| Basic Information | |
|---|---|
| Family ID | F065154 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NELANPTEYSADFNDITQGAPQCMVGWDLCAGIGSPRTYAGK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.91 % |
| % of genes near scaffold ends (potentially truncated) | 92.97 % |
| % of genes from short scaffolds (< 2000 bps) | 89.06 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.156 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (10.938 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.00% β-sheet: 2.86% Coil/Unstructured: 87.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF11741 | AMIN | 7.81 |
| PF01243 | Putative_PNPOx | 2.34 |
| PF01668 | SmpB | 1.56 |
| PF13620 | CarboxypepD_reg | 1.56 |
| PF13302 | Acetyltransf_3 | 1.56 |
| PF01872 | RibD_C | 1.56 |
| PF02518 | HATPase_c | 1.56 |
| PF00069 | Pkinase | 1.56 |
| PF04366 | Ysc84 | 1.56 |
| PF01590 | GAF | 0.78 |
| PF07394 | DUF1501 | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF00313 | CSD | 0.78 |
| PF03721 | UDPG_MGDP_dh_N | 0.78 |
| PF03631 | Virul_fac_BrkB | 0.78 |
| PF09286 | Pro-kuma_activ | 0.78 |
| PF13683 | rve_3 | 0.78 |
| PF13480 | Acetyltransf_6 | 0.78 |
| PF00384 | Molybdopterin | 0.78 |
| PF02719 | Polysacc_synt_2 | 0.78 |
| PF03928 | HbpS-like | 0.78 |
| PF13492 | GAF_3 | 0.78 |
| PF15902 | Sortilin-Vps10 | 0.78 |
| PF04140 | ICMT | 0.78 |
| PF13744 | HTH_37 | 0.78 |
| PF01431 | Peptidase_M13 | 0.78 |
| PF02368 | Big_2 | 0.78 |
| PF14384 | BrnA_antitoxin | 0.78 |
| PF03279 | Lip_A_acyltrans | 0.78 |
| PF13180 | PDZ_2 | 0.78 |
| PF00909 | Ammonium_transp | 0.78 |
| PF16124 | RecQ_Zn_bind | 0.78 |
| PF01546 | Peptidase_M20 | 0.78 |
| PF01743 | PolyA_pol | 0.78 |
| PF00856 | SET | 0.78 |
| PF04338 | DUF481 | 0.78 |
| PF17164 | DUF5122 | 0.78 |
| PF00072 | Response_reg | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.25 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.56 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.56 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.56 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.56 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.78 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.78 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.78 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.16 % |
| Unclassified | root | N/A | 14.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100186552 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004091|Ga0062387_100998524 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300004092|Ga0062389_100838316 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005586|Ga0066691_10199137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300005610|Ga0070763_10239166 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005610|Ga0070763_10527078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 678 | Open in IMG/M |
| 3300006052|Ga0075029_100116692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1616 | Open in IMG/M |
| 3300006059|Ga0075017_100555836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300006059|Ga0075017_101259109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 580 | Open in IMG/M |
| 3300006059|Ga0075017_101427509 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006102|Ga0075015_100278273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300006102|Ga0075015_101007645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis orientalis | 510 | Open in IMG/M |
| 3300006163|Ga0070715_10656607 | Not Available | 621 | Open in IMG/M |
| 3300006795|Ga0075520_1365207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 586 | Open in IMG/M |
| 3300006893|Ga0073928_11116570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 533 | Open in IMG/M |
| 3300007982|Ga0102924_1015595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5919 | Open in IMG/M |
| 3300009088|Ga0099830_11714123 | Not Available | 524 | Open in IMG/M |
| 3300009628|Ga0116125_1260746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 504 | Open in IMG/M |
| 3300009640|Ga0116126_1223743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 598 | Open in IMG/M |
| 3300009644|Ga0116121_1110595 | Not Available | 863 | Open in IMG/M |
| 3300009698|Ga0116216_10714273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009759|Ga0116101_1195812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 514 | Open in IMG/M |
| 3300009839|Ga0116223_10509854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300010048|Ga0126373_10816036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300010339|Ga0074046_10465561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 757 | Open in IMG/M |
| 3300010358|Ga0126370_11603197 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010376|Ga0126381_102718385 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300010376|Ga0126381_104385624 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300011120|Ga0150983_15897004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 981 | Open in IMG/M |
| 3300012685|Ga0137397_10668120 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012925|Ga0137419_11015057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 688 | Open in IMG/M |
| 3300012927|Ga0137416_10217454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300012971|Ga0126369_10077273 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300012971|Ga0126369_11500492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300014162|Ga0181538_10089363 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300014167|Ga0181528_10138306 | Not Available | 1319 | Open in IMG/M |
| 3300014495|Ga0182015_10332775 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300014657|Ga0181522_10432411 | Not Available | 789 | Open in IMG/M |
| 3300014838|Ga0182030_10232419 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300014838|Ga0182030_11068401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 703 | Open in IMG/M |
| 3300017948|Ga0187847_10364100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300018007|Ga0187805_10086946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 1411 | Open in IMG/M |
| 3300018024|Ga0187881_10486017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 502 | Open in IMG/M |
| 3300018025|Ga0187885_10052909 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300018026|Ga0187857_10314570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300018033|Ga0187867_10419516 | Not Available | 740 | Open in IMG/M |
| 3300018037|Ga0187883_10123969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
| 3300018038|Ga0187855_10016254 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300018038|Ga0187855_10649059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300018038|Ga0187855_10755446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 567 | Open in IMG/M |
| 3300018040|Ga0187862_10614154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 642 | Open in IMG/M |
| 3300018040|Ga0187862_10881572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 513 | Open in IMG/M |
| 3300018040|Ga0187862_10903098 | Not Available | 505 | Open in IMG/M |
| 3300018043|Ga0187887_10158837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300018044|Ga0187890_10162581 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300019786|Ga0182025_1186286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2222 | Open in IMG/M |
| 3300019787|Ga0182031_1471620 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300020579|Ga0210407_10150501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1793 | Open in IMG/M |
| 3300020583|Ga0210401_10876608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 757 | Open in IMG/M |
| 3300021180|Ga0210396_11201871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300021402|Ga0210385_11231480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 574 | Open in IMG/M |
| 3300022557|Ga0212123_10027566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6001 | Open in IMG/M |
| 3300022557|Ga0212123_10940657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 505 | Open in IMG/M |
| 3300022714|Ga0242671_1125224 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300023088|Ga0224555_1098135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 923 | Open in IMG/M |
| 3300025434|Ga0208690_1077514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300025444|Ga0208189_1042379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300025482|Ga0208715_1001749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 5444 | Open in IMG/M |
| 3300025922|Ga0207646_10961247 | Not Available | 756 | Open in IMG/M |
| 3300025928|Ga0207700_11263810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300025929|Ga0207664_11876218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300026502|Ga0255350_1059359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300026551|Ga0209648_10080986 | Not Available | 2711 | Open in IMG/M |
| 3300027117|Ga0209732_1022249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300027648|Ga0209420_1190236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 548 | Open in IMG/M |
| 3300027663|Ga0208990_1137853 | Not Available | 652 | Open in IMG/M |
| 3300027703|Ga0207862_1151953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 692 | Open in IMG/M |
| 3300027842|Ga0209580_10206027 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300027853|Ga0209274_10264812 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027855|Ga0209693_10377066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 686 | Open in IMG/M |
| 3300027898|Ga0209067_10667979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 600 | Open in IMG/M |
| 3300027898|Ga0209067_10901588 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300028023|Ga0265357_1021863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 703 | Open in IMG/M |
| 3300028047|Ga0209526_10305058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1077 | Open in IMG/M |
| 3300028566|Ga0302147_10224709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300028746|Ga0302233_10197657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300028808|Ga0302228_10224937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300028873|Ga0302197_10491717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 535 | Open in IMG/M |
| 3300029903|Ga0247271_115426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300029907|Ga0311329_10594580 | Not Available | 734 | Open in IMG/M |
| 3300029916|Ga0302148_1115482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300029939|Ga0311328_10728557 | Not Available | 668 | Open in IMG/M |
| 3300029945|Ga0311330_11100491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300029955|Ga0311342_10693763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300029999|Ga0311339_10027927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8124 | Open in IMG/M |
| 3300029999|Ga0311339_10066303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4690 | Open in IMG/M |
| 3300030007|Ga0311338_10824940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 921 | Open in IMG/M |
| 3300030520|Ga0311372_10538537 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300030524|Ga0311357_10553588 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300030580|Ga0311355_10474370 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300030677|Ga0302317_10371286 | Not Available | 633 | Open in IMG/M |
| 3300030740|Ga0265460_10686910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 865 | Open in IMG/M |
| 3300031090|Ga0265760_10186278 | Not Available | 695 | Open in IMG/M |
| 3300031235|Ga0265330_10313138 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031236|Ga0302324_102362308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 654 | Open in IMG/M |
| 3300031249|Ga0265339_10152098 | Not Available | 1169 | Open in IMG/M |
| 3300031249|Ga0265339_10182390 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300031250|Ga0265331_10323988 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031525|Ga0302326_11345981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300031708|Ga0310686_103498923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031708|Ga0310686_105284518 | Not Available | 555 | Open in IMG/M |
| 3300031708|Ga0310686_115914370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300031715|Ga0307476_10559989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300031715|Ga0307476_11322592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031718|Ga0307474_11665557 | Not Available | 500 | Open in IMG/M |
| 3300031753|Ga0307477_10855742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300031754|Ga0307475_10619284 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300031837|Ga0302315_10071832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2323 | Open in IMG/M |
| 3300031962|Ga0307479_12148632 | Not Available | 505 | Open in IMG/M |
| 3300032783|Ga0335079_12315647 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032805|Ga0335078_10208869 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300032828|Ga0335080_10578115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300032828|Ga0335080_10967314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 869 | Open in IMG/M |
| 3300032898|Ga0335072_10879724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 842 | Open in IMG/M |
| 3300032898|Ga0335072_11575811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 556 | Open in IMG/M |
| 3300033134|Ga0335073_10823530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 991 | Open in IMG/M |
| 3300033755|Ga0371489_0225063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300034124|Ga0370483_0055864 | Not Available | 1251 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1001865521 | 3300001213 | Wetland | AQLTSMYNKLINPIGYHADFNDITTGDPHCKVGWDLCTGLGSPKTYAGK* |
| Ga0062387_1009985242 | 3300004091 | Bog Forest Soil | LQQSTNDELTMMYNELANPTEYSADFNDITQGASQCKTGWDLCAGIGSAKTYAGK* |
| Ga0062389_1008383161 | 3300004092 | Bog Forest Soil | NELANPTEYSADFNDITQGAPQCMVGWDLCAGIGSPRTYAGK* |
| Ga0066691_101991371 | 3300005586 | Soil | TWLYSELANPTEYKADFYDITQGDSRCKIGFDRCTGIGSPRTYVGK* |
| Ga0070763_102391661 | 3300005610 | Soil | NSTQYKQFFNDITQGGSQCGVGFDKCTGIGSPRTYAGK* |
| Ga0070763_105270781 | 3300005610 | Soil | SKQKTTAAELTMMYDELANQTEYAADFYDITQGSSRCMIGWDLCAGIGTARTYVGK* |
| Ga0075029_1001166923 | 3300006052 | Watersheds | SSTAELTLMYNELANPLQYKADFNDIKQGDPLCSIGFDRCTGIGSPKTYVGK* |
| Ga0075017_1005558361 | 3300006059 | Watersheds | TWIYGELANPAEYSADFNDITQGDKRCMVGWDLCTGGGSPRGYGGK* |
| Ga0075017_1012591091 | 3300006059 | Watersheds | PAEYSADFNDITQGDKRCMVGWDLCTGIGSPRTYVGK* |
| Ga0075017_1014275091 | 3300006059 | Watersheds | ELANPSEYSADFNDITQGDKRCMVGWDLCTGVGSPRGYGGK* |
| Ga0075015_1002782731 | 3300006102 | Watersheds | NLMYGELANPTEYQAYFNDITQGDHRCTAGFDQCTGIGSPRTYGGK* |
| Ga0075015_1010076451 | 3300006102 | Watersheds | SNATTYKADFRDITKGATSCKVGWDVCTGIGVPKTYAGK* |
| Ga0070715_106566072 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NKQQHKAYFNDINTGDSRCKVGWDVCGGVGSPKTYAGK* |
| Ga0075520_13652071 | 3300006795 | Arctic Peat Soil | QLTTMYNELFSPIKYHADFNDITTGDPRCKVGWDLCTGIGSAKTYAGK* |
| Ga0073928_111165701 | 3300006893 | Iron-Sulfur Acid Spring | SRNELTWMYSELANPTEYKADFKDITLGDSRCKVGFDRCTGIGSPRTYVGK* |
| Ga0102924_10155959 | 3300007982 | Iron-Sulfur Acid Spring | MIELTAIYDELANPTEYKAAFNDITQGATQCTVGFDQCTGIGSAKTYKGK* |
| Ga0099830_117141231 | 3300009088 | Vadose Zone Soil | NELTWLYTELANPTEYSADFNDITQGDSRCKVGFDRCTGIGSPRTYVGK* |
| Ga0116125_12607461 | 3300009628 | Peatland | MMYDELANPSEYAADFYDITQGSSQCKVGWDLCAGIGTARTYVGK* |
| Ga0116126_12237432 | 3300009640 | Peatland | VNAAGNKQQSSVDELTWIYGELADPTEYAADFFDITAGASQCAVGWNLCAGV |
| Ga0116121_11105951 | 3300009644 | Peatland | TMYSELFNPIKYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK* |
| Ga0116216_107142732 | 3300009698 | Peatlands Soil | AEYSADFNDITLGDPRCMVGWDLCSGIGSARGYAGK* |
| Ga0116101_11958122 | 3300009759 | Peatland | MMYNELSSPIKYHADFNDITLGDPHCKVGWDLCTGIGSPHTYAGK* |
| Ga0116223_105098542 | 3300009839 | Peatlands Soil | MYSELANSTEYAADFYDITKGAKQCTTGWDLCAGIGSPRTYVGK* |
| Ga0126373_108160362 | 3300010048 | Tropical Forest Soil | QLTKMYNELANPIVYHADFNDITMGDRRCKIGWDLCTGLGSPRTYAGK* |
| Ga0074046_104655611 | 3300010339 | Bog Forest Soil | KMYNELGNPIEYHADFNDITMGDPRCKVGWDLCTGLGSAHTYAGK* |
| Ga0126370_116031971 | 3300010358 | Tropical Forest Soil | SSNAQLTMMYGEIGNPNEFFDVTQGSGQCKVGWDLCAGIGTPRTYAGK* |
| Ga0126381_1027183852 | 3300010376 | Tropical Forest Soil | GNKAKSSLYELTAIYRELANPTLYSERFNDITQGGSQCTVGFDECTGIGSPKTYAGK* |
| Ga0126381_1043856241 | 3300010376 | Tropical Forest Soil | KMYSELGNPIVYRADFNDITTGDSRCKPGWDLCTGIGSPKTYAGK* |
| Ga0150983_158970041 | 3300011120 | Forest Soil | QQSSVDELTWMYSELANPGEYAADFNDITQGASQCKVGWDLCAGIGSPRTYVGK* |
| Ga0137397_106681202 | 3300012685 | Vadose Zone Soil | DLANSTQYAADFNDITQGASQCGTGFDQCTGIGTPKTYAGK* |
| Ga0137419_110150572 | 3300012925 | Vadose Zone Soil | ELTWLYSELANPTEYKVDFKDITQGDSRCKIGFDRCTGIGSPRTYVGK* |
| Ga0137416_102174542 | 3300012927 | Vadose Zone Soil | SELANPTEYSADFYDITQGDSRCKVGFDRCTGIGSPRTYVGK* |
| Ga0126369_100772731 | 3300012971 | Tropical Forest Soil | SVQELTAMYKELANSTLYKENFNDITQGGSQCKTGFDMCTGIGSPKTYGGK* |
| Ga0126369_115004922 | 3300012971 | Tropical Forest Soil | SVQELTAMYKELANSTLYKENFNDITQGGSQCKTGFDMCTGVGSPKTYGGK* |
| Ga0181538_100893631 | 3300014162 | Bog | YHADFNDITTGDPRCKVGWDLCTGIGSAHTYAGK* |
| Ga0181528_101383062 | 3300014167 | Bog | SSPIKYHADFNDITTGDPRCKIGWDLCTGIGSAHTYAGK* |
| Ga0182015_103327751 | 3300014495 | Palsa | YNELANPTEYKADFNDITQGAPQCTTGWDLCAGIGSARTYAGK* |
| Ga0181522_104324112 | 3300014657 | Bog | SWIYTELFNPTEYADDFNDITQGGSQCKTGWDVCSGVGSARGYAGK* |
| Ga0182030_102324192 | 3300014838 | Bog | MMYKELANPTEYAADFYDITQGAPQCKVGWDLCAGIGSARTYVGK* |
| Ga0182030_110684012 | 3300014838 | Bog | NMMYSELSSPIKYHADFNDITTGDPRCKIGWDLCTGIGSAHTYAGK* |
| Ga0187847_103641001 | 3300017948 | Peatland | YGVTKEYKADFIDITSGSNGYACVAGWDYCTGIGAPKTYVGK |
| Ga0187805_100869461 | 3300018007 | Freshwater Sediment | VAELTMMYNELANPTEYADDFNDITLGGSLCKTGFDECTGIGSPRTYAGK |
| Ga0187881_104860172 | 3300018024 | Peatland | YNELANPTEYAADFYDITQGASQCMIGWDLCSGVGSARTYVGK |
| Ga0187885_100529091 | 3300018025 | Peatland | LFNPIKYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0187857_103145701 | 3300018026 | Peatland | TEYAADFYDITQGASQCMIGWDLCSGVGSARTYVGK |
| Ga0187867_104195162 | 3300018033 | Peatland | FNPIKYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0187883_101239692 | 3300018037 | Peatland | STVDELTWIYSELANPTEYAADFYDITQGASQCMIGWDLCSGVGSARTYVGK |
| Ga0187855_100162544 | 3300018038 | Peatland | MYSELFNPIKYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0187855_106490591 | 3300018038 | Peatland | NPSEYAADFFDITQGASQCSIGWDLCAGIGTARTYVGK |
| Ga0187855_107554461 | 3300018038 | Peatland | ELFNPIKYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0187862_106141542 | 3300018040 | Peatland | DELTWIYGELTDPTEYAADFFDITAGASQCAVGWDLCAGVGSPRTYAGK |
| Ga0187862_108815721 | 3300018040 | Peatland | NELASPIYHADFNDITLGDPRCKIGWDLCTGLGSPKTYAGK |
| Ga0187862_109030981 | 3300018040 | Peatland | HKAKGSVAELTMMYDELANPTEYADDFNDITQGSSECSVGFDKCSGIGSAKTYAGK |
| Ga0187887_101588371 | 3300018043 | Peatland | ANPTEYADDFNDITQGAPQCMVGWDLCAGIGSARTYAGK |
| Ga0187890_101625811 | 3300018044 | Peatland | HKSKSSVAELTMMYKELANPSEYSADFNDITQGAPQCGVGFDECTGIGSPKTYAGK |
| Ga0182025_11862861 | 3300019786 | Permafrost | MQPATCSNPSLDELTWMYSELANSGEYAEDFFDITKGAKQCKVGWDLCAGIGSPRTYAGK |
| Ga0182031_14716206 | 3300019787 | Bog | VNAAANKQQSTADELTWIYGELANPSEYAADFFDITKGASQCGVGWDFCAGIG |
| Ga0210407_101505011 | 3300020579 | Soil | SELANPGEYAADFNDITQGASQCKVGWDLCAGIGSPRTYVGK |
| Ga0210401_108766082 | 3300020583 | Soil | TEYKADFNDITQGDSHCKVGWDECAGVGSPKTYAGK |
| Ga0210396_112018712 | 3300021180 | Soil | AELTMMYNELANPAEYSADFNDITLGDPRCKVGWDLCTGIGSAKTYAGK |
| Ga0210385_112314801 | 3300021402 | Soil | YDELANQTEYAADFYDITQGSSRCMIGWDLCAGIGTARTYVGK |
| Ga0212123_100275669 | 3300022557 | Iron-Sulfur Acid Spring | MIELTAIYDELANPTEYKAAFNDITQGATQCTVGFDQCTGIGSAKTYKGK |
| Ga0212123_109406572 | 3300022557 | Iron-Sulfur Acid Spring | YSELANPTEYKADFKDITLGDSRCKVGFDRCTGIGSPRTYVGK |
| Ga0242671_11252242 | 3300022714 | Soil | ANPAEYSADFNDITLGDPRCKVGWDLCTGIGSAKTYAGK |
| Ga0224555_10981351 | 3300023088 | Soil | GSLIEYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0208690_10775142 | 3300025434 | Peatland | QSTNDELTMMYNELANPTEYADDFNDITQGASQCMVGWDLCAGIGSAKTYAGK |
| Ga0208189_10423791 | 3300025444 | Peatland | TADELTMMYDELANPTEYAADFNDITQGAPQCMVGWDLCAGIGSARTYAGK |
| Ga0208715_10017491 | 3300025482 | Arctic Peat Soil | YNELFSPIKYHADFNDITTGDPRCKVGWDLCTGIGSAKTYAGK |
| Ga0207646_109612472 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LANPTEYSADFNDITQGDSRCKVGFDRCTGIGSPRTYAGK |
| Ga0207700_112638101 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AKSSLYELNAIYRELANPTLYSERFNDITQGASQCKVGFDECTGIGSPKTYAGK |
| Ga0207664_118762181 | 3300025929 | Agricultural Soil | YGSQAYHSAYNDITSGDPNCKVGWDICTGVGSPATYRGK |
| Ga0255350_10593591 | 3300026502 | Soil | QSTADELTWIYGELANPSEYAADFFDITKGASQCGVGWDFCAGIGSPRTYAGK |
| Ga0209648_100809863 | 3300026551 | Grasslands Soil | MMYNELANATEYKADFYDITQGDARCKVGFDLCTGIGSPRTYVGK |
| Ga0209732_10222493 | 3300027117 | Forest Soil | KAKSSLYEHVMIYNDLANSKEYSADFNDITQGASQCAVGFDKCTGIGSPKTYAGK |
| Ga0209420_11902361 | 3300027648 | Forest Soil | TEYKADFYDITQGASQCMMGWDLCAGIGTARTYVGK |
| Ga0208990_11378532 | 3300027663 | Forest Soil | TEYKADFYDITQGDSRCKVGFDRCTGIGSPRTYVGK |
| Ga0207862_11519531 | 3300027703 | Tropical Forest Soil | VAQLTKMYNDLANPIEYHADFNDITMGDPRCKIGWDLCTGLGSPKTYAGK |
| Ga0209580_102060271 | 3300027842 | Surface Soil | ELANPIAYSADFNDITQGGSKCGVGFDECTGIGSPKTYAGK |
| Ga0209274_102648123 | 3300027853 | Soil | QYADFFNDITQGASQCGVGFDECTGIGSPRTYGGK |
| Ga0209693_103770662 | 3300027855 | Soil | SKQKTTAAELTMMYDELANQTEYAADFYDITQGSSRCMIGWDLCAGIGTARTYVGK |
| Ga0209067_106679792 | 3300027898 | Watersheds | AELNLIYGELANPTEYKAYFNDITQGDTRCTVGFDQCTGIGSPRTYGGK |
| Ga0209067_109015881 | 3300027898 | Watersheds | MMYNELANQTEYQADFNDITTGDPHCKTGWDLCAGIGSAKTYVGK |
| Ga0265357_10218631 | 3300028023 | Rhizosphere | VYHAHFNDITTGDSRCKPGWDLCTGLGSARTYAGK |
| Ga0209526_103050582 | 3300028047 | Forest Soil | MYSELANPLEYSADFNDITSGSSKCKVGWDECAGIGSPKTYVGK |
| Ga0302147_102247091 | 3300028566 | Bog | LANQSEYSADFNDITQGDSRCTVGFDQCTGIGSPKTYAGK |
| Ga0302233_101976572 | 3300028746 | Palsa | NELANPTEYKADFNDITQGAPQCTTGWDLCAGIGSARTYAGK |
| Ga0302228_102249371 | 3300028808 | Palsa | LMYKELANSSEYSSDFNDITQGAKQCAVGFDKCTGIGSPKTYAGK |
| Ga0302197_104917171 | 3300028873 | Bog | YNELGSLIEYHADFNDITTGDSRCKVGWDLCTGIGSAHTYAGK |
| Ga0247271_1154262 | 3300029903 | Soil | MMYNELANPTEYADDFNDITQGASQCMVGWDLCAGIGSAKTYAGK |
| Ga0311329_105945801 | 3300029907 | Bog | TVDELTWIYGELANQSEYSADFNDITQGDPRCTVGFDQCTGIGSPKTYTGK |
| Ga0302148_11154822 | 3300029916 | Bog | SVDELTWIYSELANQSEYSADFNDITQGDPRCTVGFDQCTGIGSAKTYAGK |
| Ga0311328_107285572 | 3300029939 | Bog | ELTWIYGELANQSEYSADFNDITQGDPRCTVGFDQCTGIGSPKTYTGK |
| Ga0311330_111004912 | 3300029945 | Bog | EYAADFNDITQGASQCTVGWDLCAGIGSARTYAGK |
| Ga0311342_106937632 | 3300029955 | Bog | QSEYSADFNDITQGDSRCTVGFDQCTGIGSPKTYAGK |
| Ga0311339_100279279 | 3300029999 | Palsa | ELSSPIKYHADFNDITLGDPHCKVGWDLCTGIGSPHTYAGK |
| Ga0311339_100663031 | 3300029999 | Palsa | ELTVLYNELANPTEYKADFNDITQGAPQCTTGWDLCAGIGSAHTYAGK |
| Ga0311338_108249401 | 3300030007 | Palsa | SPIRYHADFNDITMGDPRCKIGWDLCTGIGSPHTYAGK |
| Ga0311372_105385371 | 3300030520 | Palsa | PIKYHADFNDITLGDPHCKVGWDLCTGIGSPHTYAGK |
| Ga0311357_105535883 | 3300030524 | Palsa | LTVLYNELANPTEYKADFNDITQGAPQCTTGWDLCAGIGSARTYAGK |
| Ga0311355_104743702 | 3300030580 | Palsa | YGALANPLEYGADFFDITVGASQCAVGWDLCAGVGSPRTYLAK |
| Ga0302317_103712861 | 3300030677 | Palsa | SVAELTVMYDELVHRIAYAGDFNDITQGSPECSVGFDKCTGIGSPKTYAGK |
| Ga0265460_106869102 | 3300030740 | Soil | MYSELFSPIKYHADFNDITTGDSRCKVGWDLCTGIGSPHTYAGK |
| Ga0265760_101862781 | 3300031090 | Soil | KSSAAELTLMYKELANSSEYSSDFNDITQGAKQCAVGFDKCTGIGSPKTYAGK |
| Ga0265330_103131381 | 3300031235 | Rhizosphere | ELANPTEYQADFNDITSGDARCTVGFDQCTGIGSPRTYVGK |
| Ga0302324_1023623081 | 3300031236 | Palsa | PIRYHADFNDITMGDPRCKIGWDLCTGIGSPHTYAGK |
| Ga0265339_101520981 | 3300031249 | Rhizosphere | VAELNMIYNELANPTEYSADFNDITLGGSLCVAGFDKCTGVGSPKGYVGK |
| Ga0265339_101823902 | 3300031249 | Rhizosphere | ANPTEYQADFNDITSGDARCTVGFDQCTGIGSPRTYVGK |
| Ga0265331_103239882 | 3300031250 | Rhizosphere | ELTWMYGELANPTEYQADFNDITSGDARCTVGFDQCTGIGSPRTYVGK |
| Ga0302326_113459812 | 3300031525 | Palsa | KQKSTADELAWIYGELANPTEYEADFYDITQGASQCMVGWDLCSGVGSARTYAGK |
| Ga0310686_1034989233 | 3300031708 | Soil | QSSMDELTWIYGELENSTEYSDDFNDITQGARQCAIGWDLCAGIGSPKTYVGK |
| Ga0310686_1052845182 | 3300031708 | Soil | AKGSVAELSIMYKELENPTQYGADFNDITQGASQCGVGFDECSGIGSPKTYAGK |
| Ga0310686_1159143701 | 3300031708 | Soil | RYHADFNDITMGDPHCKVGWDLCTGIGSPHTYAGK |
| Ga0307476_105599892 | 3300031715 | Hardwood Forest Soil | TAAELTMMYDELANPAEYAADFFDVTQGSSQCKVGWDLCAGIGTARTYVGK |
| Ga0307476_113225921 | 3300031715 | Hardwood Forest Soil | MYRELANPIAYSADFNDITQGGSKCGVGFDECTGIGSPKTYAGK |
| Ga0307474_116655571 | 3300031718 | Hardwood Forest Soil | LTMIYDELANPTQYSTYFNDITLGGSLCVAGFDKCTGIGSPKGYVGK |
| Ga0307477_108557421 | 3300031753 | Hardwood Forest Soil | QTSSRNELTWMYSELANPTEYKADFYDITQGDSRCKVGFDQCTGIGSPRTYVGK |
| Ga0307475_106192842 | 3300031754 | Hardwood Forest Soil | SLDELTWMYSELANPTEYAADFNDITKGARQCTTGWDLCAGIGSPRTYAGK |
| Ga0302315_100718321 | 3300031837 | Palsa | YDELVHRIAYAGDFNDITQGSPECSVGFDKCTGIGSPKTYAGK |
| Ga0307479_121486321 | 3300031962 | Hardwood Forest Soil | LANPAEYKADFKDITQGDSRCKVGFDQCTGIGSPRTYVGK |
| Ga0335079_123156472 | 3300032783 | Soil | MYNELANPIVYRADFNDITMGDRRCKVGWDLCTGLGSPRGYAGK |
| Ga0335078_102088691 | 3300032805 | Soil | ELANSEEYSADFNDITQGARQCVTGYNECAGIGSPKTYAGK |
| Ga0335080_105781152 | 3300032828 | Soil | ANPQQYAAYFNDITAGGTHCMVGWDLCAGIGSPKTYGGK |
| Ga0335080_109673142 | 3300032828 | Soil | QYAAYFNDITAGDSRCKVGWDLCTGIGSPKTYGGK |
| Ga0335072_108797241 | 3300032898 | Soil | YSELANPIEYHADFNDITQGAPQCKIGWDLCTGLGSAHTYAGK |
| Ga0335072_115758111 | 3300032898 | Soil | STAAQLTMMYNEMGSPIIYHSDFNDITTGDPRCKIGWDLCTGIGSARTYIGK |
| Ga0335073_108235302 | 3300033134 | Soil | NELANPIEYHADFNDITQGAPQCKIGWDLCTGLGSAHTYAGK |
| Ga0371489_0225063_1_135 | 3300033755 | Peat Soil | MYNELANPAEYAADFYDITQGAAQCTVGWDLCAGIGSARTYAGK |
| Ga0370483_0055864_3_140 | 3300034124 | Untreated Peat Soil | MMYDELANPTEYADDFNDITQGAPQCTVGFDKCTGIGSPKTYAGK |
| ⦗Top⦘ |