Basic Information | |
---|---|
Family ID | F065252 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 48 residues |
Representative Sequence | PVLVQVSLMHRGGIGTSAPAAHSAAVVRGLTGYVDLFVTQIRDANK |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.79 % |
% of genes near scaffold ends (potentially truncated) | 95.31 % |
% of genes from short scaffolds (< 2000 bps) | 95.31 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.312 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.375 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF07519 | Tannase | 7.81 |
PF01612 | DNA_pol_A_exo1 | 3.91 |
PF14532 | Sigma54_activ_2 | 3.91 |
PF00355 | Rieske | 2.34 |
PF00069 | Pkinase | 1.56 |
PF07690 | MFS_1 | 1.56 |
PF07687 | M20_dimer | 1.56 |
PF01261 | AP_endonuc_2 | 1.56 |
PF12543 | DUF3738 | 1.56 |
PF03069 | FmdA_AmdA | 1.56 |
PF07859 | Abhydrolase_3 | 1.56 |
PF02635 | DrsE | 1.56 |
PF10503 | Esterase_PHB | 0.78 |
PF00849 | PseudoU_synth_2 | 0.78 |
PF00701 | DHDPS | 0.78 |
PF13738 | Pyr_redox_3 | 0.78 |
PF13709 | DUF4159 | 0.78 |
PF10282 | Lactonase | 0.78 |
PF00999 | Na_H_Exchanger | 0.78 |
PF07638 | Sigma70_ECF | 0.78 |
PF11376 | DUF3179 | 0.78 |
PF00753 | Lactamase_B | 0.78 |
PF13442 | Cytochrome_CBB3 | 0.78 |
PF00171 | Aldedh | 0.78 |
PF00083 | Sugar_tr | 0.78 |
PF00326 | Peptidase_S9 | 0.78 |
PF12867 | DinB_2 | 0.78 |
PF06271 | RDD | 0.78 |
PF02630 | SCO1-SenC | 0.78 |
PF13360 | PQQ_2 | 0.78 |
PF03473 | MOSC | 0.78 |
PF03475 | 3-alpha | 0.78 |
PF03781 | FGE-sulfatase | 0.78 |
PF06983 | 3-dmu-9_3-mt | 0.78 |
PF03551 | PadR | 0.78 |
PF00149 | Metallophos | 0.78 |
PF00873 | ACR_tran | 0.78 |
PF05635 | 23S_rRNA_IVP | 0.78 |
PF13561 | adh_short_C2 | 0.78 |
PF00196 | GerE | 0.78 |
PF13616 | Rotamase_3 | 0.78 |
PF00106 | adh_short | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.25 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.56 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.56 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.78 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.78 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.78 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.78 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.78 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.78 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.78 |
COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 0.78 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.78 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.78 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.78 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.78 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.78 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.78 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.31 % |
Unclassified | root | N/A | 29.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459009|GA8DASG01CT137 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300000574|JGI1357J11328_10211234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300001372|YBBDRAFT_1149844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
3300004114|Ga0062593_100185469 | Not Available | 1635 | Open in IMG/M |
3300004114|Ga0062593_100789129 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300004479|Ga0062595_100394885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
3300004643|Ga0062591_101240614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 729 | Open in IMG/M |
3300005332|Ga0066388_105587074 | Not Available | 637 | Open in IMG/M |
3300005332|Ga0066388_107402522 | Not Available | 551 | Open in IMG/M |
3300005334|Ga0068869_101962478 | Not Available | 525 | Open in IMG/M |
3300005336|Ga0070680_101313499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300005338|Ga0068868_101093700 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005436|Ga0070713_100723370 | Not Available | 951 | Open in IMG/M |
3300005441|Ga0070700_100739104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
3300005445|Ga0070708_100982083 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005458|Ga0070681_11583463 | Not Available | 580 | Open in IMG/M |
3300005459|Ga0068867_102183555 | Not Available | 525 | Open in IMG/M |
3300005467|Ga0070706_102038633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300005526|Ga0073909_10051013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
3300005526|Ga0073909_10659507 | Not Available | 521 | Open in IMG/M |
3300005536|Ga0070697_101054496 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300005536|Ga0070697_101207986 | Not Available | 674 | Open in IMG/M |
3300005542|Ga0070732_10272072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300005546|Ga0070696_100129863 | Not Available | 1832 | Open in IMG/M |
3300005577|Ga0068857_101856664 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005618|Ga0068864_100450211 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300005713|Ga0066905_101403192 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300005718|Ga0068866_10222331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
3300005764|Ga0066903_100412319 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
3300005764|Ga0066903_108144249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300005844|Ga0068862_101052331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300005937|Ga0081455_10137979 | Not Available | 1897 | Open in IMG/M |
3300006050|Ga0075028_100133668 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300006058|Ga0075432_10461643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300006606|Ga0074062_12174329 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006797|Ga0066659_10443681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1030 | Open in IMG/M |
3300006797|Ga0066659_10971090 | Not Available | 710 | Open in IMG/M |
3300006852|Ga0075433_10665689 | Not Available | 912 | Open in IMG/M |
3300006852|Ga0075433_10875347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300006852|Ga0075433_10928187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300006904|Ga0075424_101196284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300009098|Ga0105245_12522089 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009147|Ga0114129_12953916 | Not Available | 560 | Open in IMG/M |
3300009551|Ga0105238_10834076 | Not Available | 938 | Open in IMG/M |
3300009551|Ga0105238_10956394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
3300009660|Ga0105854_1308400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300010043|Ga0126380_10708238 | Not Available | 810 | Open in IMG/M |
3300010047|Ga0126382_11386240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300010048|Ga0126373_11417642 | Not Available | 760 | Open in IMG/M |
3300010320|Ga0134109_10346003 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300010360|Ga0126372_12159176 | Not Available | 605 | Open in IMG/M |
3300010360|Ga0126372_12645485 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010361|Ga0126378_12496510 | Not Available | 590 | Open in IMG/M |
3300010362|Ga0126377_12271477 | Not Available | 619 | Open in IMG/M |
3300010362|Ga0126377_12550607 | Not Available | 587 | Open in IMG/M |
3300010362|Ga0126377_12719920 | Not Available | 570 | Open in IMG/M |
3300010362|Ga0126377_13023623 | Not Available | 543 | Open in IMG/M |
3300010366|Ga0126379_10086460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2738 | Open in IMG/M |
3300010366|Ga0126379_12904144 | Not Available | 573 | Open in IMG/M |
3300010397|Ga0134124_11511287 | Not Available | 700 | Open in IMG/M |
3300010401|Ga0134121_11726732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 650 | Open in IMG/M |
3300010880|Ga0126350_10721127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2345 | Open in IMG/M |
3300011270|Ga0137391_10207223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1704 | Open in IMG/M |
3300011270|Ga0137391_11197551 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300012198|Ga0137364_11456586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300012212|Ga0150985_110238827 | Not Available | 595 | Open in IMG/M |
3300012469|Ga0150984_111649295 | Not Available | 588 | Open in IMG/M |
3300012685|Ga0137397_11019925 | Not Available | 608 | Open in IMG/M |
3300012922|Ga0137394_10423998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300012986|Ga0164304_10700735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300013296|Ga0157374_11027797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300014325|Ga0163163_10635649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
3300014969|Ga0157376_10105904 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
3300015242|Ga0137412_10610899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
3300015373|Ga0132257_102751020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 641 | Open in IMG/M |
3300015374|Ga0132255_101882376 | Not Available | 909 | Open in IMG/M |
3300016341|Ga0182035_11010145 | Not Available | 737 | Open in IMG/M |
3300017657|Ga0134074_1363398 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300018482|Ga0066669_12311595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 513 | Open in IMG/M |
3300021080|Ga0210382_10430033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300021478|Ga0210402_10633966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300021861|Ga0213853_11175853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300025885|Ga0207653_10067519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1217 | Open in IMG/M |
3300025901|Ga0207688_10387594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
3300025914|Ga0207671_10872538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300025924|Ga0207694_10744656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300025925|Ga0207650_10466244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300025928|Ga0207700_10925982 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300025928|Ga0207700_11491746 | Not Available | 600 | Open in IMG/M |
3300025934|Ga0207686_10449423 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300025934|Ga0207686_10842700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300025934|Ga0207686_11666892 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300025936|Ga0207670_10625972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
3300025941|Ga0207711_11696896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 575 | Open in IMG/M |
3300026023|Ga0207677_10292520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
3300026023|Ga0207677_11475699 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300026095|Ga0207676_11537468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300026216|Ga0209903_1068485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300026555|Ga0179593_1108020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2914 | Open in IMG/M |
3300027483|Ga0207637_1010232 | Not Available | 516 | Open in IMG/M |
3300027523|Ga0208890_1087108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300027910|Ga0209583_10071363 | Not Available | 1275 | Open in IMG/M |
3300027915|Ga0209069_10228924 | Not Available | 959 | Open in IMG/M |
3300028380|Ga0268265_11111952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300031226|Ga0307497_10288081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 748 | Open in IMG/M |
3300031366|Ga0307506_10462328 | Not Available | 531 | Open in IMG/M |
3300031366|Ga0307506_10528878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300031561|Ga0318528_10464225 | Not Available | 680 | Open in IMG/M |
3300031740|Ga0307468_101875819 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300031770|Ga0318521_10661744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 633 | Open in IMG/M |
3300031777|Ga0318543_10578679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300031793|Ga0318548_10151771 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300031821|Ga0318567_10593952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300031910|Ga0306923_11568924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
3300031912|Ga0306921_12369062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300031996|Ga0308176_12361018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300032009|Ga0318563_10224517 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300032039|Ga0318559_10487802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300032089|Ga0318525_10408042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 696 | Open in IMG/M |
3300032163|Ga0315281_11033098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
3300032174|Ga0307470_11594445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300032770|Ga0335085_11763718 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300032770|Ga0335085_11928942 | Not Available | 601 | Open in IMG/M |
3300032893|Ga0335069_11807201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300033004|Ga0335084_11941464 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300033806|Ga0314865_110496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 724 | Open in IMG/M |
3300034268|Ga0372943_0139494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1464 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.12% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.12% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.34% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.78% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.78% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027483 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F47_06899190 | 2170459009 | Grass Soil | YTHATARLSYREQPVLVQVSLMHRGGIGTSAPTAHGSAVVRGLEGFVDLFVTQIHDANK |
JGI1357J11328_102112342 | 3300000574 | Groundwater | HATAKLSYHDRPVLVQVSLMHHGGIGGGAPPAHGPEVLRGLEHFIDLFVTQIHDANK* |
YBBDRAFT_11498444 | 3300001372 | Marine Estuarine | QPVLVQVSLIHRGGIGTSAIATHPAAVLHGLEGYVDVFLAQIRDANK* |
Ga0062593_1001854692 | 3300004114 | Soil | AAKLSYRDQPVLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFVTQIRDANK* |
Ga0062593_1007891291 | 3300004114 | Soil | RLSYRDQPILAQVSLIHRGGLSSSASGAHAAAVTKGLEDYIDLFITQIRNANKD* |
Ga0062595_1003948852 | 3300004479 | Soil | YTHAAAKLSYRDQPVLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFVTQIRDANK* |
Ga0062591_1012406142 | 3300004643 | Soil | RETPVLVQVSLMHRGGISGGALSTHLASVVRGLQNDVDLLVTQIHDANK* |
Ga0066388_1055870742 | 3300005332 | Tropical Forest Soil | SYAQKPVLVQVSLMHRGGIGTSAAAGHAAAVARGLEGYVDLVVAQIRGANQTP* |
Ga0066388_1074025222 | 3300005332 | Tropical Forest Soil | LVQVSLMHRGGIGNSAPSSHGAAVSRALEGYVDLFVTQIRAANK* |
Ga0068869_1019624781 | 3300005334 | Miscanthus Rhizosphere | SLMHRGGLGTSAPAAHGTAVVRGLEGYVDLFITQIKDANK* |
Ga0070680_1013134992 | 3300005336 | Corn Rhizosphere | QPVLVQVSLMHRGGIGSSVPGAHGAAVGRGLQDYVDLFITQIRDANK* |
Ga0068868_1010937002 | 3300005338 | Miscanthus Rhizosphere | VLVQVSLMHRGGLGTSAPGAHGTAVVRGLEGYVDLFVTQIKDANK* |
Ga0070713_1007233703 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLMHRGGIGSSGIASHAAAVQKGLEGYVDLFLTQIRDANK* |
Ga0070700_1007391041 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | SYRDQPVLAQVSLIHRGGMATSGPAAHAASVTRGLENYVDLFVTQIRDANK* |
Ga0070708_1009820831 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LVQVSLMHRGGLGSSAPIGHATAVARGLADYVDLFVTQIRDANK* |
Ga0070681_115834632 | 3300005458 | Corn Rhizosphere | TAKLAYRDQPVLVQVSLMHRGGIGTTGVVSHAATVARGLESYIDLFVTQIQSANK* |
Ga0068867_1021835552 | 3300005459 | Miscanthus Rhizosphere | VLAQVSLMHRGGMGSSAPSAHAAEITRGLENYVDAFIKQVKDANK* |
Ga0070706_1020386331 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AYHDRPVLVQISLAHRGGIGSSASTAHAAAVGRGLESFVDLFITQIHDANK* |
Ga0073909_100510131 | 3300005526 | Surface Soil | TNATASVSYRDQPVLVQVSLIHRGGIATSAPASHSSTVTRGLENYLDLFITQIRDANK* |
Ga0073909_106595072 | 3300005526 | Surface Soil | HRGGIGTSGVTAHAASVQRGLEGYVDVFVSQIQQANR* |
Ga0070697_1010544962 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HDQPVLVQVSLMHRGGIGSSAPTGHAAAVVHGLENFVDLFITQIHDANK* |
Ga0070697_1012079862 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLMHRGGIGSSAPAAHASAVARGLESYVDLVVQQIRDANR* |
Ga0070732_102720722 | 3300005542 | Surface Soil | KLSYHDQPVLVQVSLMHRGGIGSSAPTGHAAAVVRGLVNYVDLFVTQIHDANK* |
Ga0070696_1001298631 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LYTHATAKVAYHDRPVLVQISLAHRGGIGSSASTAHAAAVGRGLETFVDLFITQIRDANK |
Ga0068857_1018566641 | 3300005577 | Corn Rhizosphere | PVLVQVSLMHRGGIGSSVPSAHPAAVIRGLEGYIDLFITQIRDANK* |
Ga0068864_1004502113 | 3300005618 | Switchgrass Rhizosphere | YRDQPVLVQVSLIHRGGIATSSPASHSSTVTRGLENYVDLFITQIRDANK* |
Ga0066905_1014031921 | 3300005713 | Tropical Forest Soil | PVLAQVSLMHRGGLGASAVAVHSASVLRGLEGYVDIFVMQIRDANK* |
Ga0068866_102223311 | 3300005718 | Miscanthus Rhizosphere | LYTHATARLTYREQPVLVQVSLMHRGVIGASTVAGHAAAVSRGLESYVDVFVTQIRDANK |
Ga0066903_1004123191 | 3300005764 | Tropical Forest Soil | SYRQQPVLVQVSLMHRGGIGTSAPVGHAAAVTRGLEGYIDLFVEQIREANK* |
Ga0066903_1081442491 | 3300005764 | Tropical Forest Soil | TAKLSYRDQPVLVQVSLIHRGGIGSSAQPVHAAAVVRGLEGQIDLLVTQIRDANK* |
Ga0068862_1010523312 | 3300005844 | Switchgrass Rhizosphere | VLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFVTQIRDANK* |
Ga0081455_101379792 | 3300005937 | Tabebuia Heterophylla Rhizosphere | YTHATANLTYRDRPVLVQVSLMHRGGIGTSAPAAHGAAVQRGLEGYVDLFITQIRDANK* |
Ga0075028_1001336681 | 3300006050 | Watersheds | RDQPVLVQVSLIHRGGIGTSTPTAHSAAVVRGLEGYIDLFVTQVHDANK* |
Ga0075432_104616432 | 3300006058 | Populus Rhizosphere | LSYRERPVLVQVSLMHRGGMGSSAPAGHAAAVGRGLESYIDLFVDQIRNANK* |
Ga0074062_121743292 | 3300006606 | Soil | DQPVLVQVSLIHRGGIGSSVPAAHAGAVGRGLESYIDPFVTQIRDANK* |
Ga0066659_104436811 | 3300006797 | Soil | THATARLAYRDQPVLVQVSLMHRGGIGSSAIATHAAAVSRGLEAYIDLFVTQIRDANK* |
Ga0066659_109710901 | 3300006797 | Soil | HRGGIGSSAIATHAAAVSRGLEGYIDLFVTQIRDANK* |
Ga0075433_106656892 | 3300006852 | Populus Rhizosphere | QVSLMHRGGIGTSAPTGHAAAVTRGLETYVDLFITQIRDANK* |
Ga0075433_108753472 | 3300006852 | Populus Rhizosphere | VQVSLMHRGGITTSAPASHSSTVARGLENYVDLFITQIRDANK* |
Ga0075433_109281872 | 3300006852 | Populus Rhizosphere | VQVSLMHRGGIGSSAPAAHAAAVARGLENYIDLIVTQIRDANK* |
Ga0075424_1011962841 | 3300006904 | Populus Rhizosphere | LYTHGTAKLSYREQPVLVQVSLMHRGGLGSSAPAGHASAVARGLENYVDLFVTQIHDANK |
Ga0105245_125220891 | 3300009098 | Miscanthus Rhizosphere | QPVLVQVSLMHRGGLGTSAPAAHGTAVVRGLEGYVDLFVTQIKDANK* |
Ga0114129_129539161 | 3300009147 | Populus Rhizosphere | YRDQPVLVQVSLMHRGSIGSSAPAGHAAAVAHGLEGFVDLFIAQIRDANK* |
Ga0105238_108340761 | 3300009551 | Corn Rhizosphere | RPVLVQVSLMHRGGIGVSGLSSHAASIARGLEGYVDVFVTQIRDANK* |
Ga0105238_109563942 | 3300009551 | Corn Rhizosphere | PVLVQVSLMHRGGIGTSAPAAHSAAVVRGLTGYVDLFVTQIRDANK* |
Ga0105854_13084002 | 3300009660 | Permafrost Soil | LSYHDQPVLVQVSLMHRGGMGTSAPTAHGAAVVRGLEEYVDLFITQIRDANK* |
Ga0126380_107082383 | 3300010043 | Tropical Forest Soil | AKLTYREQPVLVQVSLMHRGGIGTSSAAAHPAAVSRGLGGYIDVFVTQIRDANK* |
Ga0126382_113862402 | 3300010047 | Tropical Forest Soil | RPVLVQVSLIHRGGIGSSAPSAHAATIARGLESYIDLFVTQIRQANK* |
Ga0126373_114176423 | 3300010048 | Tropical Forest Soil | VSLMHRAGIGSSAAASHAAAVSHGLEGYVDLFVSQIRDANK* |
Ga0134109_103460032 | 3300010320 | Grasslands Soil | VSLIHRGGMGSSAPTGHAAAVSRGLETYVDLFITQIREANK* |
Ga0126372_121591761 | 3300010360 | Tropical Forest Soil | LMHRGGMTSGPPGAHAVSVGRGLEGYIDLIVSQIRDANK* |
Ga0126372_126454852 | 3300010360 | Tropical Forest Soil | TATLSYRDRPVLVQVSLMHRGGMTSGVPPAHATTVTRGLEAYVDTFMTQIREANK* |
Ga0126378_124965102 | 3300010361 | Tropical Forest Soil | GIGTSAPVGHAGAVTRGLENYVDLFVTQIHDANK* |
Ga0126377_122714771 | 3300010362 | Tropical Forest Soil | PVLVQVSLMHRGGIGTSAPTAHAAAVTRGLETYVDLIVSQIQSANK* |
Ga0126377_125506071 | 3300010362 | Tropical Forest Soil | SGIAASASALHASTLTRGLEQYIDLVITQIRDANK* |
Ga0126377_127199201 | 3300010362 | Tropical Forest Soil | RGGIGASAMAVHSASVLRGLDGYIDLFVMQIRQANQ* |
Ga0126377_130236232 | 3300010362 | Tropical Forest Soil | VSLMHRGGIGTSAPTAHAAAVTRGLEGYVDLIVSQIQQANK* |
Ga0126379_100864601 | 3300010366 | Tropical Forest Soil | ANQSYRDRPVLVQVSLMHRGGIGSSVPASHAAAVSRGLENYVDLIVTQIKNANK* |
Ga0126379_129041441 | 3300010366 | Tropical Forest Soil | HRGGIGSSAPAGHAGAVTRALEGYADVMVSQIRSANQ* |
Ga0134124_115112871 | 3300010397 | Terrestrial Soil | ASLSYRDQPVLVQVSLMHRGGIGSSAPVSHATAVTRGLENFIDLFVSQIRGANQ* |
Ga0134121_117267322 | 3300010401 | Terrestrial Soil | MHRGGISGGALSTHAATVVRGLQNYIDLFVTQIHDANK* |
Ga0126350_107211272 | 3300010880 | Boreal Forest Soil | LSYRDQPVLVQVSLMHRGGIGTSAPTAHSTAVVRGLEGYIDLFVTQVHDANK* |
Ga0137391_102072233 | 3300011270 | Vadose Zone Soil | VLVQVSLMHRGGIGTSAAAAHGAAVVRGLEDYIDLFVTQIHAANK* |
Ga0137391_111975512 | 3300011270 | Vadose Zone Soil | YGDRPALVQVSLMHRGGLGSSAPTGHATAVARGLADYVDLFVTQIRDANK* |
Ga0137364_114565862 | 3300012198 | Vadose Zone Soil | IHRGGIGSSAPVGHAGAVTRGLEDYVGLFVTQIRDANK* |
Ga0150985_1102388273 | 3300012212 | Avena Fatua Rhizosphere | VSLMHRGGIGASGVAGHAAAVSRGLEGYVDVFVTQIRDANK* |
Ga0150984_1116492953 | 3300012469 | Avena Fatua Rhizosphere | SLMHRGGIGASGVAGHAAAVSRGLEGYVDVFVTQIRDANK* |
Ga0137397_110199251 | 3300012685 | Vadose Zone Soil | RGGIGSSAPAAHGAAVTRGLESYVDLFMTQIHDANK* |
Ga0137394_104239982 | 3300012922 | Vadose Zone Soil | VLVQVSLMHRGGIGSSAIATHAAAVSRGLEGYIDLFVTQIRDANK* |
Ga0164304_107007351 | 3300012986 | Soil | GKPPYPHPAGVVPVSLMHRGGIGSSAQPGHAAAVTRGLENQIDLFVTQIRDANK* |
Ga0157374_110277972 | 3300013296 | Miscanthus Rhizosphere | AKLSYRDQPVLVQVSLMHRGGIGTSAPSAHGAAVVRGLAGYVDLFVTQIRDANK* |
Ga0163163_106356493 | 3300014325 | Switchgrass Rhizosphere | EQPVLVQVSLMHRGGIGASAVSGHAAAVSRGLESYVDVFVTQIRDANK* |
Ga0157376_101059041 | 3300014969 | Miscanthus Rhizosphere | GIGTSAPASHAAAVARGLQGYIDLFVTQIHDANK* |
Ga0137412_106108992 | 3300015242 | Vadose Zone Soil | LSYREQPVLVQVSLMHRGGIGTSAPTAHSAAVVRGLEGYIDLFVTQIHDANK* |
Ga0132257_1027510202 | 3300015373 | Arabidopsis Rhizosphere | LIHRGGIATSAPALHSPTVTRGLESYIDLFVTQIRDANK* |
Ga0132255_1018823761 | 3300015374 | Arabidopsis Rhizosphere | VLVQVSLMHRGGISASSMASHAASVSRGLEGYVDVFLMQIATANK* |
Ga0182035_110101452 | 3300016341 | Soil | ERPVLVQVSLMHRGGIGTSAPSAHAAAVTHGLENYIDLVMTQIHDANK |
Ga0134074_13633981 | 3300017657 | Grasslands Soil | HQQPVLVQVSLLHRGGIGASGVASHAAAVSRGLEGYVDLFVTQIRDANK |
Ga0066669_123115952 | 3300018482 | Grasslands Soil | KLSYRDQSVLAQVSLMHRGSIGTSTPTTHAAAVARGLENYVDLFVTQIHDANK |
Ga0210382_104300332 | 3300021080 | Groundwater Sediment | EQPVLVQVSLMHRGGIGSSAPAAHGAAVVSALENFIDLFMTQIHDANR |
Ga0210402_106339662 | 3300021478 | Soil | GGIGASAIGPHSASVVRGLEGYVDVFVSQIRDANK |
Ga0213853_111758532 | 3300021861 | Watersheds | VSLMHRGGIGSSAPTAHAAAVVRGLQNYVDLFVTQVRDANK |
Ga0207653_100675193 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | QVSLIHRGGLSSSASGAHAAAVTKGLEDYIDLFITQIRNANKD |
Ga0207688_103875942 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AAKLSYRDQPVLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFVTQIRDANK |
Ga0207671_108725382 | 3300025914 | Corn Rhizosphere | DRPVLVQVSLMHRGGIGTSAPASHAAAVARGLQGYIDLFVTQIHDANK |
Ga0207694_107446563 | 3300025924 | Corn Rhizosphere | RPVLVQVSLMHRGGIGVSGLSSHAASIARGLEGYVDVFVTQIRDANK |
Ga0207650_104662441 | 3300025925 | Switchgrass Rhizosphere | AKLSYRDQAVLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFISQIRAANK |
Ga0207700_109259822 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVQVSLIHRGGIGASAPATHAATVGRGLQNYIDLVVTQIHDANK |
Ga0207700_114917461 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLMHRGGIGSSGIASHAAAVQKGLEGYVDLFLTQIRDANK |
Ga0207686_104494231 | 3300025934 | Miscanthus Rhizosphere | ATAKLSYREQPVLVQVSLMHRGGLGTSAPGAHGTAVVRGLEGYVDLFVTQIKDANK |
Ga0207686_108427002 | 3300025934 | Miscanthus Rhizosphere | VLVQVSLMHRGGIGSSGTPAAHAAAVVHGLENYIDLFVTQIHAANK |
Ga0207686_116668921 | 3300025934 | Miscanthus Rhizosphere | SYREQPVLVQVSLMHRGGLGTSAPAAHGTAVVRGLEGYVDLFVTQIKDANK |
Ga0207670_106259722 | 3300025936 | Switchgrass Rhizosphere | MHRGGIGTSAPAGHGAAVGRGLAGYIDLFVTQIRDANK |
Ga0207711_116968962 | 3300025941 | Switchgrass Rhizosphere | QVSLIHRGGIATSAPALHSPTVTRGLENYIDLFVTQIRDANK |
Ga0207677_102925201 | 3300026023 | Miscanthus Rhizosphere | ARLTYREQPVLVQVSLMHRGGIGASAVSGHAAAVSRGLESYVDVFVTQIRDANK |
Ga0207677_114756992 | 3300026023 | Miscanthus Rhizosphere | RGGLGTSAPGAHGTAVVRGLEGYVDLFVTQIKDANK |
Ga0207676_115374682 | 3300026095 | Switchgrass Rhizosphere | SLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFITQIRDANK |
Ga0209903_10684851 | 3300026216 | Soil | KPVLVQVSLIHRGGIGTSASTAHGTAVVRGLEGYIDLFITQVRDANK |
Ga0179593_11080204 | 3300026555 | Vadose Zone Soil | LSYREQQVLVAGVADAPAAAIGTSAPTAHSSAVVRGLEGYIDLFVTQIHDANK |
Ga0207637_10102321 | 3300027483 | Soil | VLVQVSLMHRGGISGGALSTHAASVVRGLQNDVDVIVTQVRDANK |
Ga0208890_10871081 | 3300027523 | Soil | AYHEQPVLVQVSLIHRGGIGASTTTGHAAAVSRGLEGYIDIFLTQIRDANK |
Ga0209583_100713632 | 3300027910 | Watersheds | LSYRDKSVLVQVSLMHRGGIGSSAAAAHAAAVTGGLQGYVDVFVTQVRDANK |
Ga0209069_102289242 | 3300027915 | Watersheds | SVLVQVSLMHRGGIGSSAAAAHAAAVTGGLQGYVDLFVTQVRDANK |
Ga0268265_111119522 | 3300028380 | Switchgrass Rhizosphere | PVLVQVSLMHRGGIGTSAPSAHGAAVGRGLAGYVDLFISQIRAANK |
Ga0307497_102880811 | 3300031226 | Soil | VSLMHRGGIGSSAQAAHAAAVTRGLESHLDLFVTQIRDANK |
Ga0307506_104623282 | 3300031366 | Soil | VQVSLMHRGGIGTSSVAGHAASVSRGLENYVDLFLTQIQTANK |
Ga0307506_105288782 | 3300031366 | Soil | TARLTYREQPVLVQVSLTHRGGIGASAVSGHAAAVSRGLESYIDVFVTQIRDANK |
Ga0318528_104642252 | 3300031561 | Soil | SYTERPVLVQVSLMHRGGIGTSAPSAHAAAVTHGLENYIDLVMTQIHDANK |
Ga0307469_108624842 | 3300031720 | Hardwood Forest Soil | LVQVSLMHRGGLASGVPPAHATTVTHGLEAYADTFMTQIRDANK |
Ga0307468_1018758192 | 3300031740 | Hardwood Forest Soil | DQPVLVQVSLMHRGGMGSSAPVGHAAAVSRGLENYLDLFITQVRDANK |
Ga0318521_106617442 | 3300031770 | Soil | LMHRGGMASSAPSAHATGVTRGLEGYVDLLVTQVRDANK |
Ga0318543_105786792 | 3300031777 | Soil | HERPVLVQVSLMHRGGIGASAVAAHGASVLRGLEGYVDVFVTQIRDANR |
Ga0318548_101517711 | 3300031793 | Soil | GGIGSSAPVGHAAAVTRGLENYVDLFVTQIRDANK |
Ga0318567_105939522 | 3300031821 | Soil | RDRPVLVQVSLMHRGGIGTSAPAAHAAAVARGLQGYIDLFITQIHDANK |
Ga0306923_115689242 | 3300031910 | Soil | YRDRPVLVQVSLMHRGGMGSSAPTGHAAAVTRALEDYLGGFITQIRDANK |
Ga0306921_123690622 | 3300031912 | Soil | SYHERPVLVQVSLMHRGGIGASAMAVHSASVLRGLEGYVDVFVTQIRDANK |
Ga0308176_123610182 | 3300031996 | Soil | SYRDQPVLVQVSLMHRGGIGTSAPSAHGAAVMRGLAGYVDLFVTQIRDANK |
Ga0318563_102245171 | 3300032009 | Soil | LSYRDQPVLVQVSLMHRGGIGSSAPVGHAAAVTRGLENYVDLFVTQIRDANK |
Ga0318559_104878022 | 3300032039 | Soil | YTQGTATLSYRDRPVLVQVSLMHRGGIGTSAPAAHAAAVARGLQGYIDLFITQIHDANK |
Ga0318525_104080421 | 3300032089 | Soil | VYLYTHATAKVSCRDQAVLVQVSLMHRGGMASSAPSAHATGVTRGLEGYVDLLVTQVRDANK |
Ga0315281_110330981 | 3300032163 | Sediment | KLSHRDQPVLVQVSLMHRGSIDSSVVSGHAAAVTRGLASYIDAFVTQIQSANK |
Ga0307470_115944451 | 3300032174 | Hardwood Forest Soil | LSYRDQPVLVQVSLMHRGGLGSSAPSAHAAAVTRGLETYLDLFMTQIRDANK |
Ga0335085_117637182 | 3300032770 | Soil | LVQVSLMHRGGLGTSGPSAHAAAVTRGLEGYVDLFLTQIRDANK |
Ga0335085_119289421 | 3300032770 | Soil | SLIHRGGIGASAAAGHASAVSRGLEGYIDVFLTQIRDANK |
Ga0335069_118072012 | 3300032893 | Soil | SYREQPVLVQVSLMHRGGIGTSGMTSHSAAVTRGLEAYVDLFLSQIHDANK |
Ga0335084_119414641 | 3300033004 | Soil | QISLMHRGSIGSSSAPGTHAAAVARGLESYVDLFLTQIKNANK |
Ga0314865_110496_549_722 | 3300033806 | Peatland | HATATLSYREQPALVQVSLMHRGGIGSSAPAGHASAVSRALEGYVDVFVTQIRDANR |
Ga0372943_0139494_1310_1426 | 3300034268 | Soil | MHRGGIGNSAPSAHPAAVVRGLVSFVDLFVTQIRDANK |
⦗Top⦘ |