| Basic Information | |
|---|---|
| Family ID | F065140 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.34 % |
| % of genes near scaffold ends (potentially truncated) | 85.94 % |
| % of genes from short scaffolds (< 2000 bps) | 89.06 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.688 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.531 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 0.00% Coil/Unstructured: 82.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF08714 | Fae | 27.34 |
| PF13378 | MR_MLE_C | 7.81 |
| PF07969 | Amidohydro_3 | 7.03 |
| PF00465 | Fe-ADH | 7.03 |
| PF14833 | NAD_binding_11 | 4.69 |
| PF00221 | Lyase_aromatic | 3.91 |
| PF01979 | Amidohydro_1 | 3.91 |
| PF03446 | NAD_binding_2 | 3.91 |
| PF02746 | MR_MLE_N | 3.12 |
| PF01613 | Flavin_Reduct | 2.34 |
| PF01343 | Peptidase_S49 | 1.56 |
| PF13594 | Obsolete Pfam Family | 1.56 |
| PF12911 | OppC_N | 0.78 |
| PF12850 | Metallophos_2 | 0.78 |
| PF13692 | Glyco_trans_1_4 | 0.78 |
| PF08352 | oligo_HPY | 0.78 |
| PF00528 | BPD_transp_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 27.34 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 7.03 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 7.03 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 7.03 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 7.03 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 6.25 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 3.91 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.12 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 2.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.69 % |
| All Organisms | root | All Organisms | 45.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102IU1FR | Not Available | 542 | Open in IMG/M |
| 2189573001|GZR05M102IH846 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005435|Ga0070714_100097282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2587 | Open in IMG/M |
| 3300005436|Ga0070713_101525296 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005445|Ga0070708_100023879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5204 | Open in IMG/M |
| 3300005467|Ga0070706_100027593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia tenerifensis | 5225 | Open in IMG/M |
| 3300005468|Ga0070707_100008253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia tenerifensis | 9665 | Open in IMG/M |
| 3300005538|Ga0070731_11079052 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005614|Ga0068856_101170370 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005616|Ga0068852_100279131 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300006028|Ga0070717_11206168 | Not Available | 689 | Open in IMG/M |
| 3300006059|Ga0075017_101069580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300006163|Ga0070715_11048526 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006175|Ga0070712_101528273 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006176|Ga0070765_101748788 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006755|Ga0079222_10719963 | Not Available | 795 | Open in IMG/M |
| 3300006804|Ga0079221_11471309 | Not Available | 545 | Open in IMG/M |
| 3300006854|Ga0075425_100755319 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300006954|Ga0079219_10310126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 984 | Open in IMG/M |
| 3300009148|Ga0105243_10242545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1604 | Open in IMG/M |
| 3300009162|Ga0075423_11255815 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300009520|Ga0116214_1205684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 741 | Open in IMG/M |
| 3300009545|Ga0105237_11106682 | Not Available | 799 | Open in IMG/M |
| 3300009792|Ga0126374_11863783 | Not Available | 505 | Open in IMG/M |
| 3300010366|Ga0126379_11335217 | Not Available | 823 | Open in IMG/M |
| 3300010366|Ga0126379_12752721 | Not Available | 588 | Open in IMG/M |
| 3300010371|Ga0134125_12908514 | Not Available | 520 | Open in IMG/M |
| 3300010379|Ga0136449_101023633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia rubra | 1326 | Open in IMG/M |
| 3300010399|Ga0134127_11740724 | Not Available | 699 | Open in IMG/M |
| 3300010876|Ga0126361_10645468 | Not Available | 833 | Open in IMG/M |
| 3300010880|Ga0126350_10053856 | Not Available | 1193 | Open in IMG/M |
| 3300012206|Ga0137380_11511574 | Not Available | 556 | Open in IMG/M |
| 3300012210|Ga0137378_11482838 | Not Available | 590 | Open in IMG/M |
| 3300012357|Ga0137384_10320463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1287 | Open in IMG/M |
| 3300012473|Ga0157340_1029311 | Not Available | 507 | Open in IMG/M |
| 3300012515|Ga0157338_1061079 | Not Available | 566 | Open in IMG/M |
| 3300012927|Ga0137416_11581790 | Not Available | 596 | Open in IMG/M |
| 3300012955|Ga0164298_11608788 | Not Available | 512 | Open in IMG/M |
| 3300012958|Ga0164299_11147040 | Not Available | 584 | Open in IMG/M |
| 3300012961|Ga0164302_10143720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1394 | Open in IMG/M |
| 3300013104|Ga0157370_11034399 | Not Available | 743 | Open in IMG/M |
| 3300014838|Ga0182030_10031538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9305 | Open in IMG/M |
| 3300015372|Ga0132256_101838474 | Not Available | 713 | Open in IMG/M |
| 3300015374|Ga0132255_100643836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1570 | Open in IMG/M |
| 3300016294|Ga0182041_10337718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300016341|Ga0182035_11249810 | Not Available | 664 | Open in IMG/M |
| 3300016387|Ga0182040_10204757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1453 | Open in IMG/M |
| 3300016404|Ga0182037_11529682 | Not Available | 592 | Open in IMG/M |
| 3300017946|Ga0187879_10063215 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300017946|Ga0187879_10873071 | Not Available | 503 | Open in IMG/M |
| 3300018019|Ga0187874_10309509 | Not Available | 642 | Open in IMG/M |
| 3300020002|Ga0193730_1026471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1678 | Open in IMG/M |
| 3300020070|Ga0206356_10906761 | Not Available | 618 | Open in IMG/M |
| 3300020582|Ga0210395_11116709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300021180|Ga0210396_11107661 | Not Available | 666 | Open in IMG/M |
| 3300021402|Ga0210385_10976015 | Not Available | 651 | Open in IMG/M |
| 3300021402|Ga0210385_11351295 | Not Available | 545 | Open in IMG/M |
| 3300021403|Ga0210397_11310766 | Not Available | 562 | Open in IMG/M |
| 3300021420|Ga0210394_11400096 | Not Available | 595 | Open in IMG/M |
| 3300021474|Ga0210390_11216340 | Not Available | 607 | Open in IMG/M |
| 3300021478|Ga0210402_10474637 | Not Available | 1162 | Open in IMG/M |
| 3300021478|Ga0210402_10901960 | Not Available | 810 | Open in IMG/M |
| 3300024178|Ga0247694_1020749 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300024288|Ga0179589_10091942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1226 | Open in IMG/M |
| 3300025634|Ga0208589_1115566 | Not Available | 625 | Open in IMG/M |
| 3300025905|Ga0207685_10176009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300025906|Ga0207699_10797009 | Not Available | 694 | Open in IMG/M |
| 3300025910|Ga0207684_10308073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1365 | Open in IMG/M |
| 3300025913|Ga0207695_10914821 | Not Available | 757 | Open in IMG/M |
| 3300025916|Ga0207663_10449774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300025922|Ga0207646_10149299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2108 | Open in IMG/M |
| 3300025922|Ga0207646_10535494 | Not Available | 1054 | Open in IMG/M |
| 3300025922|Ga0207646_11685982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
| 3300025935|Ga0207709_10285245 | Not Available | 1221 | Open in IMG/M |
| 3300025945|Ga0207679_10580703 | Not Available | 1008 | Open in IMG/M |
| 3300026899|Ga0209326_1002002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1677 | Open in IMG/M |
| 3300026899|Ga0209326_1006413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300026995|Ga0208761_1009658 | Not Available | 811 | Open in IMG/M |
| 3300027096|Ga0208099_1010335 | Not Available | 1231 | Open in IMG/M |
| 3300027570|Ga0208043_1134989 | Not Available | 650 | Open in IMG/M |
| 3300027575|Ga0209525_1043738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300027641|Ga0208827_1001063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12316 | Open in IMG/M |
| 3300027826|Ga0209060_10546787 | Not Available | 525 | Open in IMG/M |
| 3300027846|Ga0209180_10477201 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300027869|Ga0209579_10635875 | Not Available | 579 | Open in IMG/M |
| 3300027898|Ga0209067_10768945 | Not Available | 561 | Open in IMG/M |
| 3300027908|Ga0209006_10077796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2952 | Open in IMG/M |
| 3300028789|Ga0302232_10605142 | Not Available | 538 | Open in IMG/M |
| 3300028877|Ga0302235_10210022 | Not Available | 856 | Open in IMG/M |
| 3300028879|Ga0302229_10196207 | Not Available | 924 | Open in IMG/M |
| 3300029943|Ga0311340_10020276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 8323 | Open in IMG/M |
| 3300029951|Ga0311371_10188044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3087 | Open in IMG/M |
| 3300029951|Ga0311371_10976859 | Not Available | 1011 | Open in IMG/M |
| 3300029997|Ga0302302_1090025 | Not Available | 1270 | Open in IMG/M |
| 3300030399|Ga0311353_11068669 | Not Available | 672 | Open in IMG/M |
| 3300030494|Ga0310037_10010275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia tenerifensis | 4558 | Open in IMG/M |
| 3300030520|Ga0311372_12023481 | Not Available | 673 | Open in IMG/M |
| 3300030618|Ga0311354_11336538 | Not Available | 641 | Open in IMG/M |
| 3300030730|Ga0307482_1051353 | Not Available | 1004 | Open in IMG/M |
| 3300030739|Ga0302311_10757362 | Not Available | 635 | Open in IMG/M |
| 3300031028|Ga0302180_10344216 | Not Available | 757 | Open in IMG/M |
| 3300031543|Ga0318516_10078251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
| 3300031573|Ga0310915_10374972 | Not Available | 1010 | Open in IMG/M |
| 3300031718|Ga0307474_10513903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 940 | Open in IMG/M |
| 3300031719|Ga0306917_11507880 | Not Available | 517 | Open in IMG/M |
| 3300031744|Ga0306918_10348131 | Not Available | 1149 | Open in IMG/M |
| 3300031751|Ga0318494_10105897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1555 | Open in IMG/M |
| 3300031765|Ga0318554_10099933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1630 | Open in IMG/M |
| 3300031799|Ga0318565_10164742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1076 | Open in IMG/M |
| 3300031823|Ga0307478_10190095 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300031832|Ga0318499_10154729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300031912|Ga0306921_11380274 | Not Available | 776 | Open in IMG/M |
| 3300031945|Ga0310913_10298961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1135 | Open in IMG/M |
| 3300032010|Ga0318569_10220450 | Not Available | 880 | Open in IMG/M |
| 3300032041|Ga0318549_10363597 | Not Available | 652 | Open in IMG/M |
| 3300032064|Ga0318510_10319813 | Not Available | 650 | Open in IMG/M |
| 3300032076|Ga0306924_10063181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4117 | Open in IMG/M |
| 3300032160|Ga0311301_10838109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1254 | Open in IMG/M |
| 3300032515|Ga0348332_11649828 | Not Available | 625 | Open in IMG/M |
| 3300032770|Ga0335085_12305627 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032783|Ga0335079_12175145 | Not Available | 530 | Open in IMG/M |
| 3300032828|Ga0335080_11109501 | Not Available | 800 | Open in IMG/M |
| 3300032892|Ga0335081_12082070 | Not Available | 602 | Open in IMG/M |
| 3300032892|Ga0335081_12691151 | Not Available | 508 | Open in IMG/M |
| 3300032898|Ga0335072_11710727 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032954|Ga0335083_10335655 | Not Available | 1314 | Open in IMG/M |
| 3300032954|Ga0335083_11025136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces antimycoticus | 648 | Open in IMG/M |
| 3300033818|Ga0334804_007980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4432 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.34% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_07729410 | 2170459002 | Grass Soil | SGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPVA |
| FD2_06604730 | 2189573001 | Grass Soil | RMIRELVPFTQADGTLPADLEPLVELVIRGTLTPAV |
| Ga0070714_1000972824 | 3300005435 | Agricultural Soil | TGRAYRMIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA* |
| Ga0070713_1015252961 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLGELGAGTGRAYRMIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA* |
| Ga0070708_1000238794 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRSRGTGHAYRMVRELVPFTQADDTLSADLEPVVELVARGDLTPAG* |
| Ga0070706_1000275933 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRSRGTGHAYRMVRELVPFTQADDTLPADLEPVVELVARGDLTPAG* |
| Ga0070707_1000082533 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRSRGAGHAYRMVRELVPFTQADDTLPADLEPVVELVARGDLAPAG* |
| Ga0070731_110790521 | 3300005538 | Surface Soil | RALLGPGGPGELGLGTGRAYRMIRELVPFTAADGTLPADLEPVVDLVSRGGLTAAA* |
| Ga0068856_1011703701 | 3300005614 | Corn Rhizosphere | PGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPVA* |
| Ga0068852_1002791311 | 3300005616 | Corn Rhizosphere | RAPGQLGLGTGRAYRMVRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0070717_112061681 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRELVPFTRADDTLPADLEPVVELVARGDLTPAG* |
| Ga0075017_1010695801 | 3300006059 | Watersheds | MIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA* |
| Ga0070715_110485261 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QLGLGTGRAYRMIRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0070712_1015282732 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGRAYRMIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA* |
| Ga0070765_1017487881 | 3300006176 | Soil | GTARVYRMIRELVPFTHGDGTLPADLEPLVELVSRGDLTAVA* |
| Ga0079222_107199632 | 3300006755 | Agricultural Soil | YRMIRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0079221_114713091 | 3300006804 | Agricultural Soil | GRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA* |
| Ga0075425_1007553192 | 3300006854 | Populus Rhizosphere | MIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA* |
| Ga0079219_103101263 | 3300006954 | Agricultural Soil | YRMIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA* |
| Ga0105243_102425451 | 3300009148 | Miscanthus Rhizosphere | RMVRELVPFTQADGTLPADLEPLIELVTMGTLTPAA* |
| Ga0075423_112558151 | 3300009162 | Populus Rhizosphere | IDLRAPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA* |
| Ga0116214_12056843 | 3300009520 | Peatlands Soil | MIRELVPFTQADGTLPADLEPLVELVIRGDLTPAA* |
| Ga0105237_111066822 | 3300009545 | Corn Rhizosphere | GTGRAYRMVRELVPFTQADGTLPADLEPLIELVTMGTLTPAA* |
| Ga0126374_118637832 | 3300009792 | Tropical Forest Soil | MIRELVPFTQADGTLPADLEPVVELVTRGVLTPAG* |
| Ga0126379_113352172 | 3300010366 | Tropical Forest Soil | MIRELVPFTQADGTLPADLEPLVELVTRGTLTPVA* |
| Ga0126379_127527211 | 3300010366 | Tropical Forest Soil | LGELGAGTGRAYRMIRELVPFTQADDTFPADLEPVVDLVTRGDLTPAA* |
| Ga0134125_129085142 | 3300010371 | Terrestrial Soil | GTGRAYRMVRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0136449_1010236331 | 3300010379 | Peatlands Soil | GQLGQGTGRAYRLTRELVPFTASTGTVPADLEPVVELITRGDLSSPDM* |
| Ga0134127_117407242 | 3300010399 | Terrestrial Soil | APGQALGLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA* |
| Ga0126361_106454681 | 3300010876 | Boreal Forest Soil | LGLGTGRAYRMIRELVPFTHADGTLPADLEPLVDLVTRGDLTPAA* |
| Ga0126350_100538563 | 3300010880 | Boreal Forest Soil | IRELVPFTQSDGTLPADLEPLIALVTRGDLTSAA* |
| Ga0137380_115115741 | 3300012206 | Vadose Zone Soil | MIRELVPFTQADGTFPADLEPVVDLVTRGDLTGAA* |
| Ga0137378_114828382 | 3300012210 | Vadose Zone Soil | QLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA* |
| Ga0137384_103204631 | 3300012357 | Vadose Zone Soil | GTGRAYRMIRELVPFTQADGTLPADLEPLVELVIRGTLTPAV* |
| Ga0157340_10293112 | 3300012473 | Arabidopsis Rhizosphere | GRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA* |
| Ga0157338_10610792 | 3300012515 | Arabidopsis Rhizosphere | RAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA* |
| Ga0137416_115817901 | 3300012927 | Vadose Zone Soil | GRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAV* |
| Ga0164298_116087882 | 3300012955 | Soil | MIRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0164299_111470402 | 3300012958 | Soil | MIRELVPFMQADGILPADLEPVVDLVIRGVLTPAA* |
| Ga0164302_101437203 | 3300012961 | Soil | LGTGRAYRMIRELVAVTHADGTLPGDLEPLGELVTMGTLTPVA* |
| Ga0157370_110343991 | 3300013104 | Corn Rhizosphere | LRAPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLIELVTRGTLTPAA* |
| Ga0182030_1003153810 | 3300014838 | Bog | VPDRRLGVAVQLGVGTGNAYRMIRELVPFTHGDGTLPADLEPLVELLSRGDLTVVA* |
| Ga0132256_1018384742 | 3300015372 | Arabidopsis Rhizosphere | RMIRELVPFTHADGTLPADLEPLVELVTRGTLTPAA* |
| Ga0132255_1006438363 | 3300015374 | Arabidopsis Rhizosphere | AYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA* |
| Ga0182041_103377182 | 3300016294 | Soil | SVPDGQGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0182035_112498101 | 3300016341 | Soil | LGLGTGRAYRMIRELVPFTQADGTFPADLEPLVELVTRGALTPAA |
| Ga0182040_102047572 | 3300016387 | Soil | VPDGQGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0182037_115296822 | 3300016404 | Soil | GTGRAYRMVRKLVPFTQADGTLPADLEPVVELVTRGDLNPPEPGR |
| Ga0187879_100632152 | 3300017946 | Peatland | MIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0187879_108730712 | 3300017946 | Peatland | GGLHGAAQLGLGTARVYRMIRELVPFTHGDSTLPADLEPLVELVCRGDLTAVA |
| Ga0187874_103095091 | 3300018019 | Peatland | DGLGGLHGAAQLGLGTARVYRMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0193730_10264713 | 3300020002 | Soil | PGESLGLGLGTGRVYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPGRLSSEDR |
| Ga0206356_109067612 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPVA |
| Ga0210395_111167093 | 3300020582 | Soil | LGTGRAFRMIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA |
| Ga0210396_111076611 | 3300021180 | Soil | APGQALGLGLGTGRAYRMVRELVPFTQADGTLPADLEPLIELVTRGTLTPAA |
| Ga0210385_109760152 | 3300021402 | Soil | GQLGLGTARVYRMIRELVPFTHGDGTLPADLEPLVELVSRGDLTAVA |
| Ga0210385_113512953 | 3300021402 | Soil | WMIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA |
| Ga0210397_113107661 | 3300021403 | Soil | GLGTGRAYQMVRELVPFTQADGTLPADLEPLVELVSRGDLS |
| Ga0210394_114000963 | 3300021420 | Soil | RAPGQSLGLGLGTGRAFRMIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA |
| Ga0210390_112163403 | 3300021474 | Soil | LGLGTGRAFRMIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA |
| Ga0210402_104746371 | 3300021478 | Soil | SGASQSLGLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGDLTPAAYPAATPG |
| Ga0210402_109019601 | 3300021478 | Soil | GTGRAYRMIRELVPFTQADGTLPADLEPLVELVTGGILTSAA |
| Ga0247694_10207492 | 3300024178 | Soil | DLRAPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA |
| Ga0179589_100919421 | 3300024288 | Vadose Zone Soil | IDLRVSGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVEMVTRGTLTPVA |
| Ga0208589_11155661 | 3300025634 | Arctic Peat Soil | GLGTGRAYRMIRELVPFTQADGTLPADLEPLVDLVTRGDLTPAA |
| Ga0207685_101760091 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AYRMVRELVPFTQADGTLPADLEPLIELVTRGTLTPAA |
| Ga0207699_107970092 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LNQAGMGQPGLGELGLGTGRAYRMIRELVPFMQADGILPADLEPVVDLVIRGVLTPAA |
| Ga0207684_103080731 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRSRGTGHAYRMVRELVPFTQADDTLPADLEPVVELVARGDLTPAG |
| Ga0207695_109148211 | 3300025913 | Corn Rhizosphere | RAPGQLGLGTGRAYRMVRELVPFTQADGTLPADLEPLIELVTMGTLTPAA |
| Ga0207663_104497741 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLGLGTGRAYRMIRELVPFTQADGTLPADLEPLIELVTRGTLTPAA |
| Ga0207646_101492992 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRSRGAGHAYRMVRELVPFTQADDTLPADLEPVVELVARGDLAPAG |
| Ga0207646_105354941 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRELVPFTQADGTLPADLEPLIELVTRGTLTPAA |
| Ga0207646_116859822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRELVPFTQADGTLPADLEPLVELVSRGDLHPDSRIHR |
| Ga0207709_102852451 | 3300025935 | Miscanthus Rhizosphere | RMVRELVPFTQADGTLPADLEPLIELVTMGTLTPAA |
| Ga0207679_105807032 | 3300025945 | Corn Rhizosphere | SVSGPGVSGLGELGAGTGRAYRMIRELVPFTQADGTFPADLEPVVDLVTRGDLTPAA |
| Ga0209326_10020021 | 3300026899 | Forest Soil | MIRELVPFTQADGTLPADLEPLVELVTMGTLTPAA |
| Ga0209326_10064131 | 3300026899 | Forest Soil | MIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0208761_10096581 | 3300026995 | Soil | GLGTGRAYRMIRELVPFTHADGTLPADLEPLVELVTRGTLTPAA |
| Ga0208099_10103353 | 3300027096 | Forest Soil | APGQSLGLGLGTGRAFRMIRELVPFTQADGTLPADLEPLVELVSRGDLTPAA |
| Ga0208043_11349891 | 3300027570 | Peatlands Soil | QLGLGTGRAFRMIRDLVPFTQADGTLPADLEPVVELVARGDLNPKAPPT |
| Ga0209525_10437382 | 3300027575 | Forest Soil | ELGLGTGRAYRMLRELVPFTQSDGTLPADLEPVVDLISRGDLHPDTPAYGIA |
| Ga0208827_100106315 | 3300027641 | Peatlands Soil | AYQMIRELVPFTQADGTLPADLEPLVDLVIQGDLTPSCSP |
| Ga0209060_105467871 | 3300027826 | Surface Soil | MIRELVPFTQADGTLPADLEPLVERVSRGDLHPDSMTP |
| Ga0209180_104772011 | 3300027846 | Vadose Zone Soil | GLGTERAYRMIRELVPFTQADGTLPADLEPLVELVTGGGLTPAA |
| Ga0209579_106358751 | 3300027869 | Surface Soil | RALLGPGGPGELGLGTGRAYRMIRELVPFTAADGTLPADLEPVVDLVSRGGLTAAA |
| Ga0209067_107689452 | 3300027898 | Watersheds | FRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0209006_100777965 | 3300027908 | Forest Soil | GTARVYRMIRELVPFTQGEGTLPADLEPLVELVSRGDLTAVA |
| Ga0302232_106051421 | 3300028789 | Palsa | LGGAGQLGLGTARVYRMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0302235_102100221 | 3300028877 | Palsa | MIRELVPFTHGDGTLPADLEPLVELVSRGDLTAAA |
| Ga0302229_101962071 | 3300028879 | Palsa | QLGLGTARVYRMIRVPFTHGDGTLPADLEPLVELVSRGDLTAAA |
| Ga0311340_1002027610 | 3300029943 | Palsa | ARPGHRVYRMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0311371_101880441 | 3300029951 | Palsa | YRMIRELVPFTQADGTLPADLEPLIALVTRGDLTSAA |
| Ga0311371_109768591 | 3300029951 | Palsa | RAPGELGLGTGRAYRMIRELVPFTQSDGTLPADLEPLIALVTRGDLTSAA |
| Ga0302302_10900251 | 3300029997 | Palsa | VYRMIRELVPFTHGDGTLPADLEPLVELVSRGDLTAVA |
| Ga0311353_110686692 | 3300030399 | Palsa | RMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0310037_100102753 | 3300030494 | Peatlands Soil | MIRELVPFTQADGTLPADLEPLVELVIRGDLTPAA |
| Ga0311372_120234811 | 3300030520 | Palsa | GGLTGLGGAGQLGLGTARVYRMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0311354_113365381 | 3300030618 | Palsa | LGLGTARVYRMIRELIPFTQGEGTLPADLEPLVELVCRGDLTAVA |
| Ga0307482_10513532 | 3300030730 | Hardwood Forest Soil | QGELGQGTGRVYRMVREFVPFTQADGTLPADLEPLVALVSRGDLHPDTLAPR |
| Ga0302311_107573622 | 3300030739 | Palsa | LGTARVYRMIRELVPFTHGDGTLPADLEPLVELVCRGDLTAVA |
| Ga0302180_103442161 | 3300031028 | Palsa | MIRELVPFIHGDGTLPADLEPLVELVSRGDLTAVA |
| Ga0318516_100782513 | 3300031543 | Soil | LGTGRAYRMVRELVPFTQADGTLPADLEPVVELVTRGDLNPPEPGR |
| Ga0310915_103749721 | 3300031573 | Soil | TGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0307474_105139033 | 3300031718 | Hardwood Forest Soil | QLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELITMGTLTPAA |
| Ga0306917_115078802 | 3300031719 | Soil | GPDGTGQLGLGTGRAYRMIRELVPFTQAGGTLPADLEPLVELVTRGALTPAA |
| Ga0306918_103481311 | 3300031744 | Soil | GLGTSRAYRMIRELVPFTQADGTLPADLEPLVELVARGTLTPAA |
| Ga0318494_101058972 | 3300031751 | Soil | MIRELVPFTQADGTLPADLEPVVELVARGDLSAVTPAA |
| Ga0318554_100999331 | 3300031765 | Soil | YRMVRKLVPFTQADGTLPADLEPVVELVTRGDLNPPEPGR |
| Ga0318565_101647421 | 3300031799 | Soil | YRMIRELVPFTQADGTLPADLEPLVELVARGTLTSAA |
| Ga0307478_101900953 | 3300031823 | Hardwood Forest Soil | GLGTGRAYQMVRELVPFTQADGTLPADLEPLVELVSRGALS |
| Ga0318499_101547293 | 3300031832 | Soil | RSPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVARGTLTSAA |
| Ga0306921_113802741 | 3300031912 | Soil | RMFRELVPFTQADGTLPADLEPLVELVARGTLTSAA |
| Ga0310913_102989613 | 3300031945 | Soil | GRAYRMIRELVPFTQADGTLPADLEPLVELVARGTLTSAA |
| Ga0318569_102204501 | 3300032010 | Soil | LRSPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVARGTLTPAA |
| Ga0318549_103635972 | 3300032041 | Soil | EPGQLGLGTGRAYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0318510_103198132 | 3300032064 | Soil | AYRMIRELVPFTQADGTLPADLEPLVELVTRGTLTPAA |
| Ga0306924_100631815 | 3300032076 | Soil | YRMVRELVPFTQADGTLPADLEPVVELVTRGDLNPPEPGR |
| Ga0311301_108381092 | 3300032160 | Peatlands Soil | GQLGQGTGRAYRLTRELVPFTASTGTVPADLEPVVELITRGDLSSPDM |
| Ga0348332_116498283 | 3300032515 | Plant Litter | QSLGLGLGTGRAFRMIRELVPFTQADGTLPADLEPLVELVSRGDLMPAA |
| Ga0335085_123056272 | 3300032770 | Soil | AQAIDLRSLGQLGLGTGRAYRMIRELVPFTQADGTFPADLEPLVELVTGGALTPAA |
| Ga0335079_121751452 | 3300032783 | Soil | QLGLGTGRAYRMIRELVPFTQADSTLPADLEPVVELVTRGDLDLVTQAA |
| Ga0335080_111095011 | 3300032828 | Soil | AAGPLGLGTDRAYRMTRELVPFTQAEGTLPADLEPLVELVIRGDLSQLAPAA |
| Ga0335081_120820702 | 3300032892 | Soil | TGRAYRMIRELVPFMPAGGTLPADLEPVVDLVTRGVLTPAA |
| Ga0335081_126911511 | 3300032892 | Soil | GTGRAYRMIRELVPFMPADGTLPADLEPVVDLVTRGVLTPAA |
| Ga0335072_117107271 | 3300032898 | Soil | LGGGTGRAYQMVRDLIPFTHADGTLPADLEPVVDLVIRGTLGPDTMSPCSSPDPLCPS |
| Ga0335083_103356551 | 3300032954 | Soil | MIRELVPFTRADDTLPADLEPVVELVARGDLNAVTPAA |
| Ga0335083_110251361 | 3300032954 | Soil | PGQLGLGTGRAYRMIRELVPFTQADGTFPADLEPLVELVTGGALTPAA |
| Ga0334804_007980_3606_3776 | 3300033818 | Soil | VPDRRLGVAVQLGVGTGNAYRMIRELVPFTHGDGTLPADLEPLVELVSRGDLTVVA |
| ⦗Top⦘ |