| Basic Information | |
|---|---|
| Family ID | F065144 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITLGYTGD |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 59.84 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.531 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.281 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.844 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.719 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 13.64% Coil/Unstructured: 86.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 5.47 |
| PF01548 | DEDD_Tnp_IS110 | 1.56 |
| PF00665 | rve | 1.56 |
| PF00069 | Pkinase | 0.78 |
| PF11225 | DUF3024 | 0.78 |
| PF00491 | Arginase | 0.78 |
| PF12680 | SnoaL_2 | 0.78 |
| PF02796 | HTH_7 | 0.78 |
| PF02322 | Cyt_bd_oxida_II | 0.78 |
| PF00196 | GerE | 0.78 |
| PF01638 | HxlR | 0.78 |
| PF13565 | HTH_32 | 0.78 |
| PF00239 | Resolvase | 0.78 |
| PF13340 | DUF4096 | 0.78 |
| PF13470 | PIN_3 | 0.78 |
| PF13586 | DDE_Tnp_1_2 | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.12 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.56 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.56 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.78 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.78 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.78 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.78 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.53 % |
| All Organisms | root | All Organisms | 30.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004153|Ga0063455_101226354 | Not Available | 565 | Open in IMG/M |
| 3300004633|Ga0066395_10034717 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300005363|Ga0008090_14987112 | Not Available | 569 | Open in IMG/M |
| 3300005467|Ga0070706_100514404 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300005471|Ga0070698_100247519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1715 | Open in IMG/M |
| 3300005471|Ga0070698_100389507 | Not Available | 1326 | Open in IMG/M |
| 3300005616|Ga0068852_100885985 | Not Available | 909 | Open in IMG/M |
| 3300005713|Ga0066905_101879083 | Not Available | 554 | Open in IMG/M |
| 3300006028|Ga0070717_11514181 | Not Available | 608 | Open in IMG/M |
| 3300006046|Ga0066652_102070311 | Not Available | 505 | Open in IMG/M |
| 3300006059|Ga0075017_100785021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300006163|Ga0070715_10835808 | Not Available | 562 | Open in IMG/M |
| 3300006175|Ga0070712_100818538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300006175|Ga0070712_101898599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300006852|Ga0075433_10303373 | Not Available | 1414 | Open in IMG/M |
| 3300006854|Ga0075425_102316637 | Not Available | 597 | Open in IMG/M |
| 3300006904|Ga0075424_100351229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1571 | Open in IMG/M |
| 3300006954|Ga0079219_10792104 | Not Available | 743 | Open in IMG/M |
| 3300009089|Ga0099828_11422153 | Not Available | 612 | Open in IMG/M |
| 3300009698|Ga0116216_10455691 | Not Available | 774 | Open in IMG/M |
| 3300009824|Ga0116219_10251409 | Not Available | 1003 | Open in IMG/M |
| 3300009839|Ga0116223_10222510 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010396|Ga0134126_10481218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 1433 | Open in IMG/M |
| 3300012206|Ga0137380_10146033 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300012354|Ga0137366_10028699 | All Organisms → cellular organisms → Bacteria | 4322 | Open in IMG/M |
| 3300012356|Ga0137371_10628847 | Not Available | 823 | Open in IMG/M |
| 3300012363|Ga0137390_10172788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2148 | Open in IMG/M |
| 3300012515|Ga0157338_1059879 | Not Available | 569 | Open in IMG/M |
| 3300012925|Ga0137419_10659914 | Not Available | 845 | Open in IMG/M |
| 3300012929|Ga0137404_11170183 | Not Available | 707 | Open in IMG/M |
| 3300012948|Ga0126375_10187610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1344 | Open in IMG/M |
| 3300012958|Ga0164299_10358287 | Not Available | 921 | Open in IMG/M |
| 3300014838|Ga0182030_11577487 | Not Available | 538 | Open in IMG/M |
| 3300014968|Ga0157379_11487718 | Not Available | 658 | Open in IMG/M |
| 3300016422|Ga0182039_10702249 | Not Available | 892 | Open in IMG/M |
| 3300016445|Ga0182038_11107184 | Not Available | 704 | Open in IMG/M |
| 3300017821|Ga0187812_1015290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2651 | Open in IMG/M |
| 3300017821|Ga0187812_1141554 | Not Available | 776 | Open in IMG/M |
| 3300017926|Ga0187807_1193881 | Not Available | 657 | Open in IMG/M |
| 3300017928|Ga0187806_1022167 | Not Available | 1846 | Open in IMG/M |
| 3300017928|Ga0187806_1093304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 955 | Open in IMG/M |
| 3300017942|Ga0187808_10006882 | All Organisms → cellular organisms → Bacteria | 4339 | Open in IMG/M |
| 3300017943|Ga0187819_10520696 | Not Available | 677 | Open in IMG/M |
| 3300017946|Ga0187879_10311823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 873 | Open in IMG/M |
| 3300017955|Ga0187817_10252461 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300017959|Ga0187779_10525573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
| 3300017961|Ga0187778_10397409 | Not Available | 904 | Open in IMG/M |
| 3300018007|Ga0187805_10170645 | Not Available | 991 | Open in IMG/M |
| 3300018043|Ga0187887_10084376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1922 | Open in IMG/M |
| 3300018058|Ga0187766_11000034 | Not Available | 595 | Open in IMG/M |
| 3300018085|Ga0187772_10809096 | Not Available | 677 | Open in IMG/M |
| 3300018482|Ga0066669_11158045 | Not Available | 698 | Open in IMG/M |
| 3300019789|Ga0137408_1243148 | Not Available | 730 | Open in IMG/M |
| 3300020580|Ga0210403_10688377 | Not Available | 820 | Open in IMG/M |
| 3300020583|Ga0210401_11075530 | Not Available | 663 | Open in IMG/M |
| 3300021178|Ga0210408_11058451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300021407|Ga0210383_10217976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300021432|Ga0210384_11400476 | Not Available | 604 | Open in IMG/M |
| 3300021475|Ga0210392_10854495 | Not Available | 680 | Open in IMG/M |
| 3300021478|Ga0210402_11450554 | Not Available | 613 | Open in IMG/M |
| 3300021479|Ga0210410_10300752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1440 | Open in IMG/M |
| 3300021479|Ga0210410_11336220 | Not Available | 609 | Open in IMG/M |
| 3300025898|Ga0207692_10530580 | Not Available | 750 | Open in IMG/M |
| 3300025914|Ga0207671_10642565 | Not Available | 845 | Open in IMG/M |
| 3300026078|Ga0207702_11219583 | Not Available | 746 | Open in IMG/M |
| 3300027696|Ga0208696_1256691 | Not Available | 542 | Open in IMG/M |
| 3300027775|Ga0209177_10411586 | Not Available | 544 | Open in IMG/M |
| 3300027908|Ga0209006_10885641 | Not Available | 718 | Open in IMG/M |
| 3300028906|Ga0308309_10661616 | Not Available | 907 | Open in IMG/M |
| 3300029951|Ga0311371_12230967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300029999|Ga0311339_10096823 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
| 3300030617|Ga0311356_11472751 | Not Available | 617 | Open in IMG/M |
| 3300031543|Ga0318516_10273304 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300031543|Ga0318516_10447379 | Not Available | 743 | Open in IMG/M |
| 3300031543|Ga0318516_10555756 | Not Available | 657 | Open in IMG/M |
| 3300031543|Ga0318516_10581033 | Not Available | 640 | Open in IMG/M |
| 3300031546|Ga0318538_10725342 | Not Available | 539 | Open in IMG/M |
| 3300031561|Ga0318528_10394990 | Not Available | 742 | Open in IMG/M |
| 3300031564|Ga0318573_10166975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora limicola | 1159 | Open in IMG/M |
| 3300031564|Ga0318573_10262161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
| 3300031679|Ga0318561_10397617 | Not Available | 757 | Open in IMG/M |
| 3300031680|Ga0318574_10270874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 984 | Open in IMG/M |
| 3300031680|Ga0318574_10868563 | Not Available | 528 | Open in IMG/M |
| 3300031681|Ga0318572_10409061 | Not Available | 807 | Open in IMG/M |
| 3300031708|Ga0310686_119744414 | Not Available | 514 | Open in IMG/M |
| 3300031708|Ga0310686_119855689 | Not Available | 674 | Open in IMG/M |
| 3300031713|Ga0318496_10624078 | Not Available | 595 | Open in IMG/M |
| 3300031719|Ga0306917_10492398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300031723|Ga0318493_10694543 | Not Available | 570 | Open in IMG/M |
| 3300031723|Ga0318493_10758774 | Not Available | 545 | Open in IMG/M |
| 3300031747|Ga0318502_11029773 | Not Available | 502 | Open in IMG/M |
| 3300031765|Ga0318554_10354214 | Not Available | 834 | Open in IMG/M |
| 3300031771|Ga0318546_10473785 | Not Available | 878 | Open in IMG/M |
| 3300031778|Ga0318498_10227280 | Not Available | 844 | Open in IMG/M |
| 3300031792|Ga0318529_10051691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1772 | Open in IMG/M |
| 3300031792|Ga0318529_10172027 | Not Available | 1001 | Open in IMG/M |
| 3300031794|Ga0318503_10195048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300031798|Ga0318523_10577235 | Not Available | 554 | Open in IMG/M |
| 3300031798|Ga0318523_10653374 | Not Available | 517 | Open in IMG/M |
| 3300031819|Ga0318568_10207012 | Not Available | 1211 | Open in IMG/M |
| 3300031832|Ga0318499_10213000 | Not Available | 752 | Open in IMG/M |
| 3300031846|Ga0318512_10666518 | Not Available | 532 | Open in IMG/M |
| 3300031860|Ga0318495_10363605 | Not Available | 640 | Open in IMG/M |
| 3300031879|Ga0306919_10577721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → unclassified Leifsonia → Leifsonia sp. Root227 | 867 | Open in IMG/M |
| 3300031890|Ga0306925_12102470 | Not Available | 529 | Open in IMG/M |
| 3300031910|Ga0306923_11349710 | Not Available | 754 | Open in IMG/M |
| 3300031912|Ga0306921_11881418 | Not Available | 641 | Open in IMG/M |
| 3300031942|Ga0310916_11566577 | Not Available | 536 | Open in IMG/M |
| 3300031954|Ga0306926_11127675 | Not Available | 926 | Open in IMG/M |
| 3300031954|Ga0306926_12409015 | Not Available | 580 | Open in IMG/M |
| 3300032001|Ga0306922_10716368 | Not Available | 1052 | Open in IMG/M |
| 3300032009|Ga0318563_10127110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300032044|Ga0318558_10443042 | Not Available | 647 | Open in IMG/M |
| 3300032054|Ga0318570_10460296 | Not Available | 580 | Open in IMG/M |
| 3300032054|Ga0318570_10537863 | Not Available | 533 | Open in IMG/M |
| 3300032065|Ga0318513_10184618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1002 | Open in IMG/M |
| 3300032066|Ga0318514_10349437 | Not Available | 783 | Open in IMG/M |
| 3300032067|Ga0318524_10466159 | Not Available | 661 | Open in IMG/M |
| 3300032068|Ga0318553_10466197 | Not Available | 662 | Open in IMG/M |
| 3300032089|Ga0318525_10251778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 908 | Open in IMG/M |
| 3300032261|Ga0306920_102195529 | Not Available | 768 | Open in IMG/M |
| 3300032828|Ga0335080_10969730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 868 | Open in IMG/M |
| 3300032954|Ga0335083_10254580 | Not Available | 1568 | Open in IMG/M |
| 3300032955|Ga0335076_10621917 | Not Available | 962 | Open in IMG/M |
| 3300033158|Ga0335077_10399870 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300033290|Ga0318519_11041947 | Not Available | 509 | Open in IMG/M |
| 3300033806|Ga0314865_194763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575 | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063455_1012263541 | 3300004153 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTLGYTGDGKRQRR* |
| Ga0066395_100347171 | 3300004633 | Tropical Forest Soil | MATRRRRGENGISFEHRGPCRDPERHRHCPGLWRGEFTLGYTD |
| Ga0008090_149871121 | 3300005363 | Tropical Rainforest Soil | MATRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGEFTLGYTGDG |
| Ga0070706_1005144041 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTTGYT |
| Ga0070698_1002475195 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEVVGTHRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTTGYTG |
| Ga0070698_1003895072 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTTGYTG |
| Ga0068852_1008859852 | 3300005616 | Corn Rhizosphere | MTTRRRRGEDGISFEHRGPCTDPHRHRHCPGLWRGE |
| Ga0066905_1018790832 | 3300005713 | Tropical Forest Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITMGYTEAGKR |
| Ga0070717_115141812 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTVGYTGDGKRQRRKVS |
| Ga0066652_1020703112 | 3300006046 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRG |
| Ga0075017_1007850211 | 3300006059 | Watersheds | MATRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLGYTGDG |
| Ga0070715_108358083 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTLGYTGDGKRQR |
| Ga0070712_1008185381 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGELT |
| Ga0070712_1018985992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTRRRRGEDGISFEHRGPCTDPHRHRHCPGLWRGELT |
| Ga0075433_103033731 | 3300006852 | Populus Rhizosphere | MAARRRRGEDGISFEHRGPCSDPERHRHCPGLWRGEITLGYTEDGRRNRR |
| Ga0075425_1023166372 | 3300006854 | Populus Rhizosphere | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGE |
| Ga0075424_1003512291 | 3300006904 | Populus Rhizosphere | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEVTLGYTEA |
| Ga0079219_107921041 | 3300006954 | Agricultural Soil | MTTRRRRGEDGISFEHRGPCCDPHRHRHCPGLWRGELTVGYT |
| Ga0099828_114221531 | 3300009089 | Vadose Zone Soil | MATRRRRGEDGISFEHRGPCLDRARHRHCPGLWRGEVTLG |
| Ga0116216_104556911 | 3300009698 | Peatlands Soil | MATRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLGYTGDGKR |
| Ga0116219_102514091 | 3300009824 | Peatlands Soil | MTTRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGEITLG |
| Ga0116223_102225102 | 3300009839 | Peatlands Soil | MTTRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGEI |
| Ga0134126_104812181 | 3300010396 | Terrestrial Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGEITTGYTGDGKRT |
| Ga0137380_101460334 | 3300012206 | Vadose Zone Soil | MATRRRRGEDGISFEHRGACRDPERHRHCPGLWRGEV |
| Ga0137366_100286995 | 3300012354 | Vadose Zone Soil | MTTRRRRGEDGISFAHRGPCSDPHRHRHCPGLWRGELTLGYTGGGKRQR |
| Ga0137371_106288471 | 3300012356 | Vadose Zone Soil | MATRRRRDEDGISFEHRGPCRDPKRHRHCPGLWRGEFTLGYTGDGTRTRR |
| Ga0137390_101727882 | 3300012363 | Vadose Zone Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEFTTGYTGDGTRTRRKVS |
| Ga0157338_10598791 | 3300012515 | Arabidopsis Rhizosphere | MTPRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTLG |
| Ga0137419_106599142 | 3300012925 | Vadose Zone Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTLGYTG |
| Ga0137404_111701831 | 3300012929 | Vadose Zone Soil | MTATRRRRGEDGISFEHRGPCTDPHRHRHCPGLWRGELTLGYSGDGKRQRRK |
| Ga0126375_101876101 | 3300012948 | Tropical Forest Soil | MATRRRRGEDEISFEHRRPCRDPERHRHCPGLWRGESTLGYTG |
| Ga0164299_103582871 | 3300012958 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTLG |
| Ga0182030_115774871 | 3300014838 | Bog | MTATRRRRGEDGISFEHRGPCTDPHRHRHCPGLWRGELTL |
| Ga0157379_114877182 | 3300014968 | Switchgrass Rhizosphere | MATRRRGGEDGISFEHRGPCSDPQRHRHCPGLWRGELTVGYTGDGK |
| Ga0182039_107022491 | 3300016422 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGE |
| Ga0182038_111071841 | 3300016445 | Soil | MATRRRRGEDGISFEHRGACRDPQRHRHCSGLWRGEVSLG |
| Ga0187812_10152905 | 3300017821 | Freshwater Sediment | MTTRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITLGYTGDGKRQRRKV |
| Ga0187812_11415542 | 3300017821 | Freshwater Sediment | MTTRRRHGEDGISFEHRGPCRDPHRHHNCPGLWRGEFTTG |
| Ga0187807_11938811 | 3300017926 | Freshwater Sediment | MAARRRRGEDGISFEHRGSCRDPGRHRHCPGLWRGEVT |
| Ga0187806_10221673 | 3300017928 | Freshwater Sediment | MTTRRRRGEDGISFEHRGPCRDPDRHRHCPGLWRGDITTGYTGDG |
| Ga0187806_10933041 | 3300017928 | Freshwater Sediment | MAATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITLGYTGDGKRARRK |
| Ga0187808_100068827 | 3300017942 | Freshwater Sediment | MTTRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGEIT |
| Ga0187819_105206962 | 3300017943 | Freshwater Sediment | MATRRRRGEDSISFEHRGPCRDPHRHRNCPGLWRGELTLGYTPDGKRQRRKV |
| Ga0187879_103118232 | 3300017946 | Peatland | VDEVLGTHRRRRGEDGISFEHRGPCRDPQRHRNCPGLWRGEFTTGYTGDG |
| Ga0187817_102524612 | 3300017955 | Freshwater Sediment | MTATRRRRGENGISFEHRGPCRDPERHRHCPGLWRGEI |
| Ga0187779_105255732 | 3300017959 | Tropical Peatland | MATRRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGEITLGYT |
| Ga0187778_103974092 | 3300017961 | Tropical Peatland | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITLGYTGD |
| Ga0187805_101706451 | 3300018007 | Freshwater Sediment | MTTRRLHGEDGISFEHRGPCRDPHRHRNCPGLWRGEFTTGYTGDGK |
| Ga0187887_100843763 | 3300018043 | Peatland | MTATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRAELTTGYTDD |
| Ga0187766_110000341 | 3300018058 | Tropical Peatland | MAARRRRGEDGISFEHRGGPCRDPGRHRNCPGLWRGEITLGYTSDGKRDR |
| Ga0187772_108090961 | 3300018085 | Tropical Peatland | MATRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGELTL |
| Ga0066669_111580451 | 3300018482 | Grasslands Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTLGYTGDGKR |
| Ga0137408_12431481 | 3300019789 | Vadose Zone Soil | MTATRRRRGEDGISFEHLGPCTDPHRHRHCPACGAAS |
| Ga0210403_106883772 | 3300020580 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTLGYAGD |
| Ga0210401_110755301 | 3300020583 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTVGYTGDGKRTRRK |
| Ga0210408_110584512 | 3300021178 | Soil | MATRRRRGEDGISFEHRGPRRDPHRHRHCPGMWRGELTVGYT |
| Ga0210383_102179763 | 3300021407 | Soil | MTATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEITLGYTGAG |
| Ga0210384_114004762 | 3300021432 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTV |
| Ga0210392_108544951 | 3300021475 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRHCPGLWRGEITTGYT |
| Ga0210402_114505541 | 3300021478 | Soil | MTTRRRRGEDGISFEHRGPCSDPQRHRNCPGLWRGE |
| Ga0210410_103007523 | 3300021479 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGEITTGYTGD |
| Ga0210410_113362201 | 3300021479 | Soil | MATRRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGELTLGYTG |
| Ga0207692_105305801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATRRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGELTVGYTG |
| Ga0207671_106425652 | 3300025914 | Corn Rhizosphere | MATRRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGELTVGYT |
| Ga0207702_112195831 | 3300026078 | Corn Rhizosphere | MSTRRRRGEDGISFEHRGPCADPHRHRHCPGLWRGELTTGYTSDGKRQRRKV |
| Ga0208696_12566911 | 3300027696 | Peatlands Soil | MATRRMRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLGYTGD |
| Ga0209177_104115861 | 3300027775 | Agricultural Soil | MATRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLG |
| Ga0209006_108856411 | 3300027908 | Forest Soil | MTTRRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGEITLGYTGDGKRARR |
| Ga0308309_106616161 | 3300028906 | Soil | MTATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEL |
| Ga0311371_122309672 | 3300029951 | Palsa | VDEVLGTHRRRRGEDGISFEHRGPCRDPQRHRHCPGLWRGEITLGYTGDGKRAR |
| Ga0311339_100968231 | 3300029999 | Palsa | MATRRRHGEDGISFEHRGPCRDPQRHRTCPGLWRGEFT |
| Ga0311356_114727512 | 3300030617 | Palsa | MTARRRHGEDGISFEHRGPCRDPRRHRTCPGLWRGEFTTGYTG |
| Ga0318516_102733042 | 3300031543 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEIT |
| Ga0318516_104473792 | 3300031543 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEMTLGYAEDGRR |
| Ga0318516_105557562 | 3300031543 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITLG |
| Ga0318516_105810331 | 3300031543 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTVGYTGDRKR |
| Ga0318538_107253421 | 3300031546 | Soil | MATRRRRGEDGISFEHRGPCSDPKRHRHCPGLWRGEITTGYTGDGKRTRRKVSG |
| Ga0318528_103949902 | 3300031561 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEFTLGYTEDGT |
| Ga0318573_101669751 | 3300031564 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRTCPGLWRGEITTGYTGDGKRT |
| Ga0318573_102621611 | 3300031564 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEITLGY |
| Ga0318561_103976171 | 3300031679 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEIT |
| Ga0318574_102708741 | 3300031680 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEFTLGYTED |
| Ga0318574_108685631 | 3300031680 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTVGYTGDG |
| Ga0318572_104090611 | 3300031681 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELT |
| Ga0310686_1197444142 | 3300031708 | Soil | MTTRRRHGEDGISFEHRGPCRDPQRHRNCPGLWRGEFTTGYTGDGTRTRRK |
| Ga0310686_1198556892 | 3300031708 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEFTTGYTGDG |
| Ga0318496_106240781 | 3300031713 | Soil | MATRRRRGEDGISFEHRGTCSDPNRHRHCPGLWRGEITTGYTGD |
| Ga0306917_104923981 | 3300031719 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEITLGYTGDGRRTRR |
| Ga0318493_106945431 | 3300031723 | Soil | MATRRRRGEDGISFEHRGPCRDPARHRNCPGLWRGEITTG |
| Ga0318493_107587741 | 3300031723 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTVGYTGDG |
| Ga0318502_110297731 | 3300031747 | Soil | MATRRRRGEDGISFEHRGPCSDPKRHRHCPGLWRGEITVGYT |
| Ga0318554_103542142 | 3300031765 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRHCPGLWRGEITLGYTGDG |
| Ga0318546_104737852 | 3300031771 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLGYTGDGKRT |
| Ga0318498_102272801 | 3300031778 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITTGYTGD |
| Ga0318529_100516913 | 3300031792 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEFTLGYTEEG |
| Ga0318529_101720273 | 3300031792 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITLGYT |
| Ga0318503_101950482 | 3300031794 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEITLGYTG |
| Ga0318523_105772351 | 3300031798 | Soil | MATRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTVGYTGDG |
| Ga0318523_106533742 | 3300031798 | Soil | MTTRRRRGEDGISFEHRGPCRDPYRHRHCPGRWRGEI |
| Ga0318568_102070121 | 3300031819 | Soil | MATRRRRGEDGISFEHRGPCRDPDRHRHCPGLWRGEFTLGYTGDGT |
| Ga0318499_102130002 | 3300031832 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTVGYTG |
| Ga0318512_106665181 | 3300031846 | Soil | MATRRRRGEDGISFEHRGPCHDPERHRHCPGLWRGEITLGYTGDG |
| Ga0318495_103636051 | 3300031860 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITLGYTG |
| Ga0306919_105777212 | 3300031879 | Soil | MATRRRRGEDGISFEHRGTCSDPNRHRHCPGLWRGEITTGYTGDGKR |
| Ga0306925_121024702 | 3300031890 | Soil | MATRRRRGEDGISFEHRGPCRDPERHRHCPGLWRGEMTLGYAEDG |
| Ga0306923_113497101 | 3300031910 | Soil | MANRRRRGEDGISFEHRGGPCRDPGRHRNCPGLWRGEITLGYTGDG |
| Ga0306921_118814182 | 3300031912 | Soil | MAARRRRGEDGISFEHRGPCRDPGRHRHCPGLWRGEVTLGYSEDGRRQRRK |
| Ga0310916_115665771 | 3300031942 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELTVGYTGDGKRQRRKV |
| Ga0306926_111276751 | 3300031954 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRNCPGLWRGEITLGYTG |
| Ga0306926_124090151 | 3300031954 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGEITVGYT |
| Ga0306922_107163681 | 3300032001 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITTGYTGDGKRT |
| Ga0318563_101271103 | 3300032009 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEITLG |
| Ga0318569_105137361 | 3300032010 | Soil | MATRRRRGEDGISFEHRAGPCRDPSRHRHCPGLWRGEITLGYTGDGKRNRRKVS |
| Ga0318558_104430422 | 3300032044 | Soil | MATRRRRGEDGISFEHRGACRDPQRHRHCPGLWRGEVSLGYTV |
| Ga0318570_104602961 | 3300032054 | Soil | MATRRRRGEDGISFEHRGACRDPQRHRHCSGLWRGEVSLGYT |
| Ga0318570_105378631 | 3300032054 | Soil | MAARRRRGEDGISFEHRGPCRDPRRHRNCPGLWRGEITTGYTG |
| Ga0318513_101846182 | 3300032065 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRTCPGLWRGEITLGYTGDGRRT |
| Ga0318514_103494372 | 3300032066 | Soil | MATRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGELSVG |
| Ga0318524_104661591 | 3300032067 | Soil | MTTRRRRGEDGISFEHRGPCRDPHRHRHCPGLWRGEITTGY |
| Ga0318553_104661971 | 3300032068 | Soil | MATRRRRGEDGISFEHRGPCRDPRRHRHCPGLWRGEITLGYT |
| Ga0318525_102517782 | 3300032089 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGELTVGYTGD |
| Ga0306920_1021955292 | 3300032261 | Soil | MATRRRRGEDGISFEHRGPCSDPLRHRHCPGLWRGEITLGYTGDGK |
| Ga0335080_109697302 | 3300032828 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRG |
| Ga0335083_102545802 | 3300032954 | Soil | MSTRRRRGEDGISFEHRGPCTDPHRHRHCPGLWRGEL |
| Ga0335076_106219171 | 3300032955 | Soil | MAARRRRGEDGISFEHRGPCSDPQRHRHCPGLWRGEMTLGYTSDGKRAR |
| Ga0335077_103998701 | 3300033158 | Soil | MTTRRRRGEDGISFEHRGPCSDPHRHRHCPGLWRGE |
| Ga0318519_110419471 | 3300033290 | Soil | MATRRRRGEDGISFEHRAGPCRDPSRHRHCPGLWRGEITLGY |
| Ga0314865_194763_412_543 | 3300033806 | Peatland | MATRRRRGEDGISFEHRGACRDPERHRHCPGLWRGEITLGYTED |
| ⦗Top⦘ |