| Basic Information | |
|---|---|
| Family ID | F065244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.94 % |
| % of genes near scaffold ends (potentially truncated) | 95.31 % |
| % of genes from short scaffolds (< 2000 bps) | 92.97 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.312 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.656 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00884 | Sulfatase | 17.19 |
| PF03631 | Virul_fac_BrkB | 11.72 |
| PF07080 | DUF1348 | 7.03 |
| PF12697 | Abhydrolase_6 | 3.91 |
| PF05721 | PhyH | 2.34 |
| PF03060 | NMO | 2.34 |
| PF07676 | PD40 | 1.56 |
| PF07690 | MFS_1 | 1.56 |
| PF06197 | DUF998 | 1.56 |
| PF10006 | DUF2249 | 1.56 |
| PF04343 | DUF488 | 1.56 |
| PF00923 | TAL_FSA | 1.56 |
| PF16657 | Malt_amylase_C | 0.78 |
| PF12833 | HTH_18 | 0.78 |
| PF13237 | Fer4_10 | 0.78 |
| PF03663 | Glyco_hydro_76 | 0.78 |
| PF00685 | Sulfotransfer_1 | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF03176 | MMPL | 0.78 |
| PF04972 | BON | 0.78 |
| PF07992 | Pyr_redox_2 | 0.78 |
| PF02374 | ArsA_ATPase | 0.78 |
| PF08281 | Sigma70_r4_2 | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 11.72 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 7.03 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 2.34 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 2.34 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.34 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 1.56 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 1.56 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.56 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.78 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.78 |
| COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.38 % |
| Unclassified | root | N/A | 40.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01AT1VC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 2189573004|GZGWRS401CMC7A | Not Available | 500 | Open in IMG/M |
| 3300001418|JGI20188J14859_1031562 | Not Available | 514 | Open in IMG/M |
| 3300005332|Ga0066388_107516978 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005445|Ga0070708_100152126 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300005614|Ga0068856_100223599 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300006031|Ga0066651_10034755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2281 | Open in IMG/M |
| 3300006049|Ga0075417_10127969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300006575|Ga0074053_12008685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300006606|Ga0074062_12988105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1292 | Open in IMG/M |
| 3300006806|Ga0079220_10354109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 935 | Open in IMG/M |
| 3300006903|Ga0075426_10066276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2580 | Open in IMG/M |
| 3300006953|Ga0074063_10048825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300009012|Ga0066710_101738788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300009137|Ga0066709_104050249 | Not Available | 533 | Open in IMG/M |
| 3300009147|Ga0114129_10094453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4141 | Open in IMG/M |
| 3300009148|Ga0105243_11268972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300009520|Ga0116214_1102905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1051 | Open in IMG/M |
| 3300010043|Ga0126380_10790970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300010048|Ga0126373_10232084 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300010048|Ga0126373_10235241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
| 3300010301|Ga0134070_10320242 | Not Available | 595 | Open in IMG/M |
| 3300010358|Ga0126370_10100828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1997 | Open in IMG/M |
| 3300010358|Ga0126370_10843733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300010359|Ga0126376_10289045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
| 3300010359|Ga0126376_11343655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300010360|Ga0126372_10554860 | Not Available | 1092 | Open in IMG/M |
| 3300010361|Ga0126378_11280931 | Not Available | 829 | Open in IMG/M |
| 3300010361|Ga0126378_12613971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300010376|Ga0126381_101736356 | Not Available | 901 | Open in IMG/M |
| 3300010376|Ga0126381_103599112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300010376|Ga0126381_104772380 | Not Available | 521 | Open in IMG/M |
| 3300010376|Ga0126381_105128530 | Not Available | 501 | Open in IMG/M |
| 3300011270|Ga0137391_10889756 | Not Available | 729 | Open in IMG/M |
| 3300011271|Ga0137393_10876412 | Not Available | 766 | Open in IMG/M |
| 3300012201|Ga0137365_10374494 | Not Available | 1051 | Open in IMG/M |
| 3300012206|Ga0137380_11476012 | Not Available | 565 | Open in IMG/M |
| 3300012359|Ga0137385_11362072 | Not Available | 573 | Open in IMG/M |
| 3300012957|Ga0164303_10610164 | Not Available | 720 | Open in IMG/M |
| 3300012971|Ga0126369_11927688 | Not Available | 679 | Open in IMG/M |
| 3300016371|Ga0182034_11654593 | Not Available | 563 | Open in IMG/M |
| 3300016387|Ga0182040_10275343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1276 | Open in IMG/M |
| 3300016404|Ga0182037_11140885 | Not Available | 683 | Open in IMG/M |
| 3300016404|Ga0182037_11224681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium | 660 | Open in IMG/M |
| 3300016445|Ga0182038_10284124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300016445|Ga0182038_11315530 | Not Available | 646 | Open in IMG/M |
| 3300016445|Ga0182038_11590421 | Not Available | 588 | Open in IMG/M |
| 3300017966|Ga0187776_10084783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1861 | Open in IMG/M |
| 3300018058|Ga0187766_10694634 | Not Available | 702 | Open in IMG/M |
| 3300018086|Ga0187769_10938850 | Not Available | 655 | Open in IMG/M |
| 3300020581|Ga0210399_11200276 | Not Available | 602 | Open in IMG/M |
| 3300021403|Ga0210397_10003970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9092 | Open in IMG/M |
| 3300021407|Ga0210383_11374206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300021432|Ga0210384_11901821 | Not Available | 501 | Open in IMG/M |
| 3300021478|Ga0210402_11893976 | Not Available | 522 | Open in IMG/M |
| 3300021560|Ga0126371_10324778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1670 | Open in IMG/M |
| 3300021560|Ga0126371_10428928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1466 | Open in IMG/M |
| 3300025878|Ga0209584_10012876 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300025912|Ga0207707_10482805 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300025929|Ga0207664_10268072 | Not Available | 1495 | Open in IMG/M |
| 3300025931|Ga0207644_10790334 | Not Available | 794 | Open in IMG/M |
| 3300026023|Ga0207677_10911509 | Not Available | 793 | Open in IMG/M |
| 3300026023|Ga0207677_12182611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300027862|Ga0209701_10476453 | Not Available | 682 | Open in IMG/M |
| 3300028782|Ga0307306_10169786 | Not Available | 614 | Open in IMG/M |
| 3300028799|Ga0307284_10395273 | Not Available | 562 | Open in IMG/M |
| 3300028811|Ga0307292_10464720 | Not Available | 541 | Open in IMG/M |
| 3300028819|Ga0307296_10339492 | Not Available | 820 | Open in IMG/M |
| 3300028885|Ga0307304_10178483 | Not Available | 899 | Open in IMG/M |
| 3300031546|Ga0318538_10130766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1317 | Open in IMG/M |
| 3300031549|Ga0318571_10220622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium | 686 | Open in IMG/M |
| 3300031640|Ga0318555_10003212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6274 | Open in IMG/M |
| 3300031640|Ga0318555_10245350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 967 | Open in IMG/M |
| 3300031640|Ga0318555_10621560 | Not Available | 585 | Open in IMG/M |
| 3300031668|Ga0318542_10199198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
| 3300031682|Ga0318560_10587371 | Not Available | 603 | Open in IMG/M |
| 3300031708|Ga0310686_103798341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300031713|Ga0318496_10246752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 984 | Open in IMG/M |
| 3300031719|Ga0306917_10716086 | Not Available | 786 | Open in IMG/M |
| 3300031719|Ga0306917_11366327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300031723|Ga0318493_10188360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300031723|Ga0318493_10744285 | Not Available | 551 | Open in IMG/M |
| 3300031724|Ga0318500_10592580 | Not Available | 561 | Open in IMG/M |
| 3300031744|Ga0306918_10481938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 971 | Open in IMG/M |
| 3300031748|Ga0318492_10167971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1112 | Open in IMG/M |
| 3300031751|Ga0318494_10167320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1243 | Open in IMG/M |
| 3300031754|Ga0307475_11227742 | Not Available | 583 | Open in IMG/M |
| 3300031768|Ga0318509_10134295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1357 | Open in IMG/M |
| 3300031770|Ga0318521_11017548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300031777|Ga0318543_10132988 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300031778|Ga0318498_10134895 | Not Available | 1123 | Open in IMG/M |
| 3300031779|Ga0318566_10402552 | Not Available | 674 | Open in IMG/M |
| 3300031780|Ga0318508_1202484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300031781|Ga0318547_10231433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
| 3300031781|Ga0318547_10651638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 654 | Open in IMG/M |
| 3300031794|Ga0318503_10077661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1039 | Open in IMG/M |
| 3300031796|Ga0318576_10641882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300031797|Ga0318550_10162953 | Not Available | 1074 | Open in IMG/M |
| 3300031832|Ga0318499_10098189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1132 | Open in IMG/M |
| 3300031832|Ga0318499_10125423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300031833|Ga0310917_10606474 | Not Available | 743 | Open in IMG/M |
| 3300031833|Ga0310917_10775010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300031845|Ga0318511_10033702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1974 | Open in IMG/M |
| 3300031879|Ga0306919_10581918 | Not Available | 864 | Open in IMG/M |
| 3300031894|Ga0318522_10128245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300031896|Ga0318551_10094754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1581 | Open in IMG/M |
| 3300031912|Ga0306921_12287542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300031939|Ga0308174_10851270 | Not Available | 768 | Open in IMG/M |
| 3300031942|Ga0310916_10907082 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031947|Ga0310909_10452696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
| 3300031954|Ga0306926_10883686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1071 | Open in IMG/M |
| 3300032001|Ga0306922_10643231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1120 | Open in IMG/M |
| 3300032008|Ga0318562_10167280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1269 | Open in IMG/M |
| 3300032009|Ga0318563_10645668 | Not Available | 569 | Open in IMG/M |
| 3300032035|Ga0310911_10912224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium asiaticum | 507 | Open in IMG/M |
| 3300032052|Ga0318506_10316567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300032052|Ga0318506_10515421 | Not Available | 530 | Open in IMG/M |
| 3300032055|Ga0318575_10124644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
| 3300032065|Ga0318513_10623642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300032067|Ga0318524_10436789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300032068|Ga0318553_10359407 | Not Available | 762 | Open in IMG/M |
| 3300032261|Ga0306920_103796476 | Not Available | 552 | Open in IMG/M |
| 3300032770|Ga0335085_10271233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2027 | Open in IMG/M |
| 3300032954|Ga0335083_10263593 | Not Available | 1533 | Open in IMG/M |
| 3300033289|Ga0310914_11047098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium | 716 | Open in IMG/M |
| 3300033803|Ga0314862_0091076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300034818|Ga0373950_0085904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_00548320 | 2170459023 | Grass Soil | AVTAQLEREGVSSFCDSYHQLLACIEHKLTAVSARP |
| FG2_08684460 | 2189573004 | Grass Soil | EGSEKTLADASAAGINLANVTGELEREGVQSFCDSYHQLLDCIESKLGVVAAS |
| JGI20188J14859_10315622 | 3300001418 | Arctic Peat Soil | AAAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0066388_1075169782 | 3300005332 | Tropical Forest Soil | AAEAGLDLAAITSQLEHEGVRSFCDSYHQLLGCIERKLAAVGR* |
| Ga0070708_1001521261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0068856_1002235991 | 3300005614 | Corn Rhizosphere | SITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR* |
| Ga0066651_100347551 | 3300006031 | Soil | ERMLAAAAAAGLDLSVISAELEREGVRSLCDSYHQLLACIEHKVAA* |
| Ga0075417_101279692 | 3300006049 | Populus Rhizosphere | GLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP* |
| Ga0074053_120086852 | 3300006575 | Soil | AERMLAAAAVAGLDLAAVTAELEREGVSSFCDSYHQLLACIEHKLAAVGARL* |
| Ga0074062_129881051 | 3300006606 | Soil | EAERILAAAAVAGLDLAAVTAQLEREGVSSFCDSYHELLGCIEHKLTAVSARP* |
| Ga0079220_103541091 | 3300006806 | Agricultural Soil | AGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLAAVSARP* |
| Ga0075426_100662762 | 3300006903 | Populus Rhizosphere | GVDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLAAVGARP* |
| Ga0074063_100488251 | 3300006953 | Soil | TAQLEREGVSSFCDSYHELLGCIEHKLAAVSARP* |
| Ga0066710_1017387882 | 3300009012 | Grasslands Soil | AAAAAGGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLTAVGARP |
| Ga0066709_1040502491 | 3300009137 | Grasslands Soil | TLADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0114129_100944538 | 3300009147 | Populus Rhizosphere | GGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP* |
| Ga0105243_112689722 | 3300009148 | Miscanthus Rhizosphere | QPRRCGTDAHTAAAAGLDLSVITAELEREGVSSFCDSYHQLLACIEHKLAAVGARP* |
| Ga0116214_11029051 | 3300009520 | Peatlands Soil | AAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0126380_107909701 | 3300010043 | Tropical Forest Soil | AAASGVDLAAVTGQLEREGVSSFCDSYHQLLACIEHKLEAVGARP* |
| Ga0126373_102320841 | 3300010048 | Tropical Forest Soil | TVTAGLEREGVRSFCDSYHALLDCIERKLAGGAAL* |
| Ga0126373_102352413 | 3300010048 | Tropical Forest Soil | AAITAQLEREGVRSFCDSYHQLLDCIERKVATMDAASGR* |
| Ga0134070_103202421 | 3300010301 | Grasslands Soil | RMIAGAAAAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0126370_101008281 | 3300010358 | Tropical Forest Soil | LTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG* |
| Ga0126370_108437331 | 3300010358 | Tropical Forest Soil | AVTDQLEREGVSSFCDSYHQLLACIEHKLTAVGARP* |
| Ga0126376_102890453 | 3300010359 | Tropical Forest Soil | LDADQGAADRTLAAAAADGTDLADITAQLEREGVRAFCDSYHQLLDCIERKLALI* |
| Ga0126376_113436551 | 3300010359 | Tropical Forest Soil | AAAAAEIDLAALTAQLEREGVSSFCDSYHRLLGCIERKLAAGAAASAG* |
| Ga0126372_105548601 | 3300010360 | Tropical Forest Soil | LTALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG* |
| Ga0126378_112809311 | 3300010361 | Tropical Forest Soil | TAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG* |
| Ga0126378_126139711 | 3300010361 | Tropical Forest Soil | GGLDLGAVTAQLEREGVSSFCDSYHELLGCIEHKLAAVAPSPG* |
| Ga0126381_1017363561 | 3300010376 | Tropical Forest Soil | GLGLAAITVQLEREGVRSFCDSYRQLLGCIGRQIAAGAAQ* |
| Ga0126381_1035991121 | 3300010376 | Tropical Forest Soil | GLDLGAVTAQLEREGVSSFCDSYHELLGCIEHKLAAVAPSAG* |
| Ga0126381_1047723802 | 3300010376 | Tropical Forest Soil | AAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAATSQG* |
| Ga0126381_1051285301 | 3300010376 | Tropical Forest Soil | AAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASQG* |
| Ga0137391_108897561 | 3300011270 | Vadose Zone Soil | DAAQRTLAAAAAAGIDLATLTAQLDREGARSFCDSYHQLLDCIERKLAAIATR* |
| Ga0137393_108764121 | 3300011271 | Vadose Zone Soil | RTLAAAAAAGIDLATLTAQLEREGVRSFCDSYHQLLDCIERKLAAIATR* |
| Ga0137365_103744941 | 3300012201 | Vadose Zone Soil | AAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0137380_114760121 | 3300012206 | Vadose Zone Soil | GAAAAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0137385_113620721 | 3300012359 | Vadose Zone Soil | MLAGAAAAGLDLAAVTAKLEREGVRSFCDSYHQLLGCIERKIAAGAAR* |
| Ga0164303_106101641 | 3300012957 | Soil | EIAGLELAQVTSQLEREGVRSFCESYGSLLACIEGKLAGAAA* |
| Ga0126369_119276881 | 3300012971 | Tropical Forest Soil | LAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG* |
| Ga0157369_116319052 | 3300013105 | Corn Rhizosphere | VTAQLERAGVRSFCDSYQQLLARIQTTLALPLATS* |
| Ga0182034_116545931 | 3300016371 | Soil | EPADAERILAAAAAEIDLAALTAQLEREGVSSFCDSYHQLLGCI |
| Ga0182040_102753431 | 3300016387 | Soil | GAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0182037_111408851 | 3300016404 | Soil | QAAARTLDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIARKLAADAAR |
| Ga0182037_112246811 | 3300016404 | Soil | AGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR |
| Ga0182038_102841241 | 3300016445 | Soil | VAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG |
| Ga0182038_113155302 | 3300016445 | Soil | ARTLDAEPADAERILAAAAAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLTAGAA |
| Ga0182038_115904211 | 3300016445 | Soil | AVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG |
| Ga0187776_100847831 | 3300017966 | Tropical Peatland | MLAAAAASGADLAAVTDQLEREGVSSFCDSYHQLLACIEHKLTAVGARP |
| Ga0187766_106946341 | 3300018058 | Tropical Peatland | EAAGIDLTAVTTELEREGVDSFYDSYDQLLRCIESKLYVVAGSGG |
| Ga0187769_109388502 | 3300018086 | Tropical Peatland | LAAAAAAGIDLASLTSQLEREGVRSFCDSYHELLDCIERKLAAGAP |
| Ga0210399_112002761 | 3300020581 | Soil | AGVDLAALTAELEREGVSSFCDSYHRLLDCIGRKVAAGAAR |
| Ga0210397_100039701 | 3300021403 | Soil | VIAVTALLEPEGVRSFCDSYYQLLGCIERKIAAGAGR |
| Ga0210383_113742061 | 3300021407 | Soil | AADRILAAAAGAGIDLGAITAELERAGVRSFCDSYHQLLDCIERKLTAIAAR |
| Ga0210384_119018212 | 3300021432 | Soil | AAERTLADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIECKIAAGAR |
| Ga0210402_118939761 | 3300021478 | Soil | DAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIECKIAAGAR |
| Ga0126371_103247781 | 3300021560 | Tropical Forest Soil | EIDLAALTAQLEREGVSSFCDSYHRLLGCIERKLAAGAAASAG |
| Ga0126371_104289281 | 3300021560 | Tropical Forest Soil | AERTLAVAAEAGLDLAAITAQLEREGVRSFCDSYHRLLSCIERKVATMDAASGG |
| Ga0209584_100128762 | 3300025878 | Arctic Peat Soil | VTVTLEREAVRSFCDSYHELLDCIEGKLGALAAGGSTGPA |
| Ga0207707_104828051 | 3300025912 | Corn Rhizosphere | ELSSITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR |
| Ga0207664_102680722 | 3300025929 | Agricultural Soil | AALTAQLEREGVRSFCDSYHQLLGCIERKLAAGAAAGAG |
| Ga0207644_107903342 | 3300025931 | Switchgrass Rhizosphere | AAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAA |
| Ga0207677_109115091 | 3300026023 | Miscanthus Rhizosphere | PSITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR |
| Ga0207677_121826111 | 3300026023 | Miscanthus Rhizosphere | AALGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP |
| Ga0209701_104764532 | 3300027862 | Vadose Zone Soil | AAAAAAGIDLATLTAQLEREGVRSFCDSYHQLLDCIERKLAAIATR |
| Ga0307306_101697861 | 3300028782 | Soil | ADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR |
| Ga0307284_103952731 | 3300028799 | Soil | GLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP |
| Ga0307292_104647201 | 3300028811 | Soil | GLDLAAVTAQLEREGVSSFCDSYDQLLGCIEHKLTAVGARP |
| Ga0307296_103394921 | 3300028819 | Soil | VGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP |
| Ga0307304_101784831 | 3300028885 | Soil | VGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTTVSARP |
| Ga0318538_101307661 | 3300031546 | Soil | VAGLDLAAVTAQLEREGVSSFCDSYHQLLGCIEHKLTAVGARP |
| Ga0318571_102206221 | 3300031549 | Soil | PQAAERKLAAAAAAGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR |
| Ga0318555_100032127 | 3300031640 | Soil | AAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG |
| Ga0318555_102453503 | 3300031640 | Soil | LDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIARKLAADAAR |
| Ga0318555_106215601 | 3300031640 | Soil | AGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG |
| Ga0318542_101991982 | 3300031668 | Soil | AAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR |
| Ga0318560_105873711 | 3300031682 | Soil | IDLGAVTAELERDGVRSFCDSYHQLLDCIARRLTTVAAG |
| Ga0310686_1037983411 | 3300031708 | Soil | DAAATAGIDLAALTAQLEREGVRSFCDSYRRLLDCIGRKLTAGAGR |
| Ga0318496_102467521 | 3300031713 | Soil | VRAAGIDLAALTAELEREGVQSFCDSYHRLLDCIGRKLAADAAR |
| Ga0306917_107160861 | 3300031719 | Soil | TLTAAAAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS |
| Ga0306917_113663271 | 3300031719 | Soil | VTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP |
| Ga0318493_101883602 | 3300031723 | Soil | LDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0318493_107442851 | 3300031723 | Soil | RTLADAAAEIDLASLTAQLEREGVSSFCDSYHQLLGCIERKLTAGAA |
| Ga0318500_105925801 | 3300031724 | Soil | DLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS |
| Ga0306918_104819381 | 3300031744 | Soil | EPGDAERTLAAAAAEIDLASLTAQLEREGVSSFCDSYHQLLGCIERKLAA |
| Ga0318492_101679713 | 3300031748 | Soil | IPAALTAQLEREGVESFCDSYHRLLDCIARKLAAGAAR |
| Ga0318494_101673202 | 3300031751 | Soil | DPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0307475_112277421 | 3300031754 | Hardwood Forest Soil | AERTLAEARDAGIDLAAVTAELEREGVRSFCDSYHELLDCIDSKLGTVV |
| Ga0318509_101342952 | 3300031768 | Soil | VKASPAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0318521_110175481 | 3300031770 | Soil | ERALAAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS |
| Ga0318543_101329882 | 3300031777 | Soil | DPDTAEQAVAAAAAGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLNAG |
| Ga0318498_101348951 | 3300031778 | Soil | AGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS |
| Ga0318566_104025522 | 3300031779 | Soil | AALTAELEREGVQSFCDSYHRLLDCIGRKLAADAAR |
| Ga0318508_12024841 | 3300031780 | Soil | TAEQAVAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLSTGDACR |
| Ga0318547_102314332 | 3300031781 | Soil | LAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR |
| Ga0318547_106516382 | 3300031781 | Soil | ERTLAAAVAEIDLTALTAQLEREGVSSFCDSYHQLLGCIERKLAT |
| Ga0318503_100776611 | 3300031794 | Soil | IDLAALTAQLEREGVESFCDSYHRLLDCIARKLAAGAAR |
| Ga0318576_106418822 | 3300031796 | Soil | DLGAVTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP |
| Ga0318550_101629531 | 3300031797 | Soil | TQQTLTAAAAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS |
| Ga0318499_100981891 | 3300031832 | Soil | PALTAELEREGVSSFCDSYHRLLDCIGRKVAAGAAR |
| Ga0318499_101254232 | 3300031832 | Soil | IDLAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR |
| Ga0310917_106064741 | 3300031833 | Soil | EQAVAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG |
| Ga0310917_107750101 | 3300031833 | Soil | ERILAAAAMAGLDLGAVTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP |
| Ga0318511_100337021 | 3300031845 | Soil | PQAAERKLAAAAGAGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR |
| Ga0306919_105819181 | 3300031879 | Soil | DRILAAAAGAGIDLGAVTAELERDGVRSFCDSYHQLLDCIARRLTTVAAG |
| Ga0318522_101282452 | 3300031894 | Soil | LADLAGAGVDLAAVDSELEREGVQSFCDSYHQLLGCIEHKLGALARPGS |
| Ga0318551_100947541 | 3300031896 | Soil | LDTDPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASG |
| Ga0306921_122875421 | 3300031912 | Soil | AAAAVAGLDLGAVTAQLEREGVSSFCDSYHELLSCIEHKLTAVAARP |
| Ga0308174_108512701 | 3300031939 | Soil | MIAGAAAAGLDLAVVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR |
| Ga0310916_109070821 | 3300031942 | Soil | AARTLDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIGQKVSADAAR |
| Ga0310909_104526962 | 3300031947 | Soil | TDPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0306926_108836862 | 3300031954 | Soil | DPDTAEQAVAAAAAGIDLAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR |
| Ga0306922_106432312 | 3300032001 | Soil | AAAAAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATLDAASGR |
| Ga0318562_101672801 | 3300032008 | Soil | MLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR |
| Ga0318563_106456681 | 3300032009 | Soil | QRTLDAAAAAGVDLAALTAGLEREGVSSFCDSYHRLLDCIERKLAAGAAR |
| Ga0310911_109122241 | 3300032035 | Soil | DLAGAGVDLAAVDSELEREGVQSFCDSYHQLLGCIEHKLGALARPGS |
| Ga0318506_103165671 | 3300032052 | Soil | TLADLAGAGVDLAAVDSELEREGVRSFCDSYHQLLGCIEHKLGALARPGS |
| Ga0318506_105154212 | 3300032052 | Soil | AAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS |
| Ga0318575_101246442 | 3300032055 | Soil | AAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATLDAASGR |
| Ga0318513_106236422 | 3300032065 | Soil | RALAAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS |
| Ga0318524_104367891 | 3300032067 | Soil | AAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS |
| Ga0318553_103594071 | 3300032068 | Soil | DPAVADRILAAAAGAGIDLGAVTAELERDGVRSFCDSYHQLLNCIARRLTAVAAG |
| Ga0306920_1037964761 | 3300032261 | Soil | AEQAVAAAAAGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG |
| Ga0335085_102712332 | 3300032770 | Soil | NPDDAERMLAAAAVAGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLTAVGVRP |
| Ga0335083_102635932 | 3300032954 | Soil | AERMLAAAAAGGVDLAAVTAGLEREGVSPFCDSYHRLLACIEHKLTAGGARP |
| Ga0310914_110470981 | 3300033289 | Soil | TSQLEREGVRSFCDSYHRLLDCIVRKVATMDAASGR |
| Ga0314862_0091076_2_139 | 3300033803 | Peatland | AAAGGVDLAAVTAGLEREGVSSFCDSYHQLLARIEHKLTAVGARP |
| Ga0373950_0085904_556_663 | 3300034818 | Rhizosphere Soil | VTAQLEREGVSSFCDSYHQLLACIEHKLAAVSARP |
| ⦗Top⦘ |