| Basic Information | |
|---|---|
| Family ID | F065165 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACEL |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.43 % |
| % of genes near scaffold ends (potentially truncated) | 93.75 % |
| % of genes from short scaffolds (< 2000 bps) | 89.84 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.875 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.844 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 75.00 |
| PF13579 | Glyco_trans_4_4 | 6.25 |
| PF13489 | Methyltransf_23 | 1.56 |
| PF00535 | Glycos_transf_2 | 0.78 |
| PF13641 | Glyco_tranf_2_3 | 0.78 |
| PF13847 | Methyltransf_31 | 0.78 |
| PF07715 | Plug | 0.78 |
| PF00682 | HMGL-like | 0.78 |
| PF15902 | Sortilin-Vps10 | 0.78 |
| PF13649 | Methyltransf_25 | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.88 % |
| Unclassified | root | N/A | 3.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02SN2Y9 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 2070309004|prs_FIHLEPW02TA5EQ | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 2189573004|GZGWRS402FKGFD | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300000955|JGI1027J12803_100213397 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300001139|JGI10220J13317_11503155 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300002128|JGI24036J26619_10102148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300004156|Ga0062589_100845581 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005168|Ga0066809_10178013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300005175|Ga0066673_10647282 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005180|Ga0066685_10501241 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005186|Ga0066676_10116538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1642 | Open in IMG/M |
| 3300005186|Ga0066676_10229615 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005355|Ga0070671_100879919 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005364|Ga0070673_100272954 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300005434|Ga0070709_11532094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300005446|Ga0066686_10012203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4523 | Open in IMG/M |
| 3300005458|Ga0070681_11539755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300005540|Ga0066697_10276896 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005543|Ga0070672_100683872 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005553|Ga0066695_10625108 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005560|Ga0066670_10267814 | Not Available | 1037 | Open in IMG/M |
| 3300005574|Ga0066694_10503031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300005764|Ga0066903_100510633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2041 | Open in IMG/M |
| 3300005764|Ga0066903_102690006 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300006031|Ga0066651_10413021 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006034|Ga0066656_10244596 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300006163|Ga0070715_10462603 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300006844|Ga0075428_101416628 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300009090|Ga0099827_10574144 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300009137|Ga0066709_101987614 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009177|Ga0105248_10948361 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300010042|Ga0126314_11511583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010046|Ga0126384_10118132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300010301|Ga0134070_10477730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300010320|Ga0134109_10077593 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300010329|Ga0134111_10006042 | All Organisms → cellular organisms → Bacteria | 3721 | Open in IMG/M |
| 3300010333|Ga0134080_10277228 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010333|Ga0134080_10307332 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010366|Ga0126379_11349459 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300010375|Ga0105239_12030542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 668 | Open in IMG/M |
| 3300010398|Ga0126383_12583888 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011119|Ga0105246_11445936 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012205|Ga0137362_11404572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300012208|Ga0137376_11203776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300012208|Ga0137376_11449724 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012285|Ga0137370_10975877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012350|Ga0137372_10062741 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300012357|Ga0137384_10195321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1693 | Open in IMG/M |
| 3300012582|Ga0137358_10005729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7496 | Open in IMG/M |
| 3300012897|Ga0157285_10326321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012923|Ga0137359_10375276 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300012923|Ga0137359_10544912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1021 | Open in IMG/M |
| 3300012923|Ga0137359_10868897 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012930|Ga0137407_10828368 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012961|Ga0164302_10204805 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300012971|Ga0126369_10802198 | Not Available | 1024 | Open in IMG/M |
| 3300012975|Ga0134110_10428543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300012975|Ga0134110_10510419 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012977|Ga0134087_10026092 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300012977|Ga0134087_10277056 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012985|Ga0164308_10713848 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012987|Ga0164307_11485145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300012987|Ga0164307_11585286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300012989|Ga0164305_10160822 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300013297|Ga0157378_11227549 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300014325|Ga0163163_12992299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300014968|Ga0157379_11277756 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300015077|Ga0173483_10795286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300015264|Ga0137403_11195225 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300015372|Ga0132256_100797551 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300015373|Ga0132257_100587923 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300015373|Ga0132257_103496337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300015374|Ga0132255_100769432 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300016270|Ga0182036_11104493 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300016404|Ga0182037_10190965 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300018028|Ga0184608_10468825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300019789|Ga0137408_1047031 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300019886|Ga0193727_1006356 | All Organisms → cellular organisms → Bacteria | 4757 | Open in IMG/M |
| 3300020016|Ga0193696_1148065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300020170|Ga0179594_10016004 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300020170|Ga0179594_10038526 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300020170|Ga0179594_10196683 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300021344|Ga0193719_10164002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 956 | Open in IMG/M |
| 3300021344|Ga0193719_10426649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021418|Ga0193695_1043671 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300021475|Ga0210392_10139850 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300022756|Ga0222622_10025800 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300022880|Ga0247792_1022276 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300025905|Ga0207685_10025933 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300025912|Ga0207707_11018535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300025914|Ga0207671_10362148 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300025916|Ga0207663_10830815 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025916|Ga0207663_11519399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300025925|Ga0207650_11490136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300025935|Ga0207709_11282860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300026078|Ga0207702_11854254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300026314|Ga0209268_1177192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300026342|Ga0209057_1245986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026343|Ga0209159_1136719 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300026523|Ga0209808_1272316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026542|Ga0209805_1212690 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300026547|Ga0209156_10064608 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1893 | Open in IMG/M |
| 3300027874|Ga0209465_10413196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 675 | Open in IMG/M |
| 3300027907|Ga0207428_10542378 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300028381|Ga0268264_10557003 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300028711|Ga0307293_10200766 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300028807|Ga0307305_10248570 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300028875|Ga0307289_10157983 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300028878|Ga0307278_10132909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1116 | Open in IMG/M |
| 3300028884|Ga0307308_10275125 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031057|Ga0170834_108735495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031057|Ga0170834_108949160 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031231|Ga0170824_128906065 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031469|Ga0170819_14909235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031474|Ga0170818_111791599 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031719|Ga0306917_10648645 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031744|Ga0306918_10415096 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031910|Ga0306923_10043306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4933 | Open in IMG/M |
| 3300031938|Ga0308175_101329786 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031945|Ga0310913_10586044 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031947|Ga0310909_10150090 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300031947|Ga0310909_11681000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300031954|Ga0306926_10332312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1880 | Open in IMG/M |
| 3300032059|Ga0318533_10118831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1847 | Open in IMG/M |
| 3300032076|Ga0306924_12480081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300032261|Ga0306920_101308916 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 1.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02173140 | 2070309004 | Green-Waste Compost | MNDPVAAYFDKLPETHKRQFEERASGANFNFHQRLTLASELAIESSGRLL |
| prs_03844620 | 2070309004 | Green-Waste Compost | MNDPVAAYFEKLPQIHKCQFVQRVSGASFYFKSAWQ |
| FG2_08181970 | 2189573004 | Grass Soil | MNDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACELG |
| JGI1027J12803_1002133973 | 3300000955 | Soil | MNDPVAAYFDKHAETHKRQFVESASGASFYFQTRLKLACELAGAS |
| JGI10220J13317_115031552 | 3300001139 | Soil | MKENDPVAEYFDKLPETHKRQFEERASGANFNFQQRLDLACE |
| JGI24036J26619_101021482 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDPVAAYFDKLPETHKRQFEERASGANVNFQQR |
| Ga0062589_1008455812 | 3300004156 | Soil | MNENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLRLACELGGAS |
| Ga0066809_101780132 | 3300005168 | Soil | MGSSVSKMNDPVAAYFDKLPETHKRQFEERASGANFNFQQRLALACELGG |
| Ga0066673_106472821 | 3300005175 | Soil | MNDPVGAYFEKLPQIYKCQFVQKACGANFCFQKRIRLACELAGASAGRLLDC |
| Ga0066685_105012411 | 3300005180 | Soil | MSDPVAAYFEKLPQLHKRQFAERASGASFYFQKRLTLACELASASAGRL |
| Ga0066676_101165381 | 3300005186 | Soil | MNDPVAAYFEKLPQIYKCEFVQKASGANFCFQKRLTLACELARASV* |
| Ga0066676_102296151 | 3300005186 | Soil | MSDPVAAYFEKLPQLHKRQFAQQASGASFYFQKRLTLACE |
| Ga0070671_1008799191 | 3300005355 | Switchgrass Rhizosphere | MKGNDPVATYFDKLPETHKRQFEEYASGANFNFQQRLALACEL |
| Ga0070673_1002729541 | 3300005364 | Switchgrass Rhizosphere | MKEKDPVAAYFDKLPENHKRLFEERASGVNFNFRQRLKLAC |
| Ga0070709_115320941 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGNDPVAAYFDKLPESHKRQFEESASGANFNFQQRLTLAC |
| Ga0066686_100122036 | 3300005446 | Soil | MNDPVAAYFEKLPQIYKCQFVQKASGANFCFQKRLTLACELAGAS |
| Ga0070681_115397551 | 3300005458 | Corn Rhizosphere | MNDPVAAYFDKLPETHKRQFEQRASGTNFNFQQRLALACELGGAS |
| Ga0066697_102768962 | 3300005540 | Soil | MNDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGGASSGR |
| Ga0070672_1006838721 | 3300005543 | Miscanthus Rhizosphere | MKENDPVAEYFEKLPETHKRQFEQRTSGANFNFQQRLRL |
| Ga0066695_106251081 | 3300005553 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFARSASGASFNFQMRLRLACELAGGSA |
| Ga0066670_102678141 | 3300005560 | Soil | MKGNDPVATYFDQLPESHKRQFEERASGANFNFQQRLALA |
| Ga0066694_105030311 | 3300005574 | Soil | MNDPVAAYFDKHAETHKRQFVQSGSGTSFYFQTRLILTCELAG |
| Ga0066903_1005106331 | 3300005764 | Tropical Forest Soil | MKGNDPVAAYFDKLPEIHKRQFNERASGANFNFQQRLTLTCEA |
| Ga0066903_1026900061 | 3300005764 | Tropical Forest Soil | MNDPVAAYFEKLPQTHKTQFLQRASGASFNFQKRPTLACE |
| Ga0066651_104130211 | 3300006031 | Soil | MSDPVAAYFEKLPQLHKRQFAQQASGASFYFQKRLTLACELASASAGRL |
| Ga0066656_102445961 | 3300006034 | Soil | MNDPVAAYFEKHAETHKRQFVGSGSGASFYFQKRL |
| Ga0070715_104626031 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLR |
| Ga0075428_1014166281 | 3300006844 | Populus Rhizosphere | MKGNDPVAAYFDKLPDTHKRQFRERASGANFNFQQRLALVCE |
| Ga0099827_105741442 | 3300009090 | Vadose Zone Soil | MKENDLVTPYFDKLPETHKRQFEERASGANFNFQQRLTLAC |
| Ga0066709_1019876142 | 3300009137 | Grasslands Soil | MNDPVAAYFEKLPQIHKRQFEQKASGASFNFRKRLTLTCELAGASAGRLL |
| Ga0105248_109483611 | 3300009177 | Switchgrass Rhizosphere | MKENDPVAVYFDKLPETHKRQFEERASGANFNFQQRLTRACELGG |
| Ga0126314_115115831 | 3300010042 | Serpentine Soil | MNDPVTAYFDKLPETHKRQFEKCASGANFNFQQRL |
| Ga0126384_101181323 | 3300010046 | Tropical Forest Soil | MKGNDPVAAYFDKLPEIHKRQFNERASGANFNFQQRLT |
| Ga0134070_104777301 | 3300010301 | Grasslands Soil | VDDEMSDPVAAYFEKLPQFHKRQFAERASGASFYFQKRLTLACELASASAGRL |
| Ga0134109_100775931 | 3300010320 | Grasslands Soil | MKENDPVAAYFDKLPETHKRQFEESASGANFNFQQRLTLACELAGGS |
| Ga0134111_100060426 | 3300010329 | Grasslands Soil | MNDPVAAYFAKLPQIYKCQFVQKDSGADFCFQKRLTLACELAGASGND* |
| Ga0134080_102772282 | 3300010333 | Grasslands Soil | MNDPVAAYFEKLPQIYKCQFVQKASGANFCFQKRLRLAFEWAGASGGPL |
| Ga0134080_103073321 | 3300010333 | Grasslands Soil | MNDPVAAYFEKLPQIHKRQFEQKASGASFNFRKRLTL |
| Ga0126379_113494592 | 3300010366 | Tropical Forest Soil | MKGNDPVAAYFDKLPETHKRQFKERASGANFNFQQRLTLTCEAGGASSG |
| Ga0105239_120305421 | 3300010375 | Corn Rhizosphere | MKEKDPVAAYFDKLPENHKRQFEERASGANFNFQQRLRLACELGGASSG |
| Ga0126383_125838882 | 3300010398 | Tropical Forest Soil | MDDEINGPVAAYFDKLPQTHKRQFMKKTSGASFNFQKRLALACELAGGTA |
| Ga0105246_114459361 | 3300011119 | Miscanthus Rhizosphere | MKGNDPVAAYFDKLPENHKRLFEERASGVNFNFRQRLKLA |
| Ga0137362_114045721 | 3300012205 | Vadose Zone Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQR |
| Ga0137376_112037762 | 3300012208 | Vadose Zone Soil | MKGDDPVAAYFDNLPETHKHQFEERAFGANFNLQQRLT |
| Ga0137376_114497242 | 3300012208 | Vadose Zone Soil | MNDPVAAYFDKLAPIHKRQFVQSASGASFYFQTRLKL |
| Ga0137370_105810632 | 3300012285 | Vadose Zone Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFISNNV* |
| Ga0137370_109758771 | 3300012285 | Vadose Zone Soil | MKGNDPVAAYFDKLPDIHKRQFEERASGANFNLQQRLALACELG |
| Ga0137372_100627411 | 3300012350 | Vadose Zone Soil | VDDEMSDPVAAYFEKLPQLHKRQFAQQASGASFYF |
| Ga0137384_101953211 | 3300012357 | Vadose Zone Soil | VDDEMSDPVAAYFEKLPQLHKRQFAQQASGASFYFQKRLTL |
| Ga0137358_100057298 | 3300012582 | Vadose Zone Soil | MNDPVAAYFEKLPQIYKCQFVQRASCANFCFQKRLTLACELAGASV |
| Ga0157285_103263211 | 3300012897 | Soil | MNENDPVAAYFDKLTETHKRQFEERASGANFNFQQRLTLACELGAASSG |
| Ga0137359_103752762 | 3300012923 | Vadose Zone Soil | MNDPVAAYFDKLPQTHKRQFEERASGANFNFQQRLTLACELGGASSG |
| Ga0137359_105449122 | 3300012923 | Vadose Zone Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGGASSG |
| Ga0137359_108688972 | 3300012923 | Vadose Zone Soil | MNDPVAAYFEKLPQIYKCQFVQRASGANFCFQKRLTLACELAGASVG |
| Ga0137407_108283681 | 3300012930 | Vadose Zone Soil | MKDPVAAYFDKHAESHKRQFVRSGSGASFYFQKRLTLAC |
| Ga0164302_102048052 | 3300012961 | Soil | MKENDPVAAYFDKFPESHKRQFEERASGANFNFRQ |
| Ga0126369_108021981 | 3300012971 | Tropical Forest Soil | MKGNDPIAAYFDKVPETHKRQFEERISGGNFNFQQRLT |
| Ga0134110_104285431 | 3300012975 | Grasslands Soil | MKENDPVAAYFDKLPQTHERQFEERASGANFNFQQRLTLA |
| Ga0134110_105104191 | 3300012975 | Grasslands Soil | MDDEMNDPVAAYFDKLPQTHKRQFARSASGASFNFQMRLRLA |
| Ga0134087_100260921 | 3300012977 | Grasslands Soil | VDDEMSDPVAAYFEKLPQFHKRQFAERASGASFYFQKRLTLA |
| Ga0134087_102770562 | 3300012977 | Grasslands Soil | MKGNDPVAAYFDKLPQTHKRQFEERASGANFNFQQRLTLACELGGASSG* |
| Ga0164308_107138481 | 3300012985 | Soil | MNDPVAAYFEKLPQIHKCQFVQRASGASFYFQKRLAIASELA |
| Ga0164307_114851452 | 3300012987 | Soil | MKGNDPLAAYFDKLPETHKRQFEERVSGANFNFQQRLTLACELGAASS |
| Ga0164307_115852862 | 3300012987 | Soil | MKKNDPVAAYFDKLPETHKRQFEERASGANFNFQQRLRLACQLG |
| Ga0164305_101608221 | 3300012989 | Soil | MKENDPVAAYFDKLPETHKRQFELRTSGANFNFQQRLRL |
| Ga0157378_112275492 | 3300013297 | Miscanthus Rhizosphere | MKGNDPVASYFDKLPESHKRQFEERASGANFNFRQRLARACE* |
| Ga0163163_129922991 | 3300014325 | Switchgrass Rhizosphere | MKEKDPVAAYFDKLPENHKRQFEECASGANFNFQQRLRLACEL |
| Ga0157379_112777561 | 3300014968 | Switchgrass Rhizosphere | MKGNDPVAAYFDKLPESHKRQFEESASGANFNFQQRLTL |
| Ga0173483_107952862 | 3300015077 | Soil | MKENDPVAEYFEKLPETHKRQFEQRTSGANFNFQQRLRLACELGGA |
| Ga0137403_111952251 | 3300015264 | Vadose Zone Soil | VDDEMSDPVAAYFEKLPQLHKRQFAQQASGASFYFQKRLTLACE |
| Ga0132256_1007975511 | 3300015372 | Arabidopsis Rhizosphere | MKENDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLACEL |
| Ga0132257_1005879231 | 3300015373 | Arabidopsis Rhizosphere | MKGNDPVAAYFDKLPETHKRQFEERVSGANFNFQQRLTL |
| Ga0132257_1034963372 | 3300015373 | Arabidopsis Rhizosphere | MNDPVAAYFDKLPETHKRQFEQRASGTNFNFQQRLALAC |
| Ga0132255_1007694321 | 3300015374 | Arabidopsis Rhizosphere | MKGNDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGGT |
| Ga0182036_111044931 | 3300016270 | Soil | MDDEMNDPVAAYFDKLPQVHKRQFEQRASGASFNFQMRL |
| Ga0182037_101909651 | 3300016404 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFTRSASGASFNFQMRLRLACELAGESAGRL |
| Ga0184608_104688251 | 3300018028 | Groundwater Sediment | MKENDPVAAYFDKLPETHKRQFEERASGTTFNFQQRLTLACELGGASSGR |
| Ga0137408_10470311 | 3300019789 | Vadose Zone Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLKL |
| Ga0137408_14173971 | 3300019789 | Vadose Zone Soil | MRDEKNDPVTAYFDKLPETHKRQFEERTSGANFIFNNV |
| Ga0193727_10063565 | 3300019886 | Soil | MNDPVAAYFEKLPQIYKGHFVQKASGANFCFQKRLTLACELA |
| Ga0193696_11480652 | 3300020016 | Soil | MNENDPVAAYFDKLPETHKRQFEKRASGANFNFQRR |
| Ga0179594_100160042 | 3300020170 | Vadose Zone Soil | MNDPVAAYFDKLPQTHKRQFEERASGANFNFQQRLTLACELGGASS |
| Ga0179594_100385262 | 3300020170 | Vadose Zone Soil | MNDPVAAYFEKLPQIYKCQFVQRASGANFCFQKRLTLA |
| Ga0179594_101966831 | 3300020170 | Vadose Zone Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGGASS |
| Ga0193719_101640022 | 3300021344 | Soil | MGNEMRDPVATYFDKHAETHKRQFVGSGSGASFYF |
| Ga0193719_104266492 | 3300021344 | Soil | MGNEMKDPVAAYFDKHAESHRRQFVGSGSGASFYFQKRLTL |
| Ga0193695_10436711 | 3300021418 | Soil | MNDPVAAYFEKLPQIYKCQFVQKASGANFCFQKRLTLACE |
| Ga0210392_101398501 | 3300021475 | Soil | MKENDPVAAYFDKLPETHKRQFEEHASGANFNFQQRLKVACELG |
| Ga0222622_100258001 | 3300022756 | Groundwater Sediment | MKENDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGDASSGR |
| Ga0247792_10222762 | 3300022880 | Soil | MKENDPVAAYFDKLPETHKRQFELRTSGANFNFQQRLRLACELG |
| Ga0207685_100259333 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKESDPVAAYFDKLPETHKRQFEERASGANFNFQQRLT |
| Ga0207707_110185351 | 3300025912 | Corn Rhizosphere | MNDPVAAYFDKLPETHKRQFEQCASGTNFNFQQRLALACELGG |
| Ga0207671_103621482 | 3300025914 | Corn Rhizosphere | MKGNDPVAAYFDKLPENHKRLFEERASGVNFNFRQR |
| Ga0207663_108308152 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDPVAAYFDKLPETHKRQFKERASGANFNFQQRLALACELGGASSGRL |
| Ga0207663_115193991 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDPVAAYFDKLPESHKRQFEERASGANFNFQQRLT |
| Ga0207650_114901362 | 3300025925 | Switchgrass Rhizosphere | MKEKDPVAAYFDKLPETHKRQFEERASGANFNFQQRLR |
| Ga0207709_112828602 | 3300025935 | Miscanthus Rhizosphere | MKENDPVAAYFDKLPENHKRLFEERASGVNFNFRQRLKLACELGGAS |
| Ga0207702_118542542 | 3300026078 | Corn Rhizosphere | MKENDPVAAYFEKLPETHKRQFEERASGANFNFQQRLR |
| Ga0209268_11771921 | 3300026314 | Soil | MSDPVAAYFEKLPQLHKRQFAERASGASFYFQKRLTLAC |
| Ga0209057_12459862 | 3300026342 | Soil | MNDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGGAS |
| Ga0209159_11367192 | 3300026343 | Soil | MSDPVAAYFEKLPQLHKRQFAQQASGASFYFQKRL |
| Ga0209808_12723161 | 3300026523 | Soil | MKENDPVGTYFDKLPETHKRQFEERASGANFNFQQ |
| Ga0209805_12126901 | 3300026542 | Soil | MNDPVAAYFEKLPQIHKRQFEQKASGASFNFRKRLTLTCELAGAS |
| Ga0209156_100646081 | 3300026547 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFARSASGASFNFQMRLRLACE |
| Ga0209465_104131961 | 3300027874 | Tropical Forest Soil | MKANDPVAAYFDKLPETHKRQFQERASGANINFQQRLT |
| Ga0207428_105423782 | 3300027907 | Populus Rhizosphere | MKGNDPVTAYFDNLAQTHKRHLRESASGTSFNFQQRLALT |
| Ga0268264_105570032 | 3300028381 | Switchgrass Rhizosphere | MKENDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLARELG |
| Ga0307293_102007662 | 3300028711 | Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACEL |
| Ga0307305_102485701 | 3300028807 | Soil | MNDPVAAYFDKHAETHKRQFVGSGSGASFYFQTRLKLAC |
| Ga0307289_101579832 | 3300028875 | Soil | MKENDPVTAYFDKLPETHKRQFEERASGANFNFQQRLTLAC |
| Ga0307278_101329092 | 3300028878 | Soil | MNDPVAAYFDKLPQIHKRQFVQRASGANFSFQKRLTLVCELAGAL |
| Ga0307308_102751252 | 3300028884 | Soil | MNDPVAAYFEKLPHIYKCQFVQKTSGANFCFQKRLTLACELAGASVGRLLD |
| Ga0170834_1087354951 | 3300031057 | Forest Soil | MKENDPVAAYFDKLPETHKRQFEQCASGANFNFQQRLKVA |
| Ga0170834_1089491601 | 3300031057 | Forest Soil | MGNEMKDPVAAYFDKHAETHKRQFVGSESGASFYFQKRLTLACELAGSST |
| Ga0170824_1289060652 | 3300031231 | Forest Soil | MGNEMKDPVAAYFDKHAETHKRQFVGSGSGANFYFQTRLKLACELAGASTG |
| Ga0170819_149092351 | 3300031469 | Forest Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLALACELG |
| Ga0170818_1117915991 | 3300031474 | Forest Soil | MKENDPVAAYFDKLPETHKRQFEERASGANFNFQQRLTLACELGG |
| Ga0306917_106486452 | 3300031719 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFTRSGSGASFNFQMRLRLACELAGG |
| Ga0306918_104150961 | 3300031744 | Soil | MKGNDPVAAYFDKLPETHKRQFEERVSGANFNFQQRLTLACELGAASS |
| Ga0306923_100433061 | 3300031910 | Soil | MKGNDPVAAYFDNLPEAHKRQFRESASGTSFNFQQRLVLACELSAASSGRLL |
| Ga0308175_1013297862 | 3300031938 | Soil | MNDPVAAYFDKLPETHKRQFEERASGANFNFQQRL |
| Ga0310913_105860441 | 3300031945 | Soil | MKRNDPVAAYFNNLPETHKRQFRESASGTSFNFQQRLVLAC |
| Ga0310909_101500903 | 3300031947 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFTRSGSGASFNFQMRLRLACELAGGSTGRL |
| Ga0310909_116810001 | 3300031947 | Soil | MKDPVAAYFDKHAEIHKRQFVGRGSGASFYFQTRLKLACELAGASTG |
| Ga0306926_103323123 | 3300031954 | Soil | MKENDPVATYFDKLPETHQRQFEKRTSGVNFNFQQRLT |
| Ga0318533_101188313 | 3300032059 | Soil | MDDEMNDPVAAYFDKLPQTHKRQFTRSGSGASFNFQMRLR |
| Ga0306924_124800811 | 3300032076 | Soil | MKENDPVAAYFDKLPESHKRQFEQRASGANFNFQR |
| Ga0306920_1013089162 | 3300032261 | Soil | MKDPVAAYFDKHAEIHKRQFVGRGSGASFYFQTRLKLACELAGASTGRLL |
| ⦗Top⦘ |