| Basic Information | |
|---|---|
| Family ID | F065091 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.94 % |
| % of genes near scaffold ends (potentially truncated) | 78.12 % |
| % of genes from short scaffolds (< 2000 bps) | 84.38 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.219 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.656 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.219 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 41.67% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF02274 | ADI | 7.03 |
| PF00535 | Glycos_transf_2 | 3.91 |
| PF16326 | ABC_tran_CTD | 3.12 |
| PF03412 | Peptidase_C39 | 2.34 |
| PF01148 | CTP_transf_1 | 2.34 |
| PF13662 | Toprim_4 | 1.56 |
| PF08734 | GYD | 1.56 |
| PF04366 | Ysc84 | 1.56 |
| PF00144 | Beta-lactamase | 0.78 |
| PF02785 | Biotin_carb_C | 0.78 |
| PF16266 | DUF4919 | 0.78 |
| PF13533 | Biotin_lipoyl_2 | 0.78 |
| PF00199 | Catalase | 0.78 |
| PF13884 | Peptidase_S74 | 0.78 |
| PF00027 | cNMP_binding | 0.78 |
| PF00248 | Aldo_ket_red | 0.78 |
| PF00072 | Response_reg | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 7.03 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 7.03 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 7.03 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.56 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.56 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.22 % |
| Unclassified | root | N/A | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000754|JGI11851J11668_1000621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1344 | Open in IMG/M |
| 3300002903|JGI24801J43971_1010113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300002916|JGI25389J43894_1036343 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300004157|Ga0062590_100699106 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005166|Ga0066674_10236677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 868 | Open in IMG/M |
| 3300005176|Ga0066679_10744040 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005180|Ga0066685_10242020 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300005180|Ga0066685_10342999 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1036 | Open in IMG/M |
| 3300005186|Ga0066676_10685216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300005187|Ga0066675_10058775 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300005187|Ga0066675_10575817 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005289|Ga0065704_10820069 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005332|Ga0066388_103691113 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005354|Ga0070675_101570415 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005434|Ga0070709_10134895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1689 | Open in IMG/M |
| 3300005451|Ga0066681_10126875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1482 | Open in IMG/M |
| 3300005457|Ga0070662_101580686 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005558|Ga0066698_10633821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 715 | Open in IMG/M |
| 3300005558|Ga0066698_11054180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300005576|Ga0066708_10217186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1205 | Open in IMG/M |
| 3300005577|Ga0068857_102114582 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005764|Ga0066903_101571857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1246 | Open in IMG/M |
| 3300005764|Ga0066903_103122671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 896 | Open in IMG/M |
| 3300005764|Ga0066903_103130273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 895 | Open in IMG/M |
| 3300005764|Ga0066903_103348854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 865 | Open in IMG/M |
| 3300006034|Ga0066656_10743828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 629 | Open in IMG/M |
| 3300006169|Ga0082029_1331401 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300006175|Ga0070712_101717022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR106 | 549 | Open in IMG/M |
| 3300006796|Ga0066665_10245614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1414 | Open in IMG/M |
| 3300006844|Ga0075428_101918172 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009137|Ga0066709_103155643 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009156|Ga0111538_10042095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5880 | Open in IMG/M |
| 3300009162|Ga0075423_11253052 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 792 | Open in IMG/M |
| 3300010043|Ga0126380_11097148 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010043|Ga0126380_11612701 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010046|Ga0126384_10008379 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 6367 | Open in IMG/M |
| 3300010047|Ga0126382_10045333 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300010047|Ga0126382_10720384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 839 | Open in IMG/M |
| 3300010303|Ga0134082_10262375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 718 | Open in IMG/M |
| 3300010304|Ga0134088_10726078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300010323|Ga0134086_10035206 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300010358|Ga0126370_12165809 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010366|Ga0126379_11126464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 891 | Open in IMG/M |
| 3300010366|Ga0126379_11999755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
| 3300010366|Ga0126379_12606680 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010398|Ga0126383_10884361 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300010398|Ga0126383_11495664 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300010398|Ga0126383_11643350 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300011271|Ga0137393_10683046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 880 | Open in IMG/M |
| 3300011444|Ga0137463_1308247 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012198|Ga0137364_10335871 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012198|Ga0137364_10376901 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300012199|Ga0137383_10300980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1174 | Open in IMG/M |
| 3300012200|Ga0137382_10610753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 779 | Open in IMG/M |
| 3300012202|Ga0137363_10497102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1024 | Open in IMG/M |
| 3300012205|Ga0137362_10355379 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300012206|Ga0137380_10404196 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300012207|Ga0137381_11613892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 539 | Open in IMG/M |
| 3300012207|Ga0137381_11786396 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012209|Ga0137379_10797305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 849 | Open in IMG/M |
| 3300012210|Ga0137378_10034677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4489 | Open in IMG/M |
| 3300012210|Ga0137378_10601930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1009 | Open in IMG/M |
| 3300012285|Ga0137370_10078432 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300012285|Ga0137370_10767448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 598 | Open in IMG/M |
| 3300012350|Ga0137372_11020424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 575 | Open in IMG/M |
| 3300012351|Ga0137386_10608982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 786 | Open in IMG/M |
| 3300012355|Ga0137369_10259062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1311 | Open in IMG/M |
| 3300012355|Ga0137369_11123268 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012356|Ga0137371_11171474 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012357|Ga0137384_10691048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 829 | Open in IMG/M |
| 3300012925|Ga0137419_10352259 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1139 | Open in IMG/M |
| 3300012929|Ga0137404_10013933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5656 | Open in IMG/M |
| 3300012929|Ga0137404_10294541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1406 | Open in IMG/M |
| 3300012930|Ga0137407_11194730 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012948|Ga0126375_10717956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 780 | Open in IMG/M |
| 3300012957|Ga0164303_11108488 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012971|Ga0126369_13039197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 549 | Open in IMG/M |
| 3300012972|Ga0134077_10290065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300012977|Ga0134087_10067568 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300014154|Ga0134075_10455733 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300015371|Ga0132258_10128137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6047 | Open in IMG/M |
| 3300016371|Ga0182034_11229696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 652 | Open in IMG/M |
| 3300016404|Ga0182037_11740399 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300017654|Ga0134069_1115433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 882 | Open in IMG/M |
| 3300018081|Ga0184625_10488566 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018433|Ga0066667_10200698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1465 | Open in IMG/M |
| 3300019881|Ga0193707_1009036 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3400 | Open in IMG/M |
| 3300019881|Ga0193707_1070356 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300019881|Ga0193707_1155827 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300019890|Ga0193728_1167364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 952 | Open in IMG/M |
| 3300020000|Ga0193692_1008330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2588 | Open in IMG/M |
| 3300020018|Ga0193721_1002014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5354 | Open in IMG/M |
| 3300020170|Ga0179594_10356593 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300020199|Ga0179592_10296021 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300021086|Ga0179596_10071312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1508 | Open in IMG/M |
| 3300021344|Ga0193719_10046234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1885 | Open in IMG/M |
| 3300022756|Ga0222622_10030570 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300022756|Ga0222622_10337761 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300025926|Ga0207659_10243463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1456 | Open in IMG/M |
| 3300025930|Ga0207701_10001666 | All Organisms → cellular organisms → Bacteria | 23223 | Open in IMG/M |
| 3300025933|Ga0207706_11432907 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026285|Ga0209438_1175081 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026322|Ga0209687_1039055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1545 | Open in IMG/M |
| 3300026326|Ga0209801_1008907 | All Organisms → cellular organisms → Bacteria | 5293 | Open in IMG/M |
| 3300026326|Ga0209801_1180927 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300026327|Ga0209266_1035811 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300026332|Ga0209803_1261187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
| 3300026523|Ga0209808_1131131 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300026689|Ga0208579_100040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2725 | Open in IMG/M |
| 3300027882|Ga0209590_10475415 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 807 | Open in IMG/M |
| 3300028379|Ga0268266_10063384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3191 | Open in IMG/M |
| 3300028784|Ga0307282_10002251 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 7007 | Open in IMG/M |
| 3300028810|Ga0307294_10055780 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300028881|Ga0307277_10102120 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300030844|Ga0075377_11653443 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030916|Ga0075386_12104313 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031231|Ga0170824_114625850 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031446|Ga0170820_14733046 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031469|Ga0170819_15561544 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031474|Ga0170818_108493981 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031474|Ga0170818_113974694 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031573|Ga0310915_10601706 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031720|Ga0307469_10181374 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300031833|Ga0310917_10050462 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300031942|Ga0310916_11453525 | Not Available | 560 | Open in IMG/M |
| 3300031954|Ga0306926_10755085 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300031954|Ga0306926_12675007 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032261|Ga0306920_100021616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8992 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
| 3300002903 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um Nextera | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026689 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN581 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11851J11668_10006211 | 3300000754 | Soil | PGSTPAVILLQAKTKTNIDKTMDGKKLPSGNYIMSVVSEGKTASILFTIK* |
| JGI24801J43971_10101131 | 3300002903 | Soil | VILLQGKTKTNIDKTMDGKKLPSGNYXMSVVSEGKTASILVTIK* |
| JGI25389J43894_10363432 | 3300002916 | Grasslands Soil | TPAVLLLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0062590_1006991061 | 3300004157 | Soil | LLQGKTKTNLDKTLDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0066674_102366771 | 3300005166 | Soil | QGKTKTNLDKTMDGKKLAAGNYLMSVVSEAKTASILVTIK* |
| Ga0066679_107440402 | 3300005176 | Soil | KNEPVPGSTPAVLLLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0066685_102420203 | 3300005180 | Soil | LLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0066685_103429991 | 3300005180 | Soil | LQGKTKTNLDKTMDGKKLPAGNYIMSVVSEGKTASILFTIR* |
| Ga0066676_106852161 | 3300005186 | Soil | QGKTKTNLDKTMDGKKLPAGNYIMSVVSEGKTASILFTIR* |
| Ga0066675_100587755 | 3300005187 | Soil | VILLQSKTKTTIDKTMDGKKLSAGDYIMSVISESKTASILFTIK* |
| Ga0066675_105758171 | 3300005187 | Soil | ILLHGKTKTNIDKTMGGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0065704_108200692 | 3300005289 | Switchgrass Rhizosphere | VNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0066388_1036911132 | 3300005332 | Tropical Forest Soil | LLQGKTKTNLDKTMDGKKLGPGNYIMSVVSEGKTASILFIIK* |
| Ga0070675_1015704152 | 3300005354 | Miscanthus Rhizosphere | QGKTKTNLDKTMDGKKLAVGNYVMSVVSEGTTASFFVTTK* |
| Ga0070709_101348951 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNHVMSVVSEGKSASILVTIK* |
| Ga0066681_101268753 | 3300005451 | Soil | PGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0070662_1015806861 | 3300005457 | Corn Rhizosphere | STPAVILLQGKTKTNLDKTMDGKKLAAGNYDMSVVSEGKTASILITIK* |
| Ga0066698_106338212 | 3300005558 | Soil | LQGKTKTNLDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0066698_110541802 | 3300005558 | Soil | TKTTIDKTMDGKKLSPGNYVMSVVSEGKTASILFTIK* |
| Ga0066708_102171863 | 3300005576 | Soil | ESIPDSTPAVILLQGKTKTTIDKTMDGKKLSPGNYVMSVVSEGKTASILFTIK* |
| Ga0068857_1021145821 | 3300005577 | Corn Rhizosphere | VPDSTPAVILLQGKSKTNLDKTMDGKKLGAGNYVVSVVSEGKTASILVTIK* |
| Ga0066903_1015718572 | 3300005764 | Tropical Forest Soil | EERTGSKLNARGILLQGKIKTNLDKTLDGKKLAAGNYVISVVSEGKTASILVTIK* |
| Ga0066903_1031226711 | 3300005764 | Tropical Forest Soil | VNAVNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAMSVVSEGKTASILVTIK* |
| Ga0066903_1031302731 | 3300005764 | Tropical Forest Soil | NAKNEPVPDATPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK* |
| Ga0066903_1033488543 | 3300005764 | Tropical Forest Soil | PAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASVLLTIK* |
| Ga0066656_107438281 | 3300006034 | Soil | ILLQGKTKTTIDKTMDGKKLSPGNYVMSVVSEGKTASILFTIK* |
| Ga0082029_13314014 | 3300006169 | Termite Nest | NLDKTMDGKKLGAGNYVMSVVSEGKTASILLTIK* |
| Ga0070712_1017170221 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PGSTPAVILLQGKTKTNLEKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0066665_102456142 | 3300006796 | Soil | QSKDAMIIVNVHAVNAKNEPVPGSTPAMILLQGKTKTNLDKTMDGKKLSAGNYILSVVSEGKTASILVTIK* |
| Ga0075428_1019181722 | 3300006844 | Populus Rhizosphere | ILLQGKTKTTIDKTMDGKKLSTGNYVMSVVSEGKTASILFAIK* |
| Ga0066709_1031556431 | 3300009137 | Grasslands Soil | GKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0111538_100420951 | 3300009156 | Populus Rhizosphere | GEREERTGSRLNARGILLQGKTKTNLDKTLDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0075423_112530521 | 3300009162 | Populus Rhizosphere | KTKTTIDKTMDGKKLSTGNYVMSVVSEGKTASILFAIK* |
| Ga0126380_110971482 | 3300010043 | Tropical Forest Soil | LLQGKTKTNLDKTMDGKKLAAGNYGMSVVSEGKTASIFVTIK* |
| Ga0126380_116127011 | 3300010043 | Tropical Forest Soil | NQNHLDKTMDGKKLGPGNYIMSVVSEGKTASILFTIK* |
| Ga0126384_100083795 | 3300010046 | Tropical Forest Soil | VILLQGKTKTNLDKTIDGKKLGPGNYIMSVVSEGKTASILFIIK* |
| Ga0126382_100453332 | 3300010047 | Tropical Forest Soil | VILLQGKTKTNLDKITAGVEPGNYIMSVVSEGKTASILFIIK* |
| Ga0126382_107203842 | 3300010047 | Tropical Forest Soil | VLNAGGILLQGKTKTNLDKTMAGKKLVAGNYVMSVVNEGKTASILVTIK* |
| Ga0134082_102623752 | 3300010303 | Grasslands Soil | VNAKNEPIPGSTPAVILLQGKTKTTIDKTMDGKKLSPGNYVMSVVSEGKTASILFTIK* |
| Ga0134088_107260781 | 3300010304 | Grasslands Soil | QGKTKTTIDKTMDGKKLSPGNYVMSVVSEGKTASILFTIK* |
| Ga0134086_100352063 | 3300010323 | Grasslands Soil | LLQGKTKTNIDKTMDGKKLPAGNYVMSVVSEGKTASILFTIK* |
| Ga0126370_121658092 | 3300010358 | Tropical Forest Soil | SAPAVILLQGKNKTNLDKTMDGKKLASGNYVMSVVSEGKTASILMTIK* |
| Ga0126379_111264641 | 3300010366 | Tropical Forest Soil | PVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTGSILLTIK* |
| Ga0126379_119997552 | 3300010366 | Tropical Forest Soil | QGKTKTNIDKTMDGKKLAAGNYVMSVVSEGKTASILFTIK* |
| Ga0126379_126066803 | 3300010366 | Tropical Forest Soil | GKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0126383_108843611 | 3300010398 | Tropical Forest Soil | TPAVILLQGKTKTNLDKTIDGKKLGPGNYIMSVVSEGKTASILFIIK* |
| Ga0126383_114956641 | 3300010398 | Tropical Forest Soil | LLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASIFVTIK* |
| Ga0126383_116433501 | 3300010398 | Tropical Forest Soil | TKTSLDKTMDGKKLPTGNYIMSVVSEGKTASILLTIK* |
| Ga0137393_106830461 | 3300011271 | Vadose Zone Soil | TKTNIDKTMDGKKLPAGNYIMSVVSEGKTAIILFTIK* |
| Ga0137463_13082471 | 3300011444 | Soil | KTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK* |
| Ga0137364_103358712 | 3300012198 | Vadose Zone Soil | VPGSTPAVLLLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0137364_103769012 | 3300012198 | Vadose Zone Soil | AVILLQGKTKTNIDKTMDGKKLPAGNYVMSVVSEGKTASILFTIK* |
| Ga0137383_103009801 | 3300012199 | Vadose Zone Soil | ESKSDMIIVNVNMVTAKNEPVQGSEPAVILLEGKTKTNIDKTMDGKKLPAGNYIMSVVSEGQTASILFTIK* |
| Ga0137382_106107531 | 3300012200 | Vadose Zone Soil | VILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0137363_104971022 | 3300012202 | Vadose Zone Soil | VILLQGKTKTNLDKTMDGKKLAAGNYIMSVVSQGKTASILVTIK* |
| Ga0137362_103553791 | 3300012205 | Vadose Zone Soil | TNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0137380_104041962 | 3300012206 | Vadose Zone Soil | LQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0137381_116138921 | 3300012207 | Vadose Zone Soil | AVILLQGKTKTNLDKTMDGKKLAAGNYVVSVVSEGKTASILLTIK* |
| Ga0137381_117863962 | 3300012207 | Vadose Zone Soil | QGKTKTNLDKTMDGKKLAAGNYIMSVVSQGETASILFTIK* |
| Ga0137379_107973051 | 3300012209 | Vadose Zone Soil | KTNIDKTMDGKKLPPGNYIMSVVSEGKTASILFTIK* |
| Ga0137378_100346771 | 3300012210 | Vadose Zone Soil | VPGSPPAVILLQGKTKTTIDKTMDGKKLSAGNYIMSVVSEGKTASVLFTIK* |
| Ga0137378_106019302 | 3300012210 | Vadose Zone Soil | VPGSPPAVILLQGKTKTTIDKTMDGKKLSAGNYIMSVVSEAKTASILFIIK* |
| Ga0137370_100784321 | 3300012285 | Vadose Zone Soil | AVLLLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0137370_107674481 | 3300012285 | Vadose Zone Soil | TPAVLLLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVIIK* |
| Ga0137372_110204241 | 3300012350 | Vadose Zone Soil | VILLQGKTKTTIDKTMDGKKLSAGNYIMSVVSEAKTASILFIIK* |
| Ga0137386_106089821 | 3300012351 | Vadose Zone Soil | VNAKNELVPGSTPAVLLLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK* |
| Ga0137369_102590621 | 3300012355 | Vadose Zone Soil | PPAVILLQGKTKTPIDQTMDGKTLSAGNYIMSVVSEGKTASVLFTIK* |
| Ga0137369_111232681 | 3300012355 | Vadose Zone Soil | NMVNAKNEPVQGSTPAVILLQGKTKTTIDKTMDGKKLSAGNYIMSVVSEGKTASILFTIK |
| Ga0137371_111714742 | 3300012356 | Vadose Zone Soil | LLQGKTKTNINKAMDGKKLSAGNYIMSVVSEGKIASILFIIK* |
| Ga0137384_106910481 | 3300012357 | Vadose Zone Soil | QGSTPAVILLEGKTKTNIDKTMDGKKLPAGNYIMSVVSEGQTASILFTIK* |
| Ga0137419_103522591 | 3300012925 | Vadose Zone Soil | LQGKTKTSLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK* |
| Ga0137404_100139336 | 3300012929 | Vadose Zone Soil | ILLQGKTKTTIDKTMDGKKLPAGNYIMSVVSEGNTASILFTIK* |
| Ga0137404_102945413 | 3300012929 | Vadose Zone Soil | ILLQGKTKTTIDKTMDGKKLPAGNYIMSVVSEGNTASILFKIK* |
| Ga0137407_111947301 | 3300012930 | Vadose Zone Soil | GKTKTTIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0126375_107179562 | 3300012948 | Tropical Forest Soil | VILLQGKTKTNLDKTMDGKKLGPGNYIMSVVSEGKTASILFTIK* |
| Ga0164303_111084882 | 3300012957 | Soil | VNAVNAKNEPVPGSAPAVILLHGKTKTNLDKTMDGKKLAAGNYIMSVVSEGKTASILVTIK* |
| Ga0126369_130391971 | 3300012971 | Tropical Forest Soil | VNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYILSVVSEGKTASIIITIK* |
| Ga0134077_102900652 | 3300012972 | Grasslands Soil | NVNMVNAKNEPVQGSTPAVILPQGKTKTNLDKTMDGKKLPAGNYIMSVVSKGKTASILFTIQ* |
| Ga0134087_100675681 | 3300012977 | Grasslands Soil | KTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0134075_104557332 | 3300014154 | Grasslands Soil | VLLLQGKTKTNIDKTTDGKKLPAGNYIMSVVSEGKTASILFTIK* |
| Ga0132258_101281375 | 3300015371 | Arabidopsis Rhizosphere | LLQGKTKTNLDKTLDGKKLPAGNYVMSVVSEGKTASILVTIK* |
| Ga0182034_112296961 | 3300016371 | Soil | TGSRLNARGILLRGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| Ga0182037_117403991 | 3300016404 | Soil | KLIARGILLQGKTKTNLDKTMDGKKPAAGIYVMSVVSEGKTASSFVTIK |
| Ga0134069_11154331 | 3300017654 | Grasslands Soil | ILLQGKTKTNLDKTMDGKELPAGNYIMSVMSEGKTASILFTIK |
| Ga0184625_104885661 | 3300018081 | Groundwater Sediment | AVILLQGKTKTNLDKTMDGKKLSAGNYIMSVISEGKTARILVTIK |
| Ga0066667_102006981 | 3300018433 | Grasslands Soil | LQGKTKTNLDKTMDGKKLPAGNYIMSVVSEGKTASILFTIR |
| Ga0193707_10090364 | 3300019881 | Soil | GSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVVSVVSEGKTASILLTIK |
| Ga0193707_10703562 | 3300019881 | Soil | VNSVNAKSEPVPGSTPAVILLQGKNKTNLDKTMDGKKLAAGNHVVSVVSEGKTASILVTI |
| Ga0193707_11558271 | 3300019881 | Soil | TKTNLDKTMDGKKLAAGNYVVSAVSEGKTASILVTIK |
| Ga0193728_11673642 | 3300019890 | Soil | SVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVVSAVSEGKTASILVTIK |
| Ga0193692_10083304 | 3300020000 | Soil | GSAPAVILLQGKTKTNLDKTMDGKKLAAGNYIMSVVSEGKTASILVTIK |
| Ga0193721_10020146 | 3300020018 | Soil | MIIVNVNAVNAKNEPVPGSTPAVSLLQGKTKTNLDKTMDGKKLAAGNYVVSVVSEGKTASILLTIK |
| Ga0179594_103565932 | 3300020170 | Vadose Zone Soil | VILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| Ga0179592_102960211 | 3300020199 | Vadose Zone Soil | GPGSPPAVILLQGKTKTNLDKTMDGKKLAAGNYIMSVISEGKTASILVTIK |
| Ga0179596_100713121 | 3300021086 | Vadose Zone Soil | NAVNAKTEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK |
| Ga0193719_100462343 | 3300021344 | Soil | GKTKTNLDKTMDGRKLAAGNYVVSVVSEGKTASILVTIK |
| Ga0222622_100305701 | 3300022756 | Groundwater Sediment | LLQGKTKTTIDKTMDGKKLPAGNLMSVVSEGKTASILFTIK |
| Ga0222622_103377613 | 3300022756 | Groundwater Sediment | VNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVVSVVSEGKTASILVTIK |
| Ga0207659_102434632 | 3300025926 | Miscanthus Rhizosphere | AVNAKNEPVPDSTPAVILLQGKSKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| Ga0207701_1000166622 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TKTNLDKTLDGKKLPAGNYVMSVVSEGKTASILVTIK |
| Ga0207706_114329071 | 3300025933 | Corn Rhizosphere | STPAVILLQGKTKTNLDKTMDGKKLAAGNYDMSVVSEGKTASILITIK |
| Ga0209438_11750811 | 3300026285 | Grasslands Soil | KTKTSLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK |
| Ga0209687_10390552 | 3300026322 | Soil | NVNMVNAKNEPITGSAPAVILLQGKTKATIDKTVDGKKLSPRNYVMSVVSEGKTASILFTIK |
| Ga0209801_10089073 | 3300026326 | Soil | MIIVNVNPVTAKNEPVPGSTPAVLLLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK |
| Ga0209801_11809271 | 3300026326 | Soil | KTKTNIDKTMDGKKLPAGNYIMSVVSEGKTANILFTIK |
| Ga0209266_10358114 | 3300026327 | Soil | LLQGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK |
| Ga0209803_12611872 | 3300026332 | Soil | LQGKTKTNLDKTMDGKKLPAGNYIMSVVSEGKTASILFTIK |
| Ga0209808_11311312 | 3300026523 | Soil | VILLEGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTANILFTIK |
| Ga0208579_1000401 | 3300026689 | Soil | EPVPGSTPAVFLLQGKTKTTIDKTMDGKKLSPGNYIMSVVREGKTASILFTIK |
| Ga0209590_104754151 | 3300027882 | Vadose Zone Soil | DMIIVNVNMVTAKNEPVQGSTPAVILLEGKTKTNIDKTMDGKKLPAGNYIMSVVSEGKTANILFTIK |
| Ga0268266_100633841 | 3300028379 | Switchgrass Rhizosphere | GKTKTNLDKTMDGKKLAPGNYVMSVVSEGKTASILVTIK |
| Ga0307282_100022511 | 3300028784 | Soil | TPALILLQGKTKTTIDKTMDGKKLPAGNYIMSVVSEGNTASILFTIK |
| Ga0307294_100557801 | 3300028810 | Soil | KTNLDKTMDGKKLAAGNYVVSVVSEGKTASILVTIK |
| Ga0307277_101021201 | 3300028881 | Soil | PAVSLLQGKTKTNLDKTMDGKKLAAGNYVVSVVSEGKTASILLTIK |
| Ga0075377_116534432 | 3300030844 | Soil | VHAVNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTI |
| Ga0075386_121043131 | 3300030916 | Soil | AKNEPVPGSTPAVVLLQGKTKTNLDKTMDGKKLAAGNYLMSLVSEGKTASILVTIK |
| Ga0170824_1146258501 | 3300031231 | Forest Soil | MIIVNVNAANAKNEPVPGSTAAVILLQGKTKTNLDKTMDGKKLAAGNYFVSVVSEGKSASILVTIK |
| Ga0170820_147330462 | 3300031446 | Forest Soil | VNAKNEPVPGSTPAVILLQGKTKTNLNKTMDGKKLAAGNYVMSVVSEGKTASILVTIE |
| Ga0170819_155615442 | 3300031469 | Forest Soil | VNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| Ga0170818_1084939811 | 3300031474 | Forest Soil | MIIVNVNAANAKNEPVPGSTAAVILLQGKTKTNLDKTMDGKKLAAGNYFVSVVSEGKTASILVTIK |
| Ga0170818_1139746942 | 3300031474 | Forest Soil | VHAVNAKNEPVPGSTPAVILLQGKTKTNLDKTMDGKKLAAGNYVMSAVSERKTASILVTI |
| Ga0310915_106017061 | 3300031573 | Soil | NAKNEPVPGSTPAVILLQGKTKTNLNKIMDGKKLAAGNHILSVVSEGKTASILLTIK |
| Ga0307469_101813741 | 3300031720 | Hardwood Forest Soil | NNEPVPGSTPAVILLEGKTETNLDKTMDGKKLAAGNYVMSVVSEGKTASILLTIK |
| Ga0310917_100504625 | 3300031833 | Soil | MIIVNVNAMNAKNEPVPGSTPAVILLQGKTKTNLNKIMDGKKLAAGNHILSVVSEGKTASILLTIK |
| Ga0310916_114535251 | 3300031942 | Soil | QGKTKTNLNKIMDGKKLAAGNHILSVVSEGKTASILLTIK |
| Ga0306926_107550851 | 3300031954 | Soil | MNAVNAKNEPVPGSTPAVILLEGKTKTNLDKTMDGKKLAAGNYVLSVVSEGKTASILVTI |
| Ga0306926_126750072 | 3300031954 | Soil | ILLQGKTKTNLDKTMDGKKPAAGIYVMSVVSEGKTASSFVTIK |
| Ga0306920_1000216166 | 3300032261 | Soil | MIILNMNAVNAKNEPVPGSTAAVILLEGKTKTNLDKTMDGKKLAAGNYVMSVVSEGKTASILVTIK |
| ⦗Top⦘ |