| Basic Information | |
|---|---|
| Family ID | F065102 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EILNLFFAELFVFNFGIILRSYTNIGIDLQPLLSLIKAE |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.66 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.562 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (23.438 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.969 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF05198 | IF3_N | 71.09 |
| PF03129 | HGTP_anticodon | 24.22 |
| PF07973 | tRNA_SAD | 1.56 |
| PF00707 | IF3_C | 0.78 |
| PF00012 | HSP70 | 0.78 |
| PF12695 | Abhydrolase_5 | 0.78 |
| PF12146 | Hydrolase_4 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 71.88 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 24.22 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 24.22 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 24.22 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 24.22 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.56 % |
| Unclassified | root | N/A | 48.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000238|SI36aug09_100mDRAFT_1021361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 841 | Open in IMG/M |
| 3300000239|SI36aug09_120mDRAFT_1088889 | Not Available | 512 | Open in IMG/M |
| 3300001940|GOS2222_1012321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4288 | Open in IMG/M |
| 3300001956|GOS2266_1041807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
| 3300001974|GOS2246_10121902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1602 | Open in IMG/M |
| 3300002040|GOScombined01_101892789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1674 | Open in IMG/M |
| 3300002040|GOScombined01_101908164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1779 | Open in IMG/M |
| 3300002040|GOScombined01_102072730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1867 | Open in IMG/M |
| 3300002040|GOScombined01_104366340 | Not Available | 516 | Open in IMG/M |
| 3300005398|Ga0066858_10184918 | Not Available | 601 | Open in IMG/M |
| 3300005522|Ga0066861_10163011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 768 | Open in IMG/M |
| 3300005946|Ga0066378_10124681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 801 | Open in IMG/M |
| 3300006166|Ga0066836_10474962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 756 | Open in IMG/M |
| 3300006166|Ga0066836_10747562 | Not Available | 591 | Open in IMG/M |
| 3300006334|Ga0099675_1455110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1030 | Open in IMG/M |
| 3300006334|Ga0099675_1649394 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006350|Ga0099954_1540795 | Not Available | 616 | Open in IMG/M |
| 3300006413|Ga0099963_1249887 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300008097|Ga0111541_10266520 | Not Available | 728 | Open in IMG/M |
| 3300008097|Ga0111541_10310170 | Not Available | 675 | Open in IMG/M |
| 3300008249|Ga0105353_1153806 | Not Available | 535 | Open in IMG/M |
| 3300008625|Ga0115653_1211725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 809 | Open in IMG/M |
| 3300009008|Ga0115649_1370747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300009049|Ga0102911_1157139 | Not Available | 644 | Open in IMG/M |
| 3300009054|Ga0102826_1072611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 826 | Open in IMG/M |
| 3300009104|Ga0117902_1255930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1665 | Open in IMG/M |
| 3300009106|Ga0117917_1121022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 858 | Open in IMG/M |
| 3300009109|Ga0117922_1172947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 968 | Open in IMG/M |
| 3300009132|Ga0118730_1308150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 806 | Open in IMG/M |
| 3300009172|Ga0114995_10370760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 786 | Open in IMG/M |
| 3300009172|Ga0114995_10674156 | Not Available | 565 | Open in IMG/M |
| 3300009193|Ga0115551_1392588 | Not Available | 597 | Open in IMG/M |
| 3300009409|Ga0114993_10315276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1188 | Open in IMG/M |
| 3300009409|Ga0114993_10366145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1087 | Open in IMG/M |
| 3300009420|Ga0114994_10646962 | Not Available | 691 | Open in IMG/M |
| 3300009420|Ga0114994_10969153 | Not Available | 550 | Open in IMG/M |
| 3300009425|Ga0114997_10328434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 840 | Open in IMG/M |
| 3300009436|Ga0115008_10821613 | Not Available | 682 | Open in IMG/M |
| 3300009449|Ga0115558_1385906 | Not Available | 548 | Open in IMG/M |
| 3300009481|Ga0114932_10204713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1200 | Open in IMG/M |
| 3300009498|Ga0115568_10057065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2035 | Open in IMG/M |
| 3300009498|Ga0115568_10420411 | Not Available | 577 | Open in IMG/M |
| 3300009703|Ga0114933_10101377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2022 | Open in IMG/M |
| 3300009703|Ga0114933_10623086 | Not Available | 694 | Open in IMG/M |
| 3300009705|Ga0115000_10142328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1600 | Open in IMG/M |
| 3300009705|Ga0115000_10407592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 865 | Open in IMG/M |
| 3300011302|Ga0138369_1089807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 921 | Open in IMG/M |
| 3300012950|Ga0163108_10176040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1371 | Open in IMG/M |
| 3300012950|Ga0163108_10877256 | Not Available | 579 | Open in IMG/M |
| 3300016739|Ga0182076_1423770 | Not Available | 543 | Open in IMG/M |
| 3300017762|Ga0181422_1013258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2743 | Open in IMG/M |
| 3300017779|Ga0181395_1252430 | Not Available | 539 | Open in IMG/M |
| 3300017967|Ga0181590_10603092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 751 | Open in IMG/M |
| 3300017967|Ga0181590_10755877 | Not Available | 650 | Open in IMG/M |
| 3300018418|Ga0181567_10508191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 787 | Open in IMG/M |
| 3300018876|Ga0181564_10484860 | Not Available | 664 | Open in IMG/M |
| 3300020056|Ga0181574_10323016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 929 | Open in IMG/M |
| 3300020194|Ga0181597_10367425 | Not Available | 617 | Open in IMG/M |
| 3300020238|Ga0211492_1068654 | Not Available | 640 | Open in IMG/M |
| 3300020259|Ga0211633_1052536 | Not Available | 673 | Open in IMG/M |
| 3300020297|Ga0211490_1089050 | Not Available | 509 | Open in IMG/M |
| 3300020340|Ga0211594_1090265 | Not Available | 648 | Open in IMG/M |
| 3300020346|Ga0211607_1084277 | Not Available | 636 | Open in IMG/M |
| 3300020362|Ga0211488_10150536 | Not Available | 655 | Open in IMG/M |
| 3300020370|Ga0211672_10259441 | Not Available | 537 | Open in IMG/M |
| 3300020372|Ga0211683_10024607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2045 | Open in IMG/M |
| 3300020376|Ga0211682_10183285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 817 | Open in IMG/M |
| 3300020376|Ga0211682_10222363 | Not Available | 727 | Open in IMG/M |
| 3300020381|Ga0211476_10193101 | Not Available | 722 | Open in IMG/M |
| 3300020418|Ga0211557_10304410 | Not Available | 721 | Open in IMG/M |
| 3300020428|Ga0211521_10264864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 770 | Open in IMG/M |
| 3300020428|Ga0211521_10319182 | Not Available | 688 | Open in IMG/M |
| 3300020445|Ga0211564_10216560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 948 | Open in IMG/M |
| 3300020445|Ga0211564_10312720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 774 | Open in IMG/M |
| 3300020453|Ga0211550_10302677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 749 | Open in IMG/M |
| 3300020454|Ga0211548_10431983 | Not Available | 645 | Open in IMG/M |
| 3300020456|Ga0211551_10084964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1482 | Open in IMG/M |
| 3300020456|Ga0211551_10442583 | Not Available | 620 | Open in IMG/M |
| 3300020456|Ga0211551_10590990 | Not Available | 527 | Open in IMG/M |
| 3300020461|Ga0211535_10188930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 903 | Open in IMG/M |
| 3300020462|Ga0211546_10689114 | Not Available | 513 | Open in IMG/M |
| 3300020465|Ga0211640_10749396 | Not Available | 517 | Open in IMG/M |
| 3300020471|Ga0211614_10524362 | Not Available | 525 | Open in IMG/M |
| 3300020476|Ga0211715_10488778 | Not Available | 605 | Open in IMG/M |
| 3300020476|Ga0211715_10648622 | Not Available | 516 | Open in IMG/M |
| 3300021065|Ga0206686_1072377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1032 | Open in IMG/M |
| 3300021084|Ga0206678_10146176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1198 | Open in IMG/M |
| 3300021092|Ga0194122_10450174 | Not Available | 646 | Open in IMG/M |
| 3300021342|Ga0206691_1862084 | Not Available | 665 | Open in IMG/M |
| 3300021443|Ga0206681_10334245 | Not Available | 586 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10087518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1555 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10125379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1201 | Open in IMG/M |
| 3300024344|Ga0209992_10216509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 807 | Open in IMG/M |
| 3300024344|Ga0209992_10237136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 762 | Open in IMG/M |
| 3300024348|Ga0244776_10320889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1051 | Open in IMG/M |
| 3300025438|Ga0208770_1047241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 897 | Open in IMG/M |
| 3300025886|Ga0209632_10490947 | Not Available | 563 | Open in IMG/M |
| 3300026261|Ga0208524_1026195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 1818 | Open in IMG/M |
| 3300026321|Ga0208764_10326668 | Not Available | 733 | Open in IMG/M |
| 3300026321|Ga0208764_10378928 | Not Available | 667 | Open in IMG/M |
| 3300027752|Ga0209192_10190597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 786 | Open in IMG/M |
| 3300027779|Ga0209709_10019148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4540 | Open in IMG/M |
| 3300027801|Ga0209091_10300034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 761 | Open in IMG/M |
| 3300027801|Ga0209091_10311825 | Not Available | 740 | Open in IMG/M |
| 3300027801|Ga0209091_10352054 | Not Available | 681 | Open in IMG/M |
| 3300027830|Ga0209359_10212488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 869 | Open in IMG/M |
| 3300027830|Ga0209359_10348036 | Not Available | 682 | Open in IMG/M |
| 3300027844|Ga0209501_10347569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 895 | Open in IMG/M |
| 3300027849|Ga0209712_10507716 | Not Available | 675 | Open in IMG/M |
| 3300028194|Ga0257106_1053186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1524 | Open in IMG/M |
| 3300028194|Ga0257106_1080917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1187 | Open in IMG/M |
| 3300028194|Ga0257106_1314270 | Not Available | 510 | Open in IMG/M |
| 3300028197|Ga0257110_1218768 | Not Available | 726 | Open in IMG/M |
| 3300028284|Ga0257120_1028594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1677 | Open in IMG/M |
| 3300031143|Ga0308025_1254836 | Not Available | 581 | Open in IMG/M |
| 3300031510|Ga0308010_1296521 | Not Available | 555 | Open in IMG/M |
| 3300031630|Ga0308004_10214112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 778 | Open in IMG/M |
| 3300031644|Ga0308001_10019348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2964 | Open in IMG/M |
| 3300031659|Ga0307986_10303488 | Not Available | 668 | Open in IMG/M |
| 3300031659|Ga0307986_10306203 | Not Available | 664 | Open in IMG/M |
| 3300031695|Ga0308016_10033497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2234 | Open in IMG/M |
| 3300031702|Ga0307998_1235278 | Not Available | 604 | Open in IMG/M |
| 3300031785|Ga0310343_10538248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 863 | Open in IMG/M |
| 3300032006|Ga0310344_10795343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 802 | Open in IMG/M |
| 3300032011|Ga0315316_10972620 | Not Available | 692 | Open in IMG/M |
| 3300032047|Ga0315330_10554446 | Not Available | 687 | Open in IMG/M |
| 3300032048|Ga0315329_10641634 | Not Available | 562 | Open in IMG/M |
| 3300032134|Ga0315339_1109409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 868 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 21.09% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 7.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.25% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.47% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.69% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.12% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.12% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.12% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.34% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.78% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.78% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000238 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100m | Environmental | Open in IMG/M |
| 3300000239 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m | Environmental | Open in IMG/M |
| 3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008249 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN10B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008625 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009008 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009106 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 295m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300011302 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020259 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020340 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026261 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032134 | Ammonia-oxidizing marine archaeal communities from Pacific Ocean, United States - ASW #17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI36aug09_100mDRAFT_10213611 | 3300000238 | Marine | ETLNLFFAELFVFNFGIITRSYTNIGIDLQPLLSLIKAE* |
| SI36aug09_120mDRAFT_10888892 | 3300000239 | Marine | FFAELFVFNFGIITRSYTNIGIDLQPLLSLIKAE* |
| GOS2222_10123211 | 3300001940 | Marine | LNLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAG* |
| GOS2266_10418072 | 3300001956 | Marine | IITFPFADILNLFFAELFVFSFGIIEPGYTKNDINLQQLLKPTKAE* |
| GOS2246_101219023 | 3300001974 | Marine | LPLADILNLFFAELFVFSFGIILRTYTKKGIILQPLLRLIKAELP* |
| GOScombined01_1018927893 | 3300002040 | Marine | GMTLPLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLRLIKAELP* |
| GOScombined01_1019081644 | 3300002040 | Marine | MTLPLADTLNLFFAELFVFSFGIILRTYTKKDIILQPLLRLIMAELP* |
| GOScombined01_1020727303 | 3300002040 | Marine | ADILNLFFAELFVFSFGIILRTYTKKDIILQPLLRLIKAELP* |
| GOScombined01_1043663401 | 3300002040 | Marine | TLPLADILNLFFAELFVFSFGIILRFYTKKDIILQPLLKLIKAELP* |
| Ga0066858_101849181 | 3300005398 | Marine | PLAVILNLFFAELLVFNFGIIAGSYTNNNINLQPQLPPIEAG* |
| Ga0066861_101630111 | 3300005522 | Marine | PLADILNLFFAELFVFSFGIIQRTYTKKDIILQPLLRLIKAELP* |
| Ga0066378_101246813 | 3300005946 | Marine | ILNLFFAELFVFSFGIILRTYTKKDIILQPILRLIKAELP* |
| Ga0066836_104749621 | 3300006166 | Marine | FADILNLFFAELFVLSFGIFLRSYTKIDINLQPLLKPIKAELP* |
| Ga0066836_107475621 | 3300006166 | Marine | PLAVILNLFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAELP* |
| Ga0099675_14551101 | 3300006334 | Marine | PLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLRLI* |
| Ga0099675_16493943 | 3300006334 | Marine | AEILNLFFAELFVLSFGIILRSYTKKDIILQPILKLIMVELP* |
| Ga0099954_15407951 | 3300006350 | Marine | AELLVFNFGIIERGYTYKEINLQPILRLIKAGLP* |
| Ga0099963_12498874 | 3300006413 | Marine | TLPLADILNLFFAELFVLSFGIILRTYTKKDIILQPLLQLIKVELP* |
| Ga0111541_102665202 | 3300008097 | Marine | FAVILNLFFAELFVFSFGIIERSYTNNNIILQPQILPIKAE* |
| Ga0111541_103101702 | 3300008097 | Marine | FEVILNLFFAELLVLSFGIIVRFYTNNNIILQPQLLLIKAE* |
| Ga0105353_11538061 | 3300008249 | Methane Seep Mesocosm | WGITTLPLAVILNLFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAELP* |
| Ga0115653_12117253 | 3300008625 | Marine | AELLVLSFGIIVRTYTNINIILQHQLLLIKAELP* |
| Ga0115649_13707473 | 3300009008 | Marine | AELLVLSFGIIVRTYTNINIILQHQLLPIKAELP* |
| Ga0102911_11571392 | 3300009049 | Estuarine | FFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAE* |
| Ga0102826_10726113 | 3300009054 | Estuarine | ILNLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAE* |
| Ga0117902_12559301 | 3300009104 | Marine | AVILNLFLAELLVLSFGIIVRVYTNNNIILQHQLLLIKAE* |
| Ga0117917_11210223 | 3300009106 | Marine | VILNLFLAELLVLSFGIIDRTYTNINIILQHQLLPIKAELP* |
| Ga0117922_11729473 | 3300009109 | Marine | VILNLFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAE* |
| Ga0118730_13081503 | 3300009132 | Marine | ITLPLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLKLIKAELP* |
| Ga0114995_103707603 | 3300009172 | Marine | LFLAELLVFNFGIILRTYTNIGIDLQPILSLIKAE* |
| Ga0114995_106741562 | 3300009172 | Marine | LNLFFAELFVFNFGIILRSYTNIGIDLQPLLSLIKAE* |
| Ga0115551_13925882 | 3300009193 | Pelagic Marine | FFAELLVFNFGIILRSYTNIGIDFQPLLSPIKAE* |
| Ga0114993_103152761 | 3300009409 | Marine | NLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKVE* |
| Ga0114993_103661453 | 3300009409 | Marine | AIITFPVAEILNLFFAELFVFNVGIILRTYTNIGMDLQPILNPIKAE* |
| Ga0114994_106469621 | 3300009420 | Marine | LNLFFAELLVFSFGIILGTYTNIGMDLQPLLSLIKAELP* |
| Ga0114994_109691532 | 3300009420 | Marine | LFFAELFVFNFGIILRSYTNIAVDLQPLLSLIGAE* |
| Ga0114997_103284343 | 3300009425 | Marine | ILNLFFAELFVFNFGIILRSYTNIGIDLQPLLNLIKAE* |
| Ga0115008_108216131 | 3300009436 | Marine | VAEILNLFFAELFVFNFGIIEPSYTNIGIDLQPLLSTIMAG* |
| Ga0115558_13859062 | 3300009449 | Pelagic Marine | AVITLPVADILNLFLAELFVFSFSIILRCYTKIDMDLQPLLRLIKAE* |
| Ga0114932_102047131 | 3300009481 | Deep Subsurface | AITTFPLEVSLNLFFAELLVFSLGIIDWGYTNINIILQLQLLAIMAG* |
| Ga0115568_100570653 | 3300009498 | Pelagic Marine | NLFLAELLVFSFGIILRVYTKKEIDLQPLLRLIKAE* |
| Ga0115568_104204111 | 3300009498 | Pelagic Marine | LNLFLAELFVFNFGIILRTYTNIVIDLQPLLSLIKAE* |
| Ga0114933_101013773 | 3300009703 | Deep Subsurface | AVILNLFFAELLVFSFGIILRVYTNNNIILQQQLFPIKVE* |
| Ga0114933_106230861 | 3300009703 | Deep Subsurface | TLPLAEILNLFFAELFVFNLGINQRFYTKNDIILQPLLSLIKAE* |
| Ga0115000_101423283 | 3300009705 | Marine | LNLFFAELFVFNLGIILRTYTNIGIDLQPLLSLIKVE* |
| Ga0115000_104075921 | 3300009705 | Marine | VAEILNLFFAELFVFNFGIILRSYTNIAVDLQPLLSLIGAE* |
| Ga0138369_10898071 | 3300011302 | Marine | IPLADSLNLFFAELFVFSFGIILRTYTKKDIILQPLLKLIKAELP* |
| Ga0163108_101760403 | 3300012950 | Seawater | LFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAE* |
| Ga0163108_108772561 | 3300012950 | Seawater | AVILNLFFAELLVFSFGIIATGYTNINIILQQQLLPIKAE* |
| Ga0182076_14237702 | 3300016739 | Salt Marsh | LFFAELFVFSFGIILRTYTKKDIILQPILKLIKAELP |
| Ga0181422_10132581 | 3300017762 | Seawater | ETLNLFFAELFVFNFGIILRTYTNIGIDLQPLLSLIKAE |
| Ga0181395_12524302 | 3300017779 | Seawater | AVITLPLADILNLFFAELFVFNLGIILRTYTKNGIILQPLLNPIKVG |
| Ga0181590_106030921 | 3300017967 | Salt Marsh | EITLPLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLKLIKAELP |
| Ga0181590_107558771 | 3300017967 | Salt Marsh | ADILNLFFAELFVFSFGIILRTYTKKDIILQPLLSLIKAELP |
| Ga0181567_105081913 | 3300018418 | Salt Marsh | TLPLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLKLIKAELP |
| Ga0181564_104848602 | 3300018876 | Salt Marsh | ELFVFSFGIIERGYTENDLNLQQLLRPIKAGLPLSFVYRQT |
| Ga0181574_103230163 | 3300020056 | Salt Marsh | AEITLPLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLKLIKAELP |
| Ga0181597_103674251 | 3300020194 | Salt Marsh | FAELFVFNLGIIDRSYTKKDLNLQLILKPIKAELP |
| Ga0211492_10686542 | 3300020238 | Marine | DILNLFFAELFVFSFGIILRTYTKKDIILQPLLRLIKAELP |
| Ga0211633_10525361 | 3300020259 | Marine | LADILNLFLAELFVFNLGIILRTYTKNGIILQPLLNPIKVG |
| Ga0211490_10890501 | 3300020297 | Marine | LAVILNLFFAELLVFNFGIIWRVYTNKNIILQQQLFPIKVELP |
| Ga0211594_10902651 | 3300020340 | Marine | EITLPLEDILNLFFAELFVFSFGINLRSYTKKDIILQPLLRPIMAELP |
| Ga0211607_10842771 | 3300020346 | Marine | EILNLFFAELFVFNFGIILRTYTKNVVILQPQLKLITAELPLSFVFHQI |
| Ga0211488_101505362 | 3300020362 | Marine | LFFAELFVLSFGIILRVYTYNVKNLQPILRLIKAE |
| Ga0211672_102594411 | 3300020370 | Marine | FPLAVILNLFLAELLVLSFGICGWFYTNINIDLQP |
| Ga0211683_100246071 | 3300020372 | Marine | LNLFFAELLVFNFGIILRTYTNIGMNLQPLLSLIKAE |
| Ga0211682_101832851 | 3300020376 | Marine | ILNLFFAELFVFNFGIILRSYTNIAIDLQPLLSLIVAE |
| Ga0211682_102223631 | 3300020376 | Marine | ILNLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAE |
| Ga0211476_101931012 | 3300020381 | Marine | TLPLDVILNLFFAELFVFSFGIIERGYTNINIILQLQISIIKAE |
| Ga0211557_103044101 | 3300020418 | Marine | LNLFFAELFVLSFGIILRVYTNINIILQHQLLPIKAELP |
| Ga0211521_102648641 | 3300020428 | Marine | NLFFAELFVFSFGIIVRVYTNNNIILQLQLLAIKAE |
| Ga0211521_103191822 | 3300020428 | Marine | TLPLAEILNLFFAELFVFNLGINQRSYTKNDIILQPLLNLIKAE |
| Ga0211564_102165601 | 3300020445 | Marine | DILNLFFAELFVFSLGIIFRGYTNINIILQLELLLIMAE |
| Ga0211564_103127201 | 3300020445 | Marine | LFFAELLVLSFGIIFRTYTNINIILQHQLLPIKAGLP |
| Ga0211550_103026771 | 3300020453 | Marine | LFLAELFVLSFGIIERVYTNINIILQPQILPIKAE |
| Ga0211548_104319831 | 3300020454 | Marine | VITLPLADILNLFLAELLVLSFGIILRCYTKIDINLQPLIKAYKG |
| Ga0211551_100849641 | 3300020456 | Marine | EILNLFFAELLVFSFGIIFRVYTNINIVLQLILLAILAESP |
| Ga0211551_104425832 | 3300020456 | Marine | AVKTLPFADILNLFFAELFVLSFGIILRGYTKNDLNLQPKLQLI |
| Ga0211551_105909902 | 3300020456 | Marine | LPLAVILNLFFAELLVFNFGICGRFYTNIRINLQPKL |
| Ga0211535_101889303 | 3300020461 | Marine | LNLFLAELFVLSFGIIERGYTNINIILQPQILPIKAE |
| Ga0211546_106891141 | 3300020462 | Marine | VAEILNLFFAELFVFNLGIILRSYTNIEIDLQPLLTLIKAE |
| Ga0211640_107493961 | 3300020465 | Marine | IITFPLAVILNLFLAELLVLSFGIIVSGYTNNRNILQPQLLPIKAG |
| Ga0211614_105243621 | 3300020471 | Marine | LAVILNLFLAELFVLSFGIIVSGYTNNRNILQPQLLPIKAE |
| Ga0211715_104887782 | 3300020476 | Marine | LPLAVILNLFLAELLVLSFGIIERTYTNINIILQDQLLPIKAE |
| Ga0211715_106486221 | 3300020476 | Marine | AVILNLFFAELLVFSLGIISTRYTNITIVLQLELSAIKAE |
| Ga0206686_10723773 | 3300021065 | Seawater | LPLAVILNLFFAELLVLSFGIILRVYTNINIILQHQLLPIKAELP |
| Ga0206678_101461761 | 3300021084 | Seawater | AVILNLFFAELFVLSFGIILRIYTNINIILQHQLLPIKAELP |
| Ga0194122_104501742 | 3300021092 | Freshwater Lake | NLFFAELFVLSFGIIVRCYTKIDTILQPLIRLIKVELP |
| Ga0206691_18620842 | 3300021342 | Seawater | VILNLFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAVLP |
| Ga0206681_103342451 | 3300021443 | Seawater | AVILNLFFAELFVFNFGIIERIYTNINIILQPQLLSIMVE |
| (restricted) Ga0233433_100875181 | 3300022931 | Seawater | NLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAE |
| (restricted) Ga0233427_101253791 | 3300022933 | Seawater | LNLFFAELFVFNFGIITRSYTNIGIDLQPLLSLIKAE |
| Ga0209992_102165091 | 3300024344 | Deep Subsurface | ITLPFADILNLFFAELFVLSFGIFLRSYTKIDINLQPQLRPIKVELP |
| Ga0209992_102371361 | 3300024344 | Deep Subsurface | LFFAELFVFSFGIILRVYTKNVVNLQLLLKLIKAELP |
| Ga0244776_103208893 | 3300024348 | Estuarine | NLFFAELFVFNLGIILRSYTNIVIDLQPLLRPIKAE |
| Ga0208770_10472413 | 3300025438 | Saline Lake | LNLFFAELLVFNFGIILRTYTNIGMDLQPLLSLIKAE |
| Ga0209632_104909471 | 3300025886 | Pelagic Marine | ETLNLFLAELFVFNFGIILRIYTNIVIDLQPLLSLIKAE |
| Ga0208524_10261951 | 3300026261 | Marine | LFFAELLVLSFGIIVSGYTNNRNILQPQLLPIKAE |
| Ga0208764_103266681 | 3300026321 | Marine | LAVILNLFFAELLVLSFGIIVRTYTNINIILQHQLLPIKAE |
| Ga0208764_103789281 | 3300026321 | Marine | ITLPFADILNLFLAELFVLSFGIILRCYTNIDINLQPLLRPIKAELP |
| Ga0209192_101905971 | 3300027752 | Marine | LFLAELLVFNFGIILRTYTNIGIDLQPILSLIKAE |
| Ga0209709_100191481 | 3300027779 | Marine | AEILNLFFAELLVFNFGIILGTYTNIGMDLQPLLNLIKAE |
| Ga0209091_103000343 | 3300027801 | Marine | EILNLFFAELLVFNFGIILGTYTNIGMDLQPLLNLIKAE |
| Ga0209091_103118252 | 3300027801 | Marine | LPAWAHITLPVADILNLFFAELFVFNLGIILRSYTKIDENLQLILKSIKVELP |
| Ga0209091_103520542 | 3300027801 | Marine | LFFAELFVFNFGIILRTYTNIGIDLQPLLSPIKAE |
| Ga0209359_102124883 | 3300027830 | Marine | NLFFAELFVFSFGIIFRRYTKNGENLQPLLRPIKAELP |
| Ga0209359_103480362 | 3300027830 | Marine | ILNLFFAELLVLSFGIIVRVYTKKDLDLQPLLKLIMAELP |
| Ga0209501_103475693 | 3300027844 | Marine | FPVAETLNLFFAELFVFSFGIILRCYTNIAIDLQPLLSPIRAE |
| Ga0209712_105077161 | 3300027849 | Marine | VAEILNLFFAELFVFNLGIILRTYTNIVIDLQPLLSLIKAE |
| Ga0257106_10531861 | 3300028194 | Marine | DITLPVAEILNLFFAELLVFNFGIILRCYTNIDTNLQPLLSLIKVE |
| Ga0257106_10809173 | 3300028194 | Marine | LPVAEILNLFFAELLVFNFGIILRSYTNIGIDLQPILSPIKAE |
| Ga0257106_13142702 | 3300028194 | Marine | FESFFAELLVFNFGIILRSYTNIVMNLQPLLSLIKVE |
| Ga0257110_12187682 | 3300028197 | Marine | VAEILNLFFAELLVFNFGIILRTYTNIGIDLQPLLSLIKAE |
| Ga0257120_10285943 | 3300028284 | Marine | VAETLNLFFAELFVFNFGIITRSYTNIGIDLQPLLSLIKAE |
| Ga0308025_12548361 | 3300031143 | Marine | ILNLFFAELLVFNFGIILPSYTNIGIDLQPLLSPTKAE |
| Ga0308010_12965211 | 3300031510 | Marine | ILNLFFAELLVFNFGIILPTYTNIGIDLQPLLSPTKAE |
| Ga0308004_102141121 | 3300031630 | Marine | EILNLFFAELFVFNFGIILRSYTNIGIDLQPLLSLIKAE |
| Ga0308001_100193481 | 3300031644 | Marine | LNLFFAELFVFNLGIILRTYTNIGIDLQPLLSLIKVE |
| Ga0307986_103034881 | 3300031659 | Marine | AEILNLFFAELFVFNLGIILRSYTNIGIDLQPLLSLIKAE |
| Ga0307986_103062031 | 3300031659 | Marine | LFFAELLVFNLGIILRTYTNIGIDLQPLLSLIKAE |
| Ga0308016_100334971 | 3300031695 | Marine | LFFAELLVFNFGIILGSYTNIGMDLQPLLSLIKAE |
| Ga0307998_12352781 | 3300031702 | Marine | PVAEILNLFFAELFVFNLGIILRSYTNIGIDLQPLLSLIKVE |
| Ga0310343_105382483 | 3300031785 | Seawater | FFAELFVLSFGIIVRVYTNKDVNLQPLLKLIMVELP |
| Ga0310344_107953433 | 3300032006 | Seawater | FAVILNLFFAELFVLSFGIIVRTYTNINIILQHQLLPIKAELP |
| Ga0315316_109726201 | 3300032011 | Seawater | LNLFLAELFVLSFGIIERVYTKNVENLQLILNLIKAELP |
| Ga0315330_105544461 | 3300032047 | Seawater | PLADILNLFFAELFVFSFGIILRTYTKKDIILQPLLRLIKAELP |
| Ga0315329_106416342 | 3300032048 | Seawater | LPLAVILNLFFAELLVFSFGIIRCVYTNIKLNLQQLL |
| Ga0315339_11094093 | 3300032134 | Seawater | LFFAELLVFSFGIIATGYTNINIILQQQLLPIKAE |
| ⦗Top⦘ |