NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F065236

Metagenome Family F065236

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065236
Family Type Metagenome
Number of Sequences 128
Average Sequence Length 56 residues
Representative Sequence DGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL
Number of Associated Samples 94
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.53 %
% of genes from short scaffolds (< 2000 bps) 95.31 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.062 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(46.875 % of family members)
Environment Ontology (ENVO) Unclassified
(85.156 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.938 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.62%    β-sheet: 9.52%    Coil/Unstructured: 67.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF02195ParBc 2.34
PF137592OG-FeII_Oxy_5 0.78
PF136402OG-FeII_Oxy_3 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.97 %
UnclassifiedrootN/A7.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10179733All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300000115|DelMOSum2011_c10219430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203520Open in IMG/M
3300000116|DelMOSpr2010_c10251723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203538Open in IMG/M
3300001419|JGI11705J14877_10116062All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300001460|JGI24003J15210_10077986All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300001748|JGI11772J19994_1028186All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300004097|Ga0055584_102444720All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005346|Ga0074242_11384737All Organisms → Viruses → Predicted Viral1365Open in IMG/M
3300005913|Ga0075108_10084614All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300005931|Ga0075119_1133205All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006026|Ga0075478_10134555All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006026|Ga0075478_10148731All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006026|Ga0075478_10159698All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006027|Ga0075462_10037661All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1550Open in IMG/M
3300006027|Ga0075462_10151469All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300006029|Ga0075466_1068927All Organisms → Viruses → Predicted Viral1005Open in IMG/M
3300006735|Ga0098038_1157894All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006735|Ga0098038_1230077All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300006737|Ga0098037_1186855All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006737|Ga0098037_1257215All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006802|Ga0070749_10637288All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006810|Ga0070754_10356063All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300006810|Ga0070754_10422334All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006810|Ga0070754_10494218Not Available527Open in IMG/M
3300006867|Ga0075476_10193096All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300006867|Ga0075476_10205198All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300006867|Ga0075476_10208454All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300006867|Ga0075476_10222013All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300006867|Ga0075476_10290427All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300006868|Ga0075481_10326296All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006916|Ga0070750_10386514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203586Open in IMG/M
3300006919|Ga0070746_10433971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203585Open in IMG/M
3300006921|Ga0098060_1172181All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006929|Ga0098036_1193189All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300007074|Ga0075110_1029007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1437Open in IMG/M
3300007074|Ga0075110_1115810All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300007234|Ga0075460_10280824All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300007539|Ga0099849_1269773All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300007539|Ga0099849_1318936All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300007540|Ga0099847_1006580All Organisms → cellular organisms → Bacteria3916Open in IMG/M
3300007540|Ga0099847_1117655All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300007540|Ga0099847_1145276All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300007540|Ga0099847_1146920All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300007541|Ga0099848_1322004All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300007542|Ga0099846_1339693All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300007640|Ga0070751_1180512All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300007963|Ga0110931_1133652All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300007963|Ga0110931_1213720Not Available575Open in IMG/M
3300008216|Ga0114898_1061054All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300009000|Ga0102960_1173600All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300009001|Ga0102963_1226598All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300009149|Ga0114918_10349186All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300009193|Ga0115551_1094395All Organisms → Viruses → Predicted Viral1408Open in IMG/M
3300009428|Ga0114915_1125154All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300009449|Ga0115558_1261223All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300009449|Ga0115558_1306236Not Available631Open in IMG/M
3300009476|Ga0115555_1354723All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300009495|Ga0115571_1325835All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300009593|Ga0115011_10379386All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300009786|Ga0114999_10510018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203927Open in IMG/M
3300009786|Ga0114999_10795584Not Available699Open in IMG/M
3300010148|Ga0098043_1115466All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300010153|Ga0098059_1344403All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010296|Ga0129348_1131906All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300010296|Ga0129348_1220092All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010316|Ga0136655_1155297All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300017730|Ga0181417_1161214All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300017731|Ga0181416_1094366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203712Open in IMG/M
3300017732|Ga0181415_1131127All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300017745|Ga0181427_1051511All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300017752|Ga0181400_1114624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203782Open in IMG/M
3300017758|Ga0181409_1176591All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300017763|Ga0181410_1142705Not Available676Open in IMG/M
3300017765|Ga0181413_1016780All Organisms → cellular organisms → Bacteria2292Open in IMG/M
3300017765|Ga0181413_1085717All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300017772|Ga0181430_1028698All Organisms → cellular organisms → Bacteria1791Open in IMG/M
3300020165|Ga0206125_10231429All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300021365|Ga0206123_10378259All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300021959|Ga0222716_10380543All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300021964|Ga0222719_10395427All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300022053|Ga0212030_1049767All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300022065|Ga0212024_1052363All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300022068|Ga0212021_1102099All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300022069|Ga0212026_1034208All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300022183|Ga0196891_1011905All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium1711Open in IMG/M
3300022183|Ga0196891_1013688All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1579Open in IMG/M
3300022183|Ga0196891_1096467All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300022187|Ga0196899_1119951All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300022187|Ga0196899_1155306All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300022200|Ga0196901_1017081All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300022200|Ga0196901_1136225All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300022841|Ga0222644_1006570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1806Open in IMG/M
3300023296|Ga0222664_1053955All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300025045|Ga0207901_1023540All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025048|Ga0207905_1060223All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300025086|Ga0208157_1130854All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300025138|Ga0209634_1140995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium998Open in IMG/M
3300025543|Ga0208303_1067477All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300025543|Ga0208303_1072067All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300025543|Ga0208303_1109652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203571Open in IMG/M
3300025655|Ga0208795_1118896All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300025674|Ga0208162_1188028All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025699|Ga0209715_1227138All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025759|Ga0208899_1047301All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300025769|Ga0208767_1182702All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025769|Ga0208767_1243845All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300025771|Ga0208427_1221954All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300025803|Ga0208425_1092425All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300025815|Ga0208785_1069786All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300025815|Ga0208785_1093124All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300025815|Ga0208785_1103924All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025818|Ga0208542_1040353All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300025840|Ga0208917_1047388All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1713Open in IMG/M
3300025840|Ga0208917_1169156All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300025853|Ga0208645_1276304Not Available542Open in IMG/M
3300025886|Ga0209632_10496584All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025889|Ga0208644_1128895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2031194Open in IMG/M
3300025889|Ga0208644_1235617All Organisms → cellular organisms → Bacteria768Open in IMG/M
(restricted) 3300027977|Ga0247834_1038682All Organisms → cellular organisms → Bacteria2797Open in IMG/M
3300028039|Ga0256380_1005489All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300028194|Ga0257106_1300121All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300028197|Ga0257110_1170905Not Available860Open in IMG/M
(restricted) 3300028581|Ga0247840_10341719All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031143|Ga0308025_1243112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203600Open in IMG/M
3300034374|Ga0348335_069935All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300034374|Ga0348335_107034All Organisms → cellular organisms → Bacteria862Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous46.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.84%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.81%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.69%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake3.12%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.34%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.34%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.56%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.56%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.56%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.56%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.56%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.78%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001748Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300005931Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007074Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022841Saline water microbial communities from Ace Lake, Antarctica - #291EnvironmentalOpen in IMG/M
3300023296Saline water microbial communities from Ace Lake, Antarctica - #604EnvironmentalOpen in IMG/M
3300025045Marine viral communities from the Pacific Ocean - LP-46 (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028039Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300mEnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1017973313300000101MarineDGKYRLCMGMRRFIAGCILGIENYKIEIVPDEEVDTLMNATSKYQKKHKDGTDISL*
DelMOSum2011_1021943013300000115MarineCTKDNDKYRLCIGMRRFIAGCILGIEEYEIKVVHNEEDDTLLNPCKEYIQAHKDGTPLAV
DelMOSpr2010_1025172313300000116MarineKEGKYRLCMGMRRFIAGCLLGIEKYDIEIVADEEVKTLIDATKKYQRVYKDGTYLAK*
JGI11705J14877_1011606213300001419Saline Water And SedimentKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATRKYITKHKDGTDLSL*
JGI24003J15210_1007798623300001460MarineMRRFIAGCILGIEEYEIKVVHNEEDDTLLNPCKEYIQAHKDGTPLAV*
JGI11772J19994_102818613300001748Saline Water And SedimentKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATRKYITKHKDGTDLSL*
Ga0055584_10244472023300004097Pelagic MarineGMRRFIAGCILGIEHYEIEVVLNEEPDTLINPTKKYQTKHKDGTDVSK*
Ga0074242_1138473713300005346Saline Water And SedimentGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATRKYITKHKDGTDLSL*
Ga0075108_1008461433300005913Saline LakeCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATSKYQKKHEDGTDISL*
Ga0075119_113320513300005931Saline LakeKYRLCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATSKYQKKHENGTDISL*
Ga0075478_1013455513300006026AqueousIINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075478_1014873123300006026AqueousGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTELAL*
Ga0075478_1015969823300006026AqueousKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075462_1003766113300006027AqueousRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTELAL*
Ga0075462_1015146913300006027AqueousDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATRKYITKHKDGTDLSL*
Ga0075466_106892733300006029AqueousKDGKYRLCIGMRRFIAGCFLGIKKYKIKLVNNEEVDTLLNPCKEYIKVHKDGTPLAL*
Ga0098038_115789413300006735MarineNPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVSTLMNATSKYQRKHKDGTSIAL*
Ga0098038_123007713300006735MarineTKDGDKYRLCMGMRRFIAGCILGINEYKIEIVQDEEPKTLLHATSKYQKKHKDGTDIAL*
Ga0098037_118685523300006737MarineCMGMRRFIAGCILGINEYKIEIVQDEEPKTLLHATSKYQKKHKDGTDIAL*
Ga0098037_125721513300006737MarinePLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVSTLMNATSKYQTKHKDGTGIAL*
Ga0070749_1063728823300006802AqueousRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYTTKHKDGTELAL*
Ga0070754_1035606313300006810AqueousNPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHEDGTDLSL*
Ga0070754_1042233423300006810AqueousDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0070754_1049421813300006810AqueousDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHEDGTDLSL*
Ga0075476_1019309613300006867AqueousGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075476_1020519823300006867AqueousIINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075476_1020845413300006867AqueousLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075476_1022201323300006867AqueousCTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVSTLMNATSKYQTKHKDGTGIAL
Ga0075476_1029042723300006867AqueousGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0075481_1032629623300006868AqueousIINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVSDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0070750_1038651423300006916AqueousGMRRFIAGLILGIEEYNIEIVPDEEVKTLLDACKKYQRIHKDGNPLAI*
Ga0070746_1043397113300006919AqueousKYRLCIGMRRFIAGLILGIEEYNIEIVPDEEVKTLLDACKKYQRIHKDGNPLAI*
Ga0098060_117218113300006921MarineGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATKKYQTKHKDGTDISK*
Ga0098036_119318913300006929MarineLICTKKKGKYRLCMGMRRFIAGCILGIKEYEIEVVPNEEVDTLINATKKYKTKHKNGTNLSE*
Ga0075110_102900733300007074Saline LakeEKDGKYRLCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATSKYQKKHEDGTDISL*
Ga0075110_111581013300007074Saline LakeEKDGKYRLCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLMNATSKYQKKHEDGTDISL*
Ga0075460_1028082423300007234AqueousIINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATSKYITKHEDGTDLSL*
Ga0099849_126977313300007539AqueousNGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATRKYITKHKDGTDLSL*
Ga0099849_131893623300007539AqueousINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHKDGTDLSL*
Ga0099847_100658013300007540AqueousDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATRKYITKHKDGTDLSL*
Ga0099847_111765513300007540AqueousGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDETELAL*
Ga0099847_114527613300007540AqueousGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYTTKHKDGTELAL*
Ga0099847_114692023300007540AqueousINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPNEQVDTLMNATSKYITKHKDGTEIAL*
Ga0099848_132200423300007541AqueousEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYQTKHKDGTDLSL*
Ga0099846_133969313300007542AqueousYRLCMGMRRFIAGCILGIEEYEIEIVPNEQVDTLMNATSKYITKHKDGTEIAL*
Ga0070751_118051213300007640AqueousKYRLCMGMRRFIAGCILGIEEYEIEIVPDEKVNTLMNAISKYQTKHKDGKEIAS*
Ga0110931_113365223300007963MarineCIGMRRFIAGCILGIDEYEIEVVADEEVETLLSPKTKYQTKHKDGTEIAL*
Ga0110931_121372023300007963MarineYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVSTLTNATSKYQRKHKDGTGISL*
Ga0114898_106105413300008216Deep OceanRFIAGCLLGIEEYEIEIVPDEEVSTLTNATSKYQRKHKDGTGISL*
Ga0102960_117360013300009000Pond WaterTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYQTKHKDGTEIAL*
Ga0102963_122659813300009001Pond WaterKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL*
Ga0114918_1034918613300009149Deep SubsurfaceMRRFIAGCMLGIEEYEIEIVPDEEVKTLMDATAKYQTKHKDGTEIAL*
Ga0115551_109439533300009193Pelagic MarineMGMRRFIAGCLLGIENYEIEVVPNEEADTLVNPTKKYKTKHKDGTDVST*
Ga0114915_112515423300009428Deep OceanEKDGKYRLCMGMRRFIAGCLLGIENYKIKIVPDEEVDTLINAITNYKTKHEDGTDVSK*
Ga0115558_126122323300009449Pelagic MarineTEKDGKYRLCMGMRRFIAGCLLGIEHYEIEVVANEEPDTLINPTKKYKTKHKDGTDVSK*
Ga0115558_130623613300009449Pelagic MarineINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL*
Ga0115555_135472323300009476Pelagic MarineMRRFIAGCILGIEHYEIEVVLNEEPDTLINPTKKYQTKHKDGTDVSK*
Ga0115571_132583513300009495Pelagic MarineRFIAGCILGIENYKIEIVPDEEVDTLMNATSKYQKKHEDGTDISL*
Ga0115011_1037938613300009593MarineGIINPLICTEKDGKYRLCMGMRRFIAGCLLGIEHYEIEVVPNEEADTLVNPTKKYKTKHKDGTDVSR*
Ga0114999_1051001813300009786MarineTERDGKYRLCMGMRRFIAGCLLGIKQYKIEVVADEEVKTLTDACEKYQRVYKDGTYLAK*
Ga0114999_1079558413300009786MarineRLCMGMRRFIAGCLLGIENYEIEVVPNEEADTLVNPTKKYKTKHKDGTDVSR*
Ga0098043_111546623300010148MarineIINPLICTERDGKYRLCMGMRRFIAGCLLGIDYYEIEVVPNEEPDTLVNPTKKYKTKHKDGTDVSK*
Ga0098059_134440313300010153MarineRFIAGCILGIKEYEIEVVPNEEVDTLINATKKYKTKHKNGTNLSE*
Ga0129348_113190623300010296Freshwater To Marine Saline GradientEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLSL*
Ga0129348_122009213300010296Freshwater To Marine Saline GradientTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVSDEEVDTLMNATRKYITKHKDGTDLSL*
Ga0136655_115529713300010316Freshwater To Marine Saline GradientMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL*
Ga0181417_116121413300017730SeawaterCVKKDDKYILCMGMRRFIAGLELGIEEYEIKIVPNDEVETLLNATVKYKTKHENGKDLSLXHFRLKNIN
Ga0181416_109436613300017731SeawaterDNGKYRLCIGMRRFIAGCLLGIEEYEIKIVPNEEVDTLLNPCKDYIKLHKDGTPLAL
Ga0181415_113112723300017732SeawaterDNKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVNTLMNATSKYQRKHKDGTGIAL
Ga0181427_105151123300017745SeawaterMGMRRFIAGCILGIEEYEIEIVPDEEVNTLMNATSKYQTKHKDGTGIAL
Ga0181400_111462413300017752SeawaterRRFIAGCILGIEEYEIKVVHNEEDDTLLNPCKEYIQAHKDGTPLAV
Ga0181409_117659123300017758SeawaterMGMRRFIAGCLLGIEYYEIEVVLNEEPDTLINPTKKYQTKHKDGTDVSK
Ga0181410_114270523300017763SeawaterINPLICTEKDGKYRLCIGVRRFIAGCFLGIEKYNIEIVADEEVKTLIGATKKYQRVYKDGTYLAI
Ga0181413_101678013300017765SeawaterKYRLCMGMRRFIAGCLLGIENYKIKIVPDEEVDTLMNAITNYKTKHEDGTDVSK
Ga0181413_108571713300017765SeawaterKYILCMGMRRFIAGLELGIEEYEIKIVPNDEVETLLNATVKYKTKHENGKDLSL
Ga0181430_102869833300017772SeawaterMGMRRFIAGCLLGIDYYEIEVVPNEEPDTLVNPTKKYKTKHKDGTDVSK
Ga0206125_1023142913300020165SeawaterICTEKDGKYRLCMGMRRFIAGCLLGIENYEIEVVPNEEADTLVNPTKKYKTKHKDGTDVS
Ga0206123_1037825913300021365SeawaterIINPLICTEKDGKYRLCMGIRRFIAGCILGIKEYEIEVVSNEEVDTLINATKKYKTKHKDGTDVSR
Ga0222716_1038054323300021959Estuarine WaterLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGKDLSL
Ga0222719_1039542723300021964Estuarine WaterLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYQTKHKDGTEISL
Ga0212030_104976713300022053AqueousLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYTTKHKDGTELAL
Ga0212024_105236323300022065AqueousGLCMGMRRFIAGCILGIEEYEIEIVSDEEVDTLMNATSKYITKHKDGTDLSL
Ga0212021_110209913300022068AqueousYRLCMGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATSKYITKHKDGTDLSL
Ga0212026_103420823300022069AqueousINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHEDGTDLSL
Ga0196891_101190513300022183AqueousTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTELAL
Ga0196891_101368833300022183AqueousGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHKDGTDLSL
Ga0196891_109646713300022183AqueousDGKYRLCMGMRRFIAGCILGIEEYEIEIVSDEEVDTLMNATSKYITKHKDGTDLSL
Ga0196899_111995123300022187AqueousKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATRKYITKHKDGTDLSL
Ga0196899_115530613300022187AqueousDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATRKYITKHKDGTDLSL
Ga0196901_101708153300022200AqueousGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL
Ga0196901_113622523300022200AqueousKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYTTKHKDGTELAL
Ga0222644_100657033300022841Saline WaterICTEKDGKYRLCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATSKYQKKHENGTDIS
Ga0222664_105395513300023296Saline WaterLICTEKDGKYRLCMGMRRFIAGCLLGIENYKIEIVPDEEVDTLINATSKYQKKHENGTDISL
Ga0207901_102354013300025045MarinePLICTEKDNKYRLCIGMRRFIAGCLLGIEEYEIEIVPDEEVTTLRNATSKYQTKHKDGTEVSL
Ga0207901_102790523300025045MarineRFIAGCLLGIEEYEIEIVPDEEADTLRNATSNYKTKHEDGTNLCL
Ga0207905_106022313300025048MarinePLICTEKDGKYRLCMGMRRFIAGCLLGIENYKIKIVPNEEVDTLMNAITNYKTKHEDGTDVSK
Ga0208157_113085413300025086MarineKYRLCMGMRRFIAGCILGINEYKIEIVQDEEPKTLLHATSKYQKKHKDGTDIAL
Ga0209634_114099533300025138MarineRFIAGCLLGIKEYEVIIVENEKIETLKNSCKKYKTTHKNGTLLAV
Ga0208303_106747723300025543AqueousMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLSL
Ga0208303_107206723300025543AqueousLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTELAL
Ga0208303_110965223300025543AqueousGKYRLCIGMRRFIAGLILGIEEYNIEIVPDEEVKTLLDACKKYQRIHKDGNPLAI
Ga0208795_111889613300025655AqueousRLCMGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHKDGTDLSL
Ga0208162_118802823300025674AqueousKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL
Ga0209715_122713813300025699Pelagic MarineLICTEKDGKYRLCIGMRRFIAGCILGIENYKIEIVPDEEVDTLMNATSKYQKKHEDGTDISL
Ga0208899_104730113300025759AqueousKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLSL
Ga0208767_118270223300025769AqueousTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL
Ga0208767_124384513300025769AqueousCTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVSDEEVDTLMNATSKYITKHKDGTDLSL
Ga0208427_122195423300025771AqueousKYRLCMGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATSKYITKHEDGTDLSL
Ga0208425_109242523300025803AqueousTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATRKYITKHKDGTDLSL
Ga0208785_106978613300025815AqueousNPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATRKYITKHKDGTDLSL
Ga0208785_109312423300025815AqueousNPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL
Ga0208785_110392413300025815AqueousNPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPNEEVDTLMNATSKYITKHEDGTDLSL
Ga0208542_104035333300025818AqueousYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYKTKHKDGTEISL
Ga0208917_104738833300025840AqueousDGKYRLCMGMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHKDGTDLSL
Ga0208917_116915623300025840AqueousLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL
Ga0208645_127630413300025853AqueousIINPLICTEKDGKYRLCMGMRRFIAGCILGIEEYEIEIVPDEEVSTLMNATSKYQRKHKDGTSIAL
Ga0209632_1049658423300025886Pelagic MarineINPLICTEKDGKYRLCMGMRRFIAGCLLGIENYEIEVVPNEEVDTLVNPTKKYKTKHKDGTDVST
Ga0208644_112889533300025889AqueousKYRLCIGMRRFIAGLILGIEEYNIEIVPDEEVKTLLDACKKYQRIHKDGNPLAI
Ga0208644_123561713300025889AqueousICTEKDGKYRLCMGMRRFIAGCILGIEEYEIQIVPDEEVDTLMNATSKYITKHKDGTDLS
(restricted) Ga0247834_103868213300027977FreshwaterGMRRFIAGLMLGIDEYEIEIVPDEEVKTLINAKNKYKTKHKDGTNITL
Ga0256380_100548933300028039SeawaterFIAGCILGIKEYEIKVVPDEEVETLLSAISKYKTKHKDGTNVSK
Ga0257106_130012113300028194MarineNPLICTEKDGKYRLCMGMRRFIAGCLLGIENYEIEVVPNEEADTLVNPTKKYKTKHKDGIDVSN
Ga0257110_117090523300028197MarineKDGKYRLCMGMRRFIAGCLLGIENYEIEVLPNEEADTLVNPTKKYKTKHKDGTDVST
(restricted) Ga0247840_1034171913300028581FreshwaterGMRRFIAGLMLGIDEYEIEIVPDEEVKTLINAKNKYKTKHKDGTDITL
Ga0308025_124311223300031143MarineINPLICTEKEGKYRLCMGMRRFIAGCLLGIEKYNIEIVADEEVKTLIDATKKYQRVYKDGTYLAV
Ga0307380_1121115923300031539SoilFIAGLILGIEEYNIEIVPNEEVKTLLDVCKKYQRIHKDGNPLAI
Ga0348335_069935_1_1443300034374AqueousMRRFIAGCILGIEEYEIQIVPNEEVDTLMNATSKYITKHKDGTDLSL
Ga0348335_107034_663_8123300034374AqueousMGMRRFIAGCILGIEEYEIEIVPDEEVDTLMNATSKYITKHKDGTDLSL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.