVSTLLAEKTASVAAPPKTENFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYACSSNPEESEKVSYGKPTAREIVIIKDKDQTLKYTGPYRLLGEGKVEVIQYVSKRSPFVSSHCFSYSIT*
JGI20214J51088_1046948513300003432WetlandSLCGCVATLIGEKTASVAAPPKTDNFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSTPEESEKVSYGKPTKSEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ*
JGI20214J51650_1022804913300003541WetlandTASVAAPPKTDNFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSTPEESEKVSYGKPTKSEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ*
JGI20214J51650_1093157213300003541WetlandTASVAAPPKTDNFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYACSSNPEESEKVSYGKPTAREIVIIKDKDQTLKYTGPYRLLGEGKVEVIQ*
JGI20214J51650_1102515013300003541WetlandMKKTLIVLAGGLMLMCLSGCATTLLTEKVASDAAPPKIENFSFDQSKPGADSGKLLVQFRQPSYQMSVERYAVKIDSNPPLVVSKQSDAEIKLAAGKHSLKFYAVSSNPADSEKASFGAATTREIVITKDKEQKLKYTGPYRLLGEGKVEVIQ*
Ga0031654_1002097733300003861Freshwater Lake SedimentMQSKFTVIVIGLILLSSGGCMTTMLVEKAADTAVPPKTEQFSFDLSTPGTESGQLTIQCRQPTYQQSVDKYAIKIDSKSPLVVSKQSDTNIKLDAGTHALKFYAVSSEPAESEKVAFGKPTNSEIIIVNGKEQKLKYTGPIRLFGEGKLEVIQ*
Ga0031654_1005460913300003861Freshwater Lake SedimentTTMLVEKAADTGLPPKTDQFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSKSPLVVSKQSDTDIKLDAGKHSLEFYAVSSNPEESDKVSFGKPTKREMVIIKDNEQKLKYTGPIRLFGEGKVEVVQ*
Ga0116138_103304423300009552PeatlandMKRKFILPATCLMLVSLCGCVATLVGEKTASEAAPPQIENFSFDLSTPGADTGTLMVQFRQPSYQMSVDKYAVKIDSGSPLVVSKQSDADIKLAAGKHSLKFYATSSQPDESEKVTYGKPTTREVEISKDQVQTLQYTGPYRLFGEGKVVVIQ*
Ga0116123_104631213300009617PeatlandMIAEKAASEAAPPDIEKFSFDQSTPGADIGKLTVQCRQPSYQMAVAKYAIKIDSRSPLVVAKQSDTDIKLDAGKHTLKFYACSGNPEESEKVSYGRPTTKEIVVAKDKEQKLKYTGPYRLLGEGKVEAIQ*
Ga0116116_103150133300009621PeatlandMKSKLILLVNCLILISLCGCISTLIAEKSASVAAPPKTEIFSFDLSSPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ*
Ga0116122_105221523300009639PeatlandMSLCGCIATLIGEKTASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHTLKFYACSDNPEESEKASFGYPTQREIVIIKDSEQKLKYTGPWRLLGEGKVEVIQ*
Ga0116122_107054833300009639PeatlandMPSIHKREEIKMKTKFIIPVSCLMLLALCGCVSTIIGEKVASTAAPPKIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDALSPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKREIVIIKDQEQKLKYTGSYRLFGQGNVEVIQ*
Ga0116120_125664613300009641PeatlandIHNRGEIKMKRKFIALVNCLILMSLCGCIATLIGEKTASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ*
Ga0074046_1032248633300010339Bog Forest SoilMSLCGCVATLIGEKTASVAAPPKIEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQK
Ga0137438_116450713300011431SoilMKRKIFVLASGLILLSLCGCVSTLIAEKTASVAAPPNTDKFSFDLSKPGADIGMLKVQCRQPSYQVSVDKYAIKIDSNSPLVVSKQSDTDIKLEAGKHSLKFYAVSSKPEESEKVSYGKPTKREIVIIKDKEQNLKYTGPYRLLGEGKVEVIE*
Ga0181539_118201223300014151BogMSLCGCVATLIGEKTASVAAPPKIDIFSFDLSTPGADIGKLIVQFRQPSYQMVVDKYAVKIDSKSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPEESEKVSFGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ*
Ga0181523_1079331813300014165BogQMKLKFIIPVSCLMLLFSCGCISTLIGEKVASSAAPPKIENFSFDLSTPGADAGTLTVQFRQPSYQLSVEKYAVKIDSHSPLVVSKQSDTGVKLDAGKHSLKFYAASSDPGESEQVSYGEPTKMEIVIVKDQEQKLKYTGPYRLFGRGDLEVIQ*
Ga0181531_1002270623300014169BogMKRIFIVLVSGLMLVTLCGCIATLMAEKTASVAAPPETNSFSFDLSTPGADAGKLTVQCRQPSYQISVERYAIRIDSNAPLVISKQSDTDVKLDAGKHSLELYAASSDPAESEKVSYGKPTMTDIVIIKDQDRKLKYTGPYRLLGEGKLEVIQ*
Ga0182010_1087703513300014490FenGVEGKGYLILSIHNRGEIKMKRNFIVLVNCLMLMSLCGCVSTLLVEKTASVAAPPEIDKFSFDLSTPGADIGKLIVQFRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDINLDAGKHSLKFYAVSSNPEESEKVSYGRPTKKEIVIIKDKEQKLKYTGPYRLLGEGKVE
Ga0182017_1075141323300014494FenCGCISTLIGEKTASAASPPKTATFSFDLSTPGADAGKLTVQCRQPTYQISVEKYAIKIDSNAPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPADSEQVSFGMSTKREIVIIKDQEQKLKYTGPYRLLGEGKVEVIQ*
Ga0182011_1008624513300014496FenTLIGEKTASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKIEVIQ*
Ga0182011_1070891313300014496FenTFSFDLSTPGADIGKLTVQCRQPTYQLSVEKYAIKIDFNPPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEQVSYGEPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ*
Ga0182019_1013472923300014498FenMSATAPPKIEKFSFDLSKPGADICKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVAKQSDTDIKLNAGKHSLIFYAVSSDPADSEKVSYGKPTIKEIVIIKDKEQTLKYTGPYRLLGEGDVEVIQ*
Ga0182019_1021426223300014498FenMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADIGKLIVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREVVIIKDQEPKLKYTGPYRLFGEGKVEVIQ*
Ga0182019_1031827013300014498FenRKRIAKRACACRGLEIHNIGENKMKQKFIILAGCLMLMSLCGCISTLIAEKAASEAAPPETDKFSFDLATPGADIGKLTVQCRQPSYQISVEKYAIKIDSNSPLVISKQSDTEVKLDAGKHSLKFYAVSSNPAESEQVSFGMSTKREIVIIKDQEQKLKYTGPYRLLGEGKVEVIP*
Ga0182019_1075201813300014498FenVEKAASEAAPPTTDKFSFDLSTPGADIGKLIVQFRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDINLDAGKHSLKFYAVSSNPEESEKVSYGEPTQSEIVIIKDQEQKLKYTGPYRLFGEGKIEVIQ*
Ga0182021_10018459113300014502FenVEKAASEAAPPTTDKFSFDLSTPGADIGKLIVQFRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDINLDAGKHSLKFYAVSSNPEESEKVSFGKPTKSEIVIIKDKEQKLKYTGPYRLFGEGKVEVIQ*
Ga0182021_1015145743300014502FenCGCVSTLIGEKTASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKIEVIQ*
Ga0182021_1174190813300014502FenMSATAPPKIEKFSFDLSKPGADICKLIVQFRQPTYQISVAKYAVKIDSKSPLVVSKQSDVDIKLDAGKHSLKFYAVSSDPEESEKVSFGKPTQREIVIIKNQEQKLKYTGPYRLFG
Ga0182021_1199060823300014502FenSCGCVSTLIGEKTASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKAEVIQ*
Ga0182021_1319487413300014502FenMIAEKSASVAAPPKVEKFSFNLSTPGADVGKLIVQCRQPSYQMVVDKYAIKIDSNTPLVVSKQSDTEIKLDAGKHTLKFYACSDNSEESEKASFGYPTQREIVIIKDSEQKLKYTGPWRLLGEGK
Ga0181525_1065960213300014654BogMKQKFLILVNCLMISLLCGCVSTMIAEKTASVVAPPDIEKFSFDLSTPGADTSQLTVQCRQPTYQMVVDRYAIKIDSHSPLVVSKQSDTDIKLDAGTHALRFYAVSATRESEKVSFGEPTEREIIIIKDQEQKLKYTGPYRLFGEGKLAVIQ*
Ga0182030_10001449423300014838BogMKTKFILPVSCLMLLALCGCISTLIGEKVASTQTAPKIVNFNFDLSTPGTDAGRLTLQFRQPTYQLVVEKYAVKIDSHPAQVVSKQSDVEVKLDAGKHSLKFYAVSSNPAESEQVSYGKPTKKEIVIVKDQEQKLKYTGPYRLLGHGDLEVIP*
Ga0182027_1009154633300014839FenMSSCGCVSTLIGEKTASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKIEVIQ*
Ga0182027_1023086433300014839FenMLSIHNGGEIKMKSKFIIPVSCLMLVFLCGCVSTLIGEKTASVAAPPEADKFSFDLSTPGADTGRLIVQFRQPSYQMSVEKYAIKIDSNSPLVVSKQSDADMKLDAGKHSLKFYAVSSNPEESETVSYGEPTKSEIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ*
Ga0182027_1046712123300014839FenMKTKFIIPVSCLMLLALCGCVSTLIGEKVASTATPPKIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDSHSPLVVSKQSDVEVKLDAGKHSLKFYAVSGNPEESEKVSYGEPTKREIVVVKDQEQKLKYTGPYRLFGRGDVEVIQ*
Ga0182027_1118561423300014839FenSAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVGKYAIKIDSNFPLVISKQSDTDVKLDAGKHSLKFYAASSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ*
Ga0182027_1129128413300014839FenMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVTPK*
Ga0182027_1147061213300014839FenMLVSLCGCVATLIGEKTASVAAPPKIGNFSFDLSTPGADTGKLIVQCRQPTYQMVVAKYAIKIDSNPPLVVSKQSDTDVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKREIVIIKDQEQKLKYTGSYRLFGEGKVEVIQ*
Ga0187877_111736523300017931PeatlandMKSKLILLVNCLILISLCGCISTLIAEKSASVAAPPKTEIFSFDLSSPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0187848_1001004453300017935PeatlandMKRKFIALVNCLILMSLCGCIATLIGEKTASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHTLKFYACSDNPEESEKASFGYPTQREIVIIKDSEQKLKYTGPWRLLGEGKVEVIQ
Ga0187848_1018172613300017935PeatlandMKTKFIIPVSCLMLLALCGCVSTIIGEKVASTAAPPKIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDALSPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKREIVIIKDQEQKLKYTGSYRLFGQGNVEVIQ
Ga0187853_1033279213300017940PeatlandLVSLCGCVATLVGEKTASEAAPPQIENFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHTLKFYACSDNPEESEKASFGYPTQREIVIIKDSEQKLKYTGPWRLLGEGKVEVIQ
Ga0187786_1013390223300017944Tropical PeatlandMKRIFTVLFYCLILVSLYGCVTAMISEKVASEAAPPDIEKFSFDLSTPGVDTGKLTIQCRQPSYQLVVAKYAVKIDSKSPLVVSKQSDTDIKLDAGKHTLKFYACSGNPDESEKVSFGLSTTKEIFIVKDKEQKLKYTGPYRLLGEG
Ga0187786_1018096123300017944Tropical PeatlandMKWKSIALVGCLMLLSLCGCVSTMIAEKAASTAAPPDIEKSSFNLSSPGADIGKLTVQCRQPSYQMAVAKYAIKIDSKSPLVVSKQSDTDIILDAGKHTLKFYACSGSPEDSEKVSFGMSTTREIVITKDKGQTLKYTGPYRLLGGGKVEVIQ
Ga0187786_1033032913300017944Tropical PeatlandMKMKLFVLVSCLILMSLCGCVSTMIAEKVASEAAPPDIEKFSFDLSTPGTDNGKLTVQCRQPSYQLSVAKYAIKIDSKSPLVVSKQSATEIKLDAGKHTLKFYACSSNPEESEKVSFGAPSKIEIVIIKDKEQTLKYTGPYRLLGEGKVEVIQ
Ga0187786_1051766513300017944Tropical PeatlandMKKKIIAIVGILMMISICGCVSTMIAEKTASVAAPPDVENFSFDLSTANGDAGSFIVQCRQPSYQMSVEKYAIKIDSNAPLVVSKQSDTNIKLDAGKHTLKLYAVSSKPEESEKVSFGKPTTREILINKDQVQKLKYTGPY
Ga0187879_1025125223300017946PeatlandRKFILPATCLMLVSLCGCVATLVGEKTASEAAPPQIENFSFDLSTPGADTGTLMVQFRQPSYQMSVDKYAVKIDSGSPLVVSKQSDADIKLAAGKHSLKFYATSSQPDESEKVTYGKPTTREVEISKDQVQTLQYTGPYRLFGEGKVVVIQ
Ga0187785_1000023573300017947Tropical PeatlandMKRKLIVLVGILMMISICGCVSTMIAEKTASVAAPPDVEKFSFDLSTPNRDTGSFIVQCRQPSYQISVERYAIKIDSNSPLVVSRQKDTNIKLDVGKHSLKFYAVSSKSEESEKVSFGKPTTREIVITKGQVQKLKYTGPYRLFGEGKVEEVQ
Ga0187873_106530633300018013PeatlandMKTKFIIPVSCLMLLALCGCVSTLIGEKVASTASPPHIANFNFDVSTPGADAGRLSVQFRQPTYQLSVEKYAVKIDSHSPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKRDIVVVKDQEQKLKYTGPYRLFGRGDLEVIQ
Ga0187860_102245433300018014PeatlandMLLALCGCVSTIIGEKVASTAAPPKIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDALSPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKREIVIIKDQEQKLKYTGSYRLFGQGNVEVIQ
Ga0187880_109146133300018016PeatlandMKRKFILLINCLILMSLCGCVATLIGEKTASVAAPPKIDIFSFDLSTPGADIGKLIVQFRQPSYQMVVDKYAVKIDSKSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPEESEKVSFGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0187880_112258723300018016PeatlandMPSIHKREEIKMKTKFIIPVSCLMLLALCGCVSTIIGEKVASTASPPKIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDALSPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKREIVVVKDQEQKLKYTGPYRLFGRGDLEVIQ
Ga0187861_1010823423300018020PeatlandGTVLIYDQSGYFILSIHNRGEIKMKSRFIVLVNCLILISLCGCISTLIAEKSASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0187882_119182813300018021PeatlandMKSKLILLVNCLILISLCGCISTLIAEKSASVAAPPKTEIFSFDLSSPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPGESEKVSYGAPTKTEIVIIKDKEQKLKYTGPYRLLGE
Ga0187881_1010785713300018024PeatlandMKSRFIVLVNCLILISLCGCISTLIAEKSASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSDPEKSEKVSYGAPTKTEIVIIKNNEQKLKYTGPYRLLGEGKVEVIQ
Ga0187885_1043815013300018025PeatlandAPPKIDNFSFDLSTPGADTGKLIVQCRQPTYQMAVAKYAIKIDSNPPLVVSKQSDTDVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0187867_1075092713300018033PeatlandVLVNCLLLMSLCGCVATLIGEKTASVAAPPKTDKFSFDLSTPGMDICKLIVQCRQPTYQMVVDKYAIKIDSNSALVVSKQSDTDIKLDAGKHSLKFYAVSSNPEKSEKVSFGEPSQMDIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0187875_1000006423300018035PeatlandMKRKFILPATCLMLVSLCGCVATLVGEKTASEAAPPQIENFSFDLSTPGADTGTLMVQFRQPSYQMSVDKYAVKIDSGSPLVVSKQSDADIKLAAGKHSLKFYATSSQPDESEKVTYGKPTTREVEISKDQVQTLQYTGPYRLFGEGKVVVIQ
Ga0187859_1009298413300018047PeatlandMKGKIIVLVNCLLLMSLCGCVATLIGEKTASVAAPPKTDKFSFDLSTPGMDICKLIVQCRQPTYQMVVDKYAIKIDSNSALVVSKQSDTDIKLDAGKHSLKFYAVSSNPEKSEKVSFGEPSQMDIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0187770_1094743823300018090Tropical PeatlandMKSKFIVLANCLMLVSVCGCVATMVGEKTASTVAPPDVEKSSFDLSTAGADAGKLIVQCRQPSYQMSVEKYAIKIDSMFPLVVSKQSDTEIRLDAGKHSVKFYAVSSDPAESEKVAFGKPTTREIDIVKDQEQKLQYTGPYRLLGEGKVEVIQ
Ga0194060_1058436813300021602Anoxic Zone FreshwaterMLVFTCGCLSTMIVEKSADVAASPVMDKFTFDLSTPGAEAGQLAVQFRQPSYQLSVSRYAVKIDTLTPLVVTKQSEVAVKLDAGKHFLKFYAASSDPAASENVSFGEPTLKEVVILKDQAQKLKYTGPVRLFGKGKLEVLP
Ga0224542_103513913300022516SoilMKRKFLILVNCLMLMSSCGCVSTLIGEKTASAASPPKTATFSFDLSTPGADIGKLIVQCRQPSYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPY
Ga0212088_1065913213300022555Freshwater Lake HypolimnionMKRKFLILINCLMLMSLCGCVSTLIAEKTASVAAPPKTEAFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHVLKFYAVSSNPAESEKVSYGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0236338_108689913300022593FreshwaterMKRKFFVLVNCMMLMSLCGCVSTLIAEKSASVAAPPDTDKFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLIVSKQSDTDIKLDAGKHSLKFYAVSSKPEESEKVSYGKPSKREIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0224520_110871213300023075SoilDQSGQFILSIHNRGEIKMKRKFLILVNCLILMSSCGCISTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0224555_102644523300023088SoilMKRKFIILVNSLMLVSLCGCVATLIGEKTASVAAPPKIDNFSFDLSTSGADTGKLIVQCRQPTYQMVVAKYAIKIDSNPPLVVSKQSDTDVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0224558_121064413300023090SoilYAFNPQTGRNKMKTKFIIPVSCLMLLALCGCISTLIGEKVASTASPPNIANFNFDLSTPGADAGRLTVQFRQPTYQLSVEKYAVKIDSHSPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSYGEPTKRDIVVVKDQEQKLKYTGPYRLFGRGDLEVIQ
Ga0224521_101230423300024233SoilMKRKFLILVNCLILMSSCGCISTLIGEKAASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0224522_104797423300024240SoilMKRKFLILVNCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0209083_130752513300025162FreshwaterMKRKFLILINCLMLMSLCGCVSTLIAEKTASVAAPPKTEAFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSTSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPEESEKVSFGKPTKREIVIIKDQE
Ga0208323_102660933300025439PeatlandMKRKFIALVNCLILMSLCGCIATLIGEKTASVAAPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHTLKFYACSDNPEESEKASFGYPTQREIV
Ga0208037_104393313300025448PeatlandMKGKFLVLGSLILVSLCGCVSTMIAEKAASEAAPPDIEKFSFDQSTPGADIGKLTVQCRQPSYQMAVAKYAIKIDSRSPLVVAKQSDTDIKLDAGKHTLKFYACSGNPEESEKVSYGRPTTKEIVVAKDKEQKLKYTGPYRLLGEGKVEAIQ
Ga0208039_103116913300025454PeatlandMKRKFILPATCLMLVSLCGCVATLVGEKTASEAAPPQIENFSFDLSTPGADTGTLMVQFRQPSYQMSVDKYAVKIDSGSPLVVSKQSDADIKLAAGKHSLKFYATSSQPDESEKVTYGKPTTREVEISKDQVQTLQYTGPYRLF
Ga0208479_107540813300025474Arctic Peat SoilKRKFLILVNCLILMSSCGCISTLIGEKTASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSYGKPTKREIVIIKDQEQKLKYTGPYRLLGEGKVEVIQ
Ga0209124_1033108413300025852Arctic Peat SoilLVNCLILLSLCGCVSTLLVEKTASVAAPPTTDKFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSKPAESEKVSYGKPTKREVVIIKDKEQKLKYTGPYRLLGEGKVEVIQQEFQGKSR
Ga0209517_10000060993300027854Peatlands SoilMKTKFIIPVTCLMVLALCGCVSTLIGEKVASTATPPHIANFNFDLSTPGADAGRLTVQFRQPTYQLSVEKYAVKIDSLPPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKREIVIIEDQEQKLKYTGPYRLFGQGDVEVIQ
Ga0209048_1000004513300027902Freshwater Lake SedimentMQSKFTVIVIGLILLSSGGCMTTMLVEKAADTAVPPKTEQFSFDLSTPGTESGQLTIQCRQPTYQQSVDKYAIKIDSKSPLVVSKQSDTNIKLDAGTHALKFYAVSSEPAESEKVAFGKPTNSEIIIVNGKEQKLKYTGPIRLFGEGKLEVIQ
Ga0209048_1002188623300027902Freshwater Lake SedimentMKRKFTVLVNGLILLFSCGCVTTMLVEKAADTGLPPKTDQFSFDLSTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSKSPLVVSKQSDTDIKLDAGKHSLEFYAVSSNPEESDKVSFGKPTKREMVIIKDNEQKLKYTGPIRLFGEGKVEVVQ
Ga0209048_1065824413300027902Freshwater Lake SedimentKAADTGLPPSTDQFSFDLSTPGADIGKLVVQCRQPTYQISVERYAIKIDSKSPLVVSKQSDTDIKLDAGKHSLEFYAVSSNPAESDKASFGKPTKREIVVIKDNEQKLKYTGPIRLFGEGKVEVPQ
Ga0265337_101495713300028556RhizosphereCGCVSTIIGEKTASTVAAPKTESFSFDLSTPGADAGTLMVQFRQPTYQLAVDRYAVKIDSHSPLVVSRQSEVKVKLDAGKHSLKFYAASSDPKESEQVSFGEPTKKDIVIVKDQAQKLKYTGPYRLFGQGDLEVMK
Ga0265337_101693213300028556RhizosphereMKTKLPVLLASLVLVFTGGCLSTMIVEKSADVAAPPTLDKFVFDLATPGADAGKLSVQFRQPSYQLSVSRYAVKIDDHAPLVVTKQSDAEVKLDAGKHSLKFYAASSDPAESEKVSFGEPTQSDVVIVKDQAQKLKYTGPIRLFGKGKLELLP
Ga0265326_1011166423300028558RhizosphereMKRKFLILVNCLILMSSCGCVSTLIGEKTASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTEVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0265338_1000528643300028800RhizosphereMKTKFIIPVSCLMLLTLCGCISTLIGEKVASTQTAPKIVNFNFDLSTPGADAGRLTLQFRQPTYQLVVDKYAVKIDSHPAMVVSKQSNVEVKLDAGKHSLKFYAVSSNPAESEQVSYGEPTKRDIVIVKDQEQKLKYTGPYRLLGHGDLEVIP
Ga0265338_1000608143300028800RhizosphereMKRIFIIPVGCLILMTLCGCVATLVGEKTASVAAPPEIDKFNFDLSTPGVDVGSLMVQFRQPTYQLSVERYAVKIDSHSPLVVSKQSDVDVKLDAGKHSLKFYAVSSNPEESEKVSFGEPTKKEIVIIKEQEQKLKYTGPYRLFGEGKVEVVQ
Ga0265338_1009825823300028800RhizosphereMKTKFIIPTTCLLLLALCGCVSTIIGEKTASTVAAPKTESFSFDLSTPGADAGTLMVQFRQPTYQLAVDRYAVKIDSHSPLVVSRQSEVKVKLDAGKHSLKFYAASSDPKESEQVSFGEPTKKDIVIVKDQAQKLKYTGPYRLFGQGDLEVMK
Ga0265338_1039621413300028800RhizosphereHVGRGQELKSENMPSIHNREEITMKKKFIIPVSCLMLLALCGCVSTIIGEKVASTATAPKIANFNFDLSTPGADAGRLTVQFRQPTYQAAVEKYAVKIDAKSSLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESENVSYGEPTKREIVVVKDQEQKLKYTGPYRLFGQGNVEVIH
Ga0311332_1036916523300029984FenMKQKLIALAGCLMLVSLCGCLSTLIAEKTASTAAPPEPEKCSFDLSTPGADAGWLTVQFRQPSYQLSVEKYAVKIDSHAPLVVSKQSDARMKLEAGKHSLKFYAVSSDPAASENVSFGMSTKTEIVIIKDQEQKLKYTGPYRLLGEGKLEIIQ
Ga0311334_1079543313300029987FenSLCGCLSTLIAEKTASTAAPPEPEKCSFDLSTPGADAGWLTVQFRQPSYQLSVEKYAVKIDSHAPLVVSKQSDARMKLEAGKHSLKFYAVSSDPAASENVSFGMSTKTEIVIIKDQEQKLKYTGPYRLLGEGKLEIIQ
Ga0311334_1147340713300029987FenEWVFILPIHYRGEIKMKRKFLILVNCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPADSEQVSFGMSTKREIVLIKDQEQKLKYTGPYRLLGEGKVEVIQ
Ga0311336_1056344623300029990FenMLLALCGCVSTIIGEKVASTATPPTIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDSHSPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSYGKPTKREIVVVKDQEQKLKYTGPYRLFGRGDLEVIQ
Ga0311337_1105523423300030000FenASTAAPPEPEKCSFDLSTPGADAGWLTVQFRQPSYQLSVEKYAVKIDSHAPLVVSKQSDARMKLEAGKHSLKFYAVSSDPAASENVSFGMSTKTEIVIIKDQEQKLKYTGPYRLLGEGKLEIIQ
Ga0311337_1149630313300030000FenCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKAEVIQ
Ga0311333_1184577913300030114FenLMLLALCGCVSTIIGEKVASTSTPPTIANFNFDLSTPGADAGRLTVQFRQPTYQLAVEKYAVKIDSHSPLVVSKQSDVEVKLDAGKHSLKFYAVSSNPEESEKVSYGKPTKREIVVVKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0311349_1074176623300030294FenLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKAEVIQ
Ga0302323_10059863123300031232FenMKRKFLILVNCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKAEVIQ
Ga0265316_1065939323300031344RhizosphereMKRKFLILVNCLILMSACGCISTLIGEKTASAASPPKTATFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKIEVIQ
Ga0265316_1066302113300031344RhizosphereMKTKLPVLLASLVLVFTGGCLSTMIVEKSADVAAPPTLDKFVFDLATPGADAGKLSVQFRQPSYQLSVSRYAVKIDDHAPLVVTKQSDAEVKLDAGKHSLKFYAASSDPAESEKVSFGEPTQSDVVIVKDQAQK
Ga0265342_1026205923300031712RhizosphereMKRKFLILVNCLILMSSCGCVSTLIGEKTASAASPPKTATFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHALKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKIEAIQ
Ga0302321_10166490913300031726FenMKRKFLILVNCLILMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKYQEQKLKYTGPYRLFGEG
Ga0302322_10235276723300031902FenMKMKFIALVNLLMLMSLCGCATTLIAEKTASVAAPPKTDKFSFDQSTSRADIGKLIIQCRQPSYQMSVEKYAIKIDSNPPLVVSKQSDTDIKLDSGKHSLKFYAVSSEPEESEKVSFGEPTTRQVVIIKDKEQILKYTGPYRLLGEGKVE
Ga0335085_1139847723300032770SoilRNQEKRLELIGGPSCLIFSIHNRGEFEMKWKFIVLIGCLILMSLCGCISTMIAEKTASVAAPPDIEKFSFDLSTPGADMGKLTVQCRQPSYQMAVAKYAIKIDSKSPLVVSKQSDTDIKLEAGKHSLKFYACSSNPEESEKVSYGAPTTREIVIIKDQEQKLKYTGPYRLLGEGKVEVIQ
Ga0335079_1005119833300032783SoilMKRKFIALASCLILIALCGCVSTMIAEKAASTAAPPDIEKFVFDLSTPGADMGKLTVQCRQPSYQMAVARYAIKIDSRSPLVVAKQSDTDIKLDAGKHTLKFYACSSDPEESEKVSYGMSTTREIVIVKDKGQTLKYTGPYRLLGEGRLEVIQ
Ga0335078_1248552113300032805SoilMKPKFIVLINCLLLVPLCGCVATMIGEKTASEAAPPKIENFGFDLSTPGADAGKLMVQFRQPTYQMVVERYAVKIDTNAPLVVSKQSDTEVKLDAGKHSLKFYATSSDPAGSEKVSYGEPTKSEIVIIKDQEQKLKYTGPYRLFG
Ga0335080_1056116713300032828SoilCVTTMIAEKAASTAAPPDIEKFSFNLSTPGADAGKLTIQCRQPSYQMAVAKYAIKIDSKSPLVVSKQSDTDIILDAGKHTLKFYACSSTPEDSEKVSFGMSTTREVVIAKDKGQTLKYTGPYRLLGEGKIEVIQ
Ga0335080_1135598113300032828SoilKWKSVVLVGCLVLLSLCGCVTTMIAEKAASTAAPPDIEKFSFNLSTPGTDVGKLTVQCRQPSYQMSVAKYAIKIDSRSPLVVSKQSDTDIILDAGKHTLKFYACSSTPEDSEKVSFGMSTTKEVVIAKDKGQKLKYTGPYRLLGEGKVEIIQ
Ga0335070_1035336323300032829SoilMKKKFIVLANCLVIMSLCGCVTALVLEKTASVAAPPKIENFSFDLSTPGADIGKLMVQCRQPSYQVSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSKPEESEKVAYGKPTAKEIVIIKDKEEKLKYTGPYRLLGEGNVEVVQ
Ga0335071_1000877773300032897SoilMKKILVVLVGFLIMSLCGCVSTMVAEKAASSAAPPDVEYFSFDLSTPNGDNGNFIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTTIKLDAGKHTLKLYAVSSKPEESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEEVQ
Ga0335071_1025733123300032897SoilMKWKFIVLVGCLILMSLCGCISTMIAEKTASVAAPPDIEKFSFDLSTPGADMGKLTVQCRQPSYQMAVAKYAIKIDSKSPLVVSKQSDADIKLEAGKHSLKFYACSSNPEESEKVSYGAPTAREIVIIKDQEQKLKYTGPYRLLGEGKVEVIQ
Ga0335071_1063868613300032897SoilLVIGLILLFSWGCVTTMLVEKAADTAAPPKTDQFSFDLSTPGTESGQLIVQCRQPTYQQSVDKYAIKIDSKSPLVVSKQSDTDIKLDAGTHALKFYAVSSEPAESEKVAFGKPTNSEIIIVNGKGQKLKYTGPIRLFGEGKLEVVQ
Ga0335084_1041180823300033004SoilMKWKFIVLIGCLILMSLCGCISTMIAEKTASVAAPPDIEKFSFDLSTPGADMGKLTVQCRQPSYQMAVAKYAIRIDSKSPLVVSKQSDTDIKLEAGKHSLKFYACSSNPEESEKVSYGAPTAREIVIIKDQEQKLKYTGPYRLLGEGKVEVIQ
Ga0335084_1070788613300033004SoilMKRIFTVLCFCLILISLCGCVTTMISEKVASEAAPPDIEKFSFDLSTPGADIGKLTVQCRQPSYQIFVDKYAIKVDSKAPLVVSKQSDTDIKLDAGKHTLKFYACSSNPESSEKVSFGLSTTREIFIVKDKEQKLKYTGPYRLLGEGKVEDIQ
Ga0335084_1212679113300033004SoilMKRKCIVLLNCLILMSLCGCVSTLIAEKTASVAAPPETDKFSFDLSTPGADICKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIRLDAGKHSLKFYAVSSNPEESEKVSYGKPTKREL
Ga0335077_1063236033300033158SoilMKGKSVVLVGCMVILSLCGCVTTMIAEKAASTAAPPDIEKFSFNLSTPGADAGKLTIQCRQPSYQMAVAKYAIKIDSKSPLVVSKQSDTDIILDAGKHTLKFYACSSTPEDSEKVSFGMSTTREVVIAKDKGQTLKYTGPYRLLGEGKIEVIQ
Ga0326728_1014576123300033402Peat SoilMKRKFIVLVNCLILMSLCGCVATLIGEKTASVAAPPKTDKFSFDLSTPGADICKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSKPEESEKVSFGEPTKIEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0326727_1049831223300033405Peat SoilMKKISIVLVNCLILMSLCGCVATLIGEKTASVAAPPKIDKFSFDLSAPGADICKLIVQCRQPSYQMIVDKYAIKIDSNAPLVVSKQSDSDINLDAGKHSLKFYAVSSNPEESEKVSFGEPSKIEIVIIKDRVQKLKYTGPYRLLGEGKVEVIQ
Ga0326726_1003902343300033433Peat SoilMKRKFIVLANCLILMSLCGCVSTMLVEKTASVAVPPDTDMFSFDLLTPGADIGKLIVQCRQPSYQMSVEKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLEFYAVSSNPGESEKVSFGKPTKREIVIIKDNEQKLKYTGPYRLFGEGKVEVIQ
Ga0326726_1149824313300033433Peat SoilMKRGLIVLANCLILLFSSGCVTTMLVEKAADTGLPPKTDQFSFDLSTPGADIGKLIVQCRQPTYQISVERYAIKIDSKSPLVVSKQSDTDIKLDVGKHSLEFYAVSSNPAESDKASFGKPTKREIVVIKDNEQKLKYTGPIRLFGEGKVEVPQ
Ga0326726_1232002313300033433Peat SoilLVSSFGCVSTMIVEKGADTAAPPDVQKFSFDLSTPGTDSGILVVQCRQPSYQMVVDKYAIKIDANAPLVVAKQSDTEIKLGAGKHSVKFYATSGKPEDSEKVTFGQSTNKEIDITKDQELKLKYTGPYRLTGEGKVEPVK
Ga0334821_065018_55_5163300033798SoilMKRKFIIPVSCLILLSLCGCVSTLIGEKTASAVSPPKTATFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0334817_022936_348_7703300033820SoilMSSCGCISTLIGEKAASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSYGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVTPK
Ga0334810_039185_383_8023300033890SoilMSSCGCISTLIGEKTASAASPPKTEIFSFDLSTPGADAGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0334811_174234_176_5263300033891SoilMSSCGCVSTLIGEKAASAASPPKTEIFSFDLSTPGADVGKLTVQCRQPTYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSFGKPTKREIVIIKDQ
Ga0334822_008138_354_7733300034070SoilMSSCGCISTLIGEKAASSASPPKTEIFSFDLSTPGADIGKLIVQCRQPSYQLSVEKYAIKIDSNSPLVISKQSDTDVKLDAGKHSLKFYAVSSNPAESEKVSYGEPTKREIVIIKDQEQKLKYTGPYRLFGEGKVEVIQ
Ga0326724_0021706_217_6363300034091Peat SoilMSLCGCVATLIGEKTASVAAPPKTDKFSFDLSTPGADICKLIVQCRQPSYQMVVDKYAIKIDSNSPLVVSKQSDTDIKLDAGKHSLKFYAVSSKPEESEKVSFGEPTKIEIVIIKDKEQKLKYTGPYRLLGEGKVEVIQ
Ga0370481_0000143_23065_235833300034281Untreated Peat SoilVELQRGNFILSIHNRGEIKMKRKFIVLVNCLLLMYLCGCVATLIGEKTASVAAPPKTDIFSFDLSTPGADFGKLIVQCRQPSYQISVEKYAIKIDSKSPLVVSKQSDTDIKLDAGKHSLKFYAVSSNPEESEKVSFGRPTKREIVIIKDKEQTLKYTGPYRLLGEGVVEVIQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.