NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065014

Metagenome / Metatranscriptome Family F065014

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065014
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 56 residues
Representative Sequence PGRAETTFERDGDGWRAAAGRERGERLRVDGDRMIWAGYAFTRAQEPFTA
Number of Associated Samples 118
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 90.62 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.094 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(9.375 % of family members)
Environment Ontology (ENVO) Unclassified
(33.594 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.969 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.49%    Coil/Unstructured: 70.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF01699Na_Ca_ex 68.75
PF07452CHRD 12.50
PF13419HAD_2 3.12
PF07883Cupin_2 1.56
PF00884Sulfatase 1.56
PF00749tRNA-synt_1c 1.56
PF13302Acetyltransf_3 0.78
PF01261AP_endonuc_2 0.78
PF13649Methyltransf_25 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 68.75
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 68.75
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.09 %
UnclassifiedrootN/A3.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig98095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
2170459006|GBPF9FW01BVP50All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
2170459007|GJ61VE201EYU3YAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
2170459009|GA8DASG02HXH4LAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300001538|A10PFW1_11253562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300001686|C688J18823_10398360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300002568|C688J35102_120811715All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300004081|Ga0063454_101991962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005093|Ga0062594_103325889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005174|Ga0066680_10736616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300005179|Ga0066684_10657008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300005329|Ga0070683_100250486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1684Open in IMG/M
3300005329|Ga0070683_100732718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300005336|Ga0070680_102007954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005337|Ga0070682_101009754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005339|Ga0070660_100022453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4666Open in IMG/M
3300005344|Ga0070661_100050437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3045Open in IMG/M
3300005434|Ga0070709_10891576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300005436|Ga0070713_100439250All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300005456|Ga0070678_101068989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300005468|Ga0070707_100825963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia891Open in IMG/M
3300005535|Ga0070684_100223352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1719Open in IMG/M
3300005538|Ga0070731_10065454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2413Open in IMG/M
3300005539|Ga0068853_101434481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus668Open in IMG/M
3300005547|Ga0070693_101399026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus544Open in IMG/M
3300005548|Ga0070665_101566280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300005560|Ga0066670_10155220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1341Open in IMG/M
3300005563|Ga0068855_100916176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium925Open in IMG/M
3300005564|Ga0070664_101202806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus715Open in IMG/M
3300005564|Ga0070664_101206790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300005577|Ga0068857_101464136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300005577|Ga0068857_101956681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005616|Ga0068852_101848966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300005764|Ga0066903_101525805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300005764|Ga0066903_108844903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300006028|Ga0070717_10828445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300006173|Ga0070716_101794643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae508Open in IMG/M
3300006175|Ga0070712_100013800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5169Open in IMG/M
3300006804|Ga0079221_11580797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus530Open in IMG/M
3300006953|Ga0074063_13486371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300009098|Ga0105245_11816216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300009177|Ga0105248_12927423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300009545|Ga0105237_10926901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus878Open in IMG/M
3300009840|Ga0126313_11666458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300010048|Ga0126373_13055812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300010152|Ga0126318_10522629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus576Open in IMG/M
3300010336|Ga0134071_10499050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300010371|Ga0134125_12363162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300010375|Ga0105239_11857725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300010396|Ga0134126_12345985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300010397|Ga0134124_11923795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300010399|Ga0134127_12423639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus604Open in IMG/M
3300010400|Ga0134122_12177257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300010401|Ga0134121_11667873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300010937|Ga0137776_1760933Not Available540Open in IMG/M
3300012208|Ga0137376_10812242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300012212|Ga0150985_119645100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300012469|Ga0150984_107496686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300012944|Ga0137410_10565073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300012960|Ga0164301_11061094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012961|Ga0164302_11004443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300012984|Ga0164309_10910668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300012987|Ga0164307_10781178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300012988|Ga0164306_10088571All Organisms → cellular organisms → Bacteria1988Open in IMG/M
3300012988|Ga0164306_10817402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300012989|Ga0164305_12255943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300013296|Ga0157374_11496122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300013765|Ga0120172_1004449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4934Open in IMG/M
3300013770|Ga0120123_1011994All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300015203|Ga0167650_1080835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300015245|Ga0137409_10554382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300016341|Ga0182035_11391677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300017659|Ga0134083_10572239All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300017944|Ga0187786_10271903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300017961|Ga0187778_10609032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300017974|Ga0187777_10108762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1826Open in IMG/M
3300018431|Ga0066655_10676337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300020069|Ga0197907_10938164All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300020069|Ga0197907_11011473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300020070|Ga0206356_11367352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus770Open in IMG/M
3300020075|Ga0206349_1500790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300021363|Ga0193699_10048192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1642Open in IMG/M
3300022467|Ga0224712_10516874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus578Open in IMG/M
3300024178|Ga0247694_1030556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300024283|Ga0247670_1042419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300025899|Ga0207642_10431118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300025906|Ga0207699_10480859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300025909|Ga0207705_10217180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1451Open in IMG/M
3300025913|Ga0207695_11188390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300025915|Ga0207693_10638421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300025920|Ga0207649_10119411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1775Open in IMG/M
3300025928|Ga0207700_10591475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300025928|Ga0207700_12004235All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300025932|Ga0207690_10405026All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300025934|Ga0207686_10069148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2264Open in IMG/M
3300025939|Ga0207665_11283497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300025945|Ga0207679_11377205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus647Open in IMG/M
3300025960|Ga0207651_11931043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300025981|Ga0207640_11096354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300026067|Ga0207678_11203013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300026078|Ga0207702_10047050All Organisms → cellular organisms → Bacteria3633Open in IMG/M
3300026078|Ga0207702_11383264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300026319|Ga0209647_1038050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2727Open in IMG/M
3300027869|Ga0209579_10042710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2433Open in IMG/M
3300028782|Ga0307306_10093880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300028875|Ga0307289_10372190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300031251|Ga0265327_10098089All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300031344|Ga0265316_10289419All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300031474|Ga0170818_100886198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus749Open in IMG/M
3300031640|Ga0318555_10387031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300031671|Ga0307372_10168784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1491Open in IMG/M
3300031672|Ga0307373_10255916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1168Open in IMG/M
3300031779|Ga0318566_10347534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300031845|Ga0318511_10074030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1412Open in IMG/M
3300031938|Ga0308175_102097992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300031939|Ga0308174_10039476All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300031996|Ga0308176_11319783Not Available767Open in IMG/M
3300032055|Ga0318575_10219255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300032065|Ga0318513_10163123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300032074|Ga0308173_10007813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6476Open in IMG/M
3300032160|Ga0311301_11388189Not Available878Open in IMG/M
3300032261|Ga0306920_102515800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300032782|Ga0335082_10631062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300032954|Ga0335083_10170816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2025Open in IMG/M
3300033158|Ga0335077_10743738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300033158|Ga0335077_11437758Not Available663Open in IMG/M
3300034195|Ga0370501_0103657Not Available959Open in IMG/M
3300034195|Ga0370501_0210352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.34%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.34%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.34%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.56%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.78%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_065096502140918008SoilGALQAKVAGSPPGRGETTFERDGDGWRASAGRELGERLRVDGGQLVWSGYAFTRAQEPFK
L01_035044002170459006Grass SoilAGRGETTFERDGDAWRAAVGRERGERLRVDGDRLIWAGYAFTRLQEPFKG
L02_031856002170459007Grass SoilEFVFWWEGGTLRAKVVGTGPGRGETTFERDGDAWRASAGRERGERLRIDGGRLVWSGYAFTRAQEPF
F47_085410702170459009Grass SoilDKGKLRAKVAGTSPGRGETAFERDGDGWIAAEGRELGERLRVAGDELVWAGYAFTRTQQPFKA
A10PFW1_1125356223300001538PermafrostFWWEDGTLQAKVAGTPPGRGETTFERDGDGWRAARGRERGERLRVDGDRLVWAGYSFTRAQEPFKA*
C688J18823_1039836013300001686SoilGETTFEDDGEGWRASAGRERGERLRVEGEKMIWAGYAFTRAQEPFKAS*
C688J35102_12081171513300002568SoilTLPGRGETTFAREGDGWRASVGRERGERLRIDGDRLIWSGYAFTRAQEPFPGV*
Ga0063454_10199196213300004081SoilARFAAAPPGKGETEFERDGDGWRASGGRERGERLRIDGERMIWAGYAFTRAQEPFTA*
Ga0062594_10332588923300005093SoilQFVFTWEQGSLRAKVTGSPPGRGETTFERDGEGWVASAGRERGEQLRVDAEQLVWAGYPFTRTQQPFAAG*
Ga0066680_1073661623300005174SoilFVFWWEEGTLQAKVVNSPRGRGETTFERDGDGWRAARGRERGERLRAEDGRLVWAGYAFTRAQQPFKA*
Ga0066684_1065700823300005179SoilERDGDGWIAAKGRERGERVRWNGEALVWAGYPFTRNQEPFKA*
Ga0070683_10025048613300005329Corn RhizosphereDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQRPFTAG*
Ga0070683_10073271823300005329Corn RhizosphereKGETEFEREGDGWRASGGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0070680_10200795423300005336Corn RhizosphereAPGRGETTFERDGDAWRAAAGRERGERLRIDGDQLIWSGYAFTRAQEPFKA*
Ga0070682_10100975423300005337Corn RhizosphereGETTFERDGDAWRAAAGRERGERLRIDGDQLIWSGYAFTRAQEPFKA*
Ga0070660_10002245313300005339Corn RhizosphereNEFVFWWQDEALQAKVVGTAPGRGETTFERDGDAWRAAAGRERGERLRIDGDQLIWSGYAFTRAQEPFKA*
Ga0070661_10005043713300005344Corn RhizosphereFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQQPFTTR*
Ga0070709_1089157613300005434Corn, Switchgrass And Miscanthus RhizosphereGTAPGRAETTFARDGDDWRAAEGRELGERLRVDGNRLIWAGYPFTRDQQPFTPDES*
Ga0070713_10043925033300005436Corn, Switchgrass And Miscanthus RhizosphereFERDGDGWVAAEGRELGERLRVVGDELVWAGYAFTRTQQPFKA*
Ga0070678_10106898913300005456Miscanthus RhizosphereEFVFWWERGALQAKVVGTAPGRAETTFARDGDDWRAAEGRELGERLRVDGNRLIWAGYPFTRDQQPFTPDES*
Ga0070707_10082596313300005468Corn, Switchgrass And Miscanthus RhizosphereFWWERGALQAKVVGTLPGRGETTFERDGEQWRAAAGRERGERLRVDGDRLIWAGYAFTRAQQPFTAAQRGS*
Ga0070684_10022335233300005535Corn RhizosphereEGDGWRAAAGRERGERLTIDGDRLIWSGYAFTRAQEPFKA*
Ga0070731_1006545413300005538Surface SoilVFWWEESTLRAKVAGSPPGRGETTFARDGDGWVAAEGYERGERLLIRDGELVWSGYPFTRAQQQTRM*
Ga0068853_10143448113300005539Corn RhizosphereGSLPGRGETTFERDGAGWVASAGRERGEQLRVDAEQLVWAGYPFTRAQQPFAAG*
Ga0070693_10139902623300005547Corn, Switchgrass And Miscanthus RhizosphereRDGDGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFAAG*
Ga0070665_10156628023300005548Switchgrass RhizosphereWWERGALQAKVAGTAPGRAETTFARDGDDWRAAEGRELGERLRVDGNRLIWAGYPFTRDQQPFTPDES*
Ga0066670_1015522023300005560SoilGNEFVFWWQDGTLRAKVVGTPAGRGETTFERDGDGWRASAGRERGERLRVDGDRMIWSGYAFTRAQEPFKA*
Ga0068855_10091617633300005563Corn RhizosphereEGNEFIFWWEGGKLRAKVAGFAPGRGETAFERTADGWVASEGREQGEKLRVEGDRVIWGGYAFTREQLPFSAL*
Ga0070664_10120280623300005564Corn RhizospherePGRAETTFERDGDGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFTAG*
Ga0070664_10120679023300005564Corn RhizosphereRPLVVRGQRVHLWWEHGTLQAKVAGTPPGRGETTFERDGDGWRASAGRERGERLRIEDGRFVWSGYAFTRAQEPFKA*
Ga0068857_10146413613300005577Corn RhizosphereRPQTCIRCRPLVAEGNEFIFWWEHGTLQAKVAGTPPGRGETTFERDGDGWRASAGRERGERLRIEDGRFVWSGYAFTRAQEPFKA*
Ga0068857_10195668113300005577Corn RhizospherePGRGETTFERDGDAWRAAAGRERGERLRIDGDQLIWSGYAFTRAQEPFKA*
Ga0068852_10184896623300005616Corn RhizosphereWSEGNEFMFWWEAGKLRARFVAAPPGRGETTFERDGDGFLAVAGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0066903_10152580513300005764Tropical Forest SoilLQAKVAGSLPGKKETTFARDGDGWRAARGRERGERLRVDGDRLVWAGYAFTRAQEPFTA*
Ga0066903_10884490313300005764Tropical Forest SoilAETTFERDGDGWVAAAGRERGEKLRWNGEAVVWAGYSFTRVQEPFKA*
Ga0070717_1082844513300006028Corn, Switchgrass And Miscanthus RhizospherePPGRGETTFAREGDGWIAAAGRERGERLRVDGERMVWAGYAFTRTQEPFT*
Ga0070716_10179464313300006173Corn, Switchgrass And Miscanthus RhizosphereALKAKVAGTPRGRGETTFAREGNGWRAAAGRERGERLRVDGERLIWSGYAFTRAQEPFGV
Ga0070712_10001380083300006175Corn, Switchgrass And Miscanthus RhizosphereGDDWRAAEGRELGERLRVDGNRLIWAGYPFTRDQQPFTPDES*
Ga0079221_1158079723300006804Agricultural SoilRDGEGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFSAG*
Ga0074063_1348637123300006953SoilREGDGWRASRGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0105245_1181621613300009098Miscanthus RhizosphereGDGWIAARGRERGERLRVDGERLIWAGYAFTRAQEPFTV*
Ga0105248_1292742323300009177Switchgrass RhizosphereFAAAPPGKGETEFERDGDGWRAAGGRERGERLRVDGDQMIWAGYAFTRAQEPFKA*
Ga0105237_1092690113300009545Corn RhizosphereSLCAKVAGTAPGRAETTFERDGSGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFAAD*
Ga0126313_1166645823300009840Serpentine SoilGETEFECDGDGWRASGGRERGERLRVDGDRMIWAGYAFTRAQEPFQA*
Ga0126373_1305581213300010048Tropical Forest SoilNRGGDTTFARDAGGWIATEGRERGERLRVDGDRLIWAGYEFTRAQKPFAG*
Ga0126318_1052262913300010152SoilFLVRFAFWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFTAG*
Ga0134071_1049905023300010336Grasslands SoilERGALQAKVVGTPPGRAETTFDRDGDGWRAAEGREGGERLRVDGDRLIWGGYAFTRAQEPTAG*
Ga0134125_1236316223300010371Terrestrial SoilFWWEAGTLHARVVAAPPGRGETAFEREGDGWRASRGRERGEPLRVDGERLIWAGYPFTRAQEPFKA*
Ga0105239_1185772513300010375Corn RhizosphereLQAKVVGLPPGRGETTFELDGDGWIAARGRERGERLRVDGERLIWAGYAFTRAQEPFTV*
Ga0134126_1234598513300010396Terrestrial SoilALVVAAPAGRGETTFAREGDGWVAAAGRERGERLRVDGERLIWAGYEFTRAQQPSAPDA*
Ga0134124_1192379523300010397Terrestrial SoilGALKAKVAGTAPGRGETTFERDGDAWRASAGRERGESLRIDDGRLIWSGYAFTRAQEPFTA*
Ga0134127_1242363923300010399Terrestrial SoilEQGSLRAKVTGTAPGRAETTFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQQPFAAG*
Ga0134122_1217725713300010400Terrestrial SoilFAAAPPGKGETEFERDGDGWRASGGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0134121_1166787313300010401Terrestrial SoilPPGKGETEFERDGDGWRAARGRERGERLRVDGDQMIWAGYAFTRAQEPFKA*
Ga0137776_176093323300010937SedimentETAFERDGDGWVAAEGRELGERLRVVGDELVWAGYPFTRSQEQTRA*
Ga0137376_1081224213300012208Vadose Zone SoilRGTLQAKVVGTPPGRGETTFERDGGQWRAAAGRERGERLRVDGDRLIWAGYAFTRAQQPFAGTQRGS*
Ga0150985_11964510023300012212Avena Fatua RhizosphereAKVVGTAAGRGETTFENDGDGWRASAGRERGERLRVEGDQMIWAGYAFTRAQEPFKAS*
Ga0150984_10749668613300012469Avena Fatua RhizosphereEDDGDGWRASAGRERGERLRVEGEQMIWAGYAFTRAQEPFKAS*
Ga0137410_1056507313300012944Vadose Zone SoilTFEREGGGWRASAGRERGERLRVEGDRMIWSGYAFTRAQEPFKA*
Ga0164301_1106109423300012960SoilPPGRGETEFAREGDGWRASRGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0164302_1100444323300012961SoilALQAKVAGSPPGRKETTFERDGDGFVAARGRERGERLRVDGDQLVWAGYPFTRSQEPTKG
Ga0164309_1091066813300012984SoilGSLRAKFAAAPPGKGETEFERDGDGWRAVGGRERGERLRVDGDQMIWAGYAFTRAQEPFKA*
Ga0164307_1078117833300012987SoilFARDGDGWRAARGRERGERLRVDGDRLVWAGYAFTRTQEPFTPD*
Ga0164306_1008857133300012988SoilGGALKAKVVGTPPGRGETTFEQEGDGWRASAGRERGERLRVDGEQMIWAGYAFTRAQEPFKA*
Ga0164306_1081740223300012988SoilARDGDGWRASRGRERGERLRVDGDRMIWAGYAFTRAQEPFKA*
Ga0164305_1225594313300012989SoilTAAPGKGETTFARDGDGWIAAKGRERGERLRRDGDRMIWAGYAFTRDQEPFSLL*
Ga0157374_1149612223300013296Miscanthus RhizosphereEGNEFVFWWEGGTLKAKVVGTKPGRGETTFARDGDAWRAAAGRERGERLRIDGGRLVWSGYAFTRAQEPFA*
Ga0120172_100444983300013765PermafrostFWWQDGTLQAKVAGTAPGRGETTFEPDGDGWRAARGRERGERLRVDGDRLVWAGYSFTRAQEPFKA*
Ga0120123_101199413300013770PermafrostGTAPGRAETTFERDGDGWVASAGRERGERLRVEGEQLVWAGYPFTRAQKPFSA*
Ga0167650_108083513300015203Glacier Forefield SoilVAAAPPGKGETTFALDGDGWVAAKGRERGERLRCDGERMIWAGYAFTRAQEPFSSL*
Ga0137409_1055438213300015245Vadose Zone SoilRAKVVGTPAGRGETTFERDGGGWRASAGRERGERLRAEGDRMIWSGYAFTRAQEPFKA*
Ga0182035_1139167723300016341SoilKGKLRAKVAGTPPGRGETAFERDGDDWVAAEGRELGERLRVAGDELVWAGYPFTRTQQQTRA
Ga0134083_1057223913300017659Grasslands SoilPAGRGETTFERDRDGWRASAGREQGERLRVDGDRMIWAGYAFTRAQQPFKA
Ga0187786_1027190323300017944Tropical PeatlandWEGGSLRARVVAAPPGRGETTFERDGEGWRAAAGRERGERLRVVGDRLVWAGYPFTREQEPLPSNQSAS
Ga0187778_1060903213300017961Tropical PeatlandAKVVGEPPGRGETTFERDGDGWRASAGREQGERLRVDGDGLVWAGYSFTRAQEPFTG
Ga0187777_1010876233300017974Tropical PeatlandPPGRGETTFERDGDGWRASAGREQGERLRVDGDGLVWAGYSFTRAQEPFTG
Ga0066655_1067633713300018431Grasslands SoilTTFEPDADGWMAVEGRERGERLSVRDGELVWAGYPFTRDQQPFKA
Ga0197907_1093816413300020069Corn, Switchgrass And Miscanthus RhizospherePGRGETTFERDGEGWVASAGRERGEQLRVDAEQLVWAGYPFTRTQQPFAAG
Ga0197907_1101147323300020069Corn, Switchgrass And Miscanthus RhizospherePDERDGDGFLPVAGRERGERLRVDGDRMIWAGYAFTRAQEPFKA
Ga0206356_1136735213300020070Corn, Switchgrass And Miscanthus RhizosphereTQFVFTWEKGSLCAKVAGTAPGRAETTFERDGDGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFAAD
Ga0206349_150079013300020075Corn, Switchgrass And Miscanthus RhizosphereTTFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQRPFTAG
Ga0193699_1004819233300021363SoilTFEFVFWWEGGTLNAKVVGTAAGRGETTFERDGDGDAWRAAAGRERGERLRIDGGRLIWSGYAFTRAQEPFKA
Ga0224712_1051687413300022467Corn, Switchgrass And Miscanthus RhizosphereGSLCAKVAGTAPGRAETTFERDGDGWIAAAGRERGERLRVDGEQLVWAGYPFTRAQQPFTAG
Ga0247694_103055623300024178SoilETAFERDGDAWRAAAGRERGERLRIDGGRLVWSGYAFTRAQEPFA
Ga0247670_104241913300024283SoilEFVFWWEGGTLRAKVVGTKPGRGETTFERDGDAWRASAGRELGERLRIDGGRLVWSGYAFTRAQEPFA
Ga0207642_1043111823300025899Miscanthus RhizosphereEGNEFMFWWEAGTLHARVVAAPPGRGETAFEREGDGWRASRGRERGEPLRVEGDRLIWAGYPFTRAQEPFKA
Ga0207699_1048085913300025906Corn, Switchgrass And Miscanthus RhizosphereGTAPGRAETTFARDGDDWRAAEGRELGERLRVDGNRLIWAGYPFTRDQQPFTPDES
Ga0207705_1021718033300025909Corn RhizospherePPGRGETIFERDGDGWRASAGRERGERLRIEDGRFVWSGYAFTRAQEPFKA
Ga0207695_1118839013300025913Corn RhizosphereGRGETTFERDGDGWRASAGRERGERLRIEDGRFVWSGYAFTRAQEPFKA
Ga0207693_1063842113300025915Corn, Switchgrass And Miscanthus RhizosphereDGDGWRAAGGRERGERLRVDGDQMIWAGYAFTRAQEPFKA
Ga0207649_1011941113300025920Corn RhizosphereGETTFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQQPFTTR
Ga0207700_1059147513300025928Corn, Switchgrass And Miscanthus RhizosphereFERDGDGWVAAEGRELGERLRVVGDELVWAGYAFTRTQQPFKA
Ga0207700_1200423523300025928Corn, Switchgrass And Miscanthus RhizosphereRGETTFERDHDGWRASAGREQGERLRVDGERMIWAGYPFTRAQEPSPG
Ga0207690_1040502613300025932Corn RhizosphereGTAPGRGETTFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQQPFTTR
Ga0207686_1006914843300025934Miscanthus RhizosphereEQEGDGWRASAGRERGERLRVDGEQMIWAGYAFTRAQEPFKA
Ga0207665_1128349713300025939Corn, Switchgrass And Miscanthus RhizosphereVFWWEHGTLQAKIVASSRGRAETTFERDRDGWRAAKGRERGERLRVDGDRLIWAGYAFTRDQEPFTA
Ga0207679_1137720513300025945Corn RhizosphereTGSPPGRGETTFERDGEGWVASAGRERGEQLRVDAEQLVWAGYPFTRTQQPFAAG
Ga0207651_1193104323300025960Switchgrass RhizosphereLRARFAAAPPGKGETEFEREGDGWRASGGRERGERLRVDGDRMIWAGYAFTRAQEPFKA
Ga0207640_1109635413300025981Corn RhizosphereTAPGRGETTFERDGDDWIAAAGRERGERLRVEAEQLVWAGYPFTRTQRPFAAG
Ga0207678_1120301323300026067Corn RhizosphereRARVAAAPAGRGETTFEHDGDGWRAAAGRERGERLRIDGERLIWSGYAFTRAQEPFTA
Ga0207702_1004705063300026078Corn RhizosphereAKVAGTAPGRGETTFERDGDGWIAAAGRERGERLRVEAEQLVWAGYPFTRTQQPFTTR
Ga0207702_1138326423300026078Corn RhizosphereGKGETEFERDGDAWRAARGRERGERLRVDGDQMIWAGYAFTRAQEPFKA
Ga0209647_103805013300026319Grasslands SoilVFWWEGGTLRAKVVGTKPGRGETTFERDGDAWRASAGRERGERLRIDGGRMVWSGYAFTRAQEPFKA
Ga0209579_1004271043300027869Surface SoilREFVFWWEESTLRAKVAGSPPGRGETTFARDGDGWVAAEGYERGERLLIRDGELVWSGYPFTRAQQQTRM
Ga0307306_1009388013300028782SoilNEFLFWWQGGALRAKFAAAPAGKGETEFERDGDGWRAARGRERGERLRVDGDQMIWAGYAFTRAQEPFKA
Ga0307289_1037219023300028875SoilETEFERDGDGWRAARGRERGERLRVDGDQMIWAGYAFTRAQEPFKA
Ga0265327_1009808933300031251RhizosphereWERGSLQAKVVGSPPGRGETTFERDGDGWVASAGRERGERVRVEDGLLVWAGYPFTRAQQPSTA
Ga0265316_1028941913300031344RhizosphereERGSLQAKVVGSPPGRGETTFERDGDGWVASAGRERGERVRVEDGLLVWAGYPFTRAQQPSTA
Ga0170818_10088619823300031474Forest SoilWEQGSLRAKVAGTQPGRGETTFARDGDGWIASAGRERGERLRVEGDQFVWAGYPFTRAQRPFSA
Ga0318555_1038703123300031640SoilRGETAFERDGDDWVAAEGRELGERLRIAGDELVWAGYPFTRTQQQTRA
Ga0307372_1016878433300031671SoilEHGALQAKVVGTPPGRGETTFERDGDGWRASVGRERGERLRVDDGRLVWAGYPFTRAQEPFKA
Ga0307373_1025591623300031672SoilAKLVGTPPGRGETTFERDGDGWRASVGRERGERLRVDDGRLVWAGYPFTRAQEPFKA
Ga0318566_1034753413300031779SoilGEGWLATAGRERGERLRVDGDRLIWAGYAFTRTQQPFPGGGQTAA
Ga0318511_1007403033300031845SoilGETTFERDGEGWLATAGRERGERLRVDGDRLIWAGYAFTRTQQPFPGGGQTAA
Ga0308175_10209799213300031938SoilTTFERDGDGWLAVKGRERGERLRIDGDRMIWAGYPFTRAQEPFVA
Ga0308174_1003947653300031939SoilRGETTFERDGEGWLAVKGRERGERLRIDGDRMIWAGYAFTRAQEPFKA
Ga0308176_1131978313300031996SoilAKLRGTPPGRGETRFEREGDGWVAAAGRELGERLRIDGAQVVWAGYPFTRDQQPFKA
Ga0318575_1021925513300032055SoilEGSEFLFWWEGGTLKARSVDALPGRGETTFERDGEGWLATAGRERGERLRVDGDRLIWAGYAFTRTQQPFPGGGQTAA
Ga0318513_1016312323300032065SoilEFLFWWEGGTLKARSVDALPGRGETTFERDGEGWLATAGRERGERLRVDGDRLIWAGYAFTRTQQPFPGGGQTAA
Ga0308173_1000781313300032074SoilAKVVGTAPGRAETTFERDGDGWRASAGRERGERLRVEDGQFVWAGYAFTRAQEPFKA
Ga0311301_1138818933300032160Peatlands SoilFEADGEGFRAVKGRERGERLRVDGDRLVWAGYLFTRGQQPSA
Ga0306920_10251580023300032261SoilFWWEGGTLKARIDAAPPGRGETTFERDGDGWVAAAGRERGERLRADGDRLIWAGYEFTRAQQPFPGGGQTTA
Ga0335082_1063106223300032782SoilAKVAGTPPGRAETTFERDGDGWRAAAGRERGERLRVDGDRMIWAGYAFTRAQEPFTA
Ga0335083_1017081633300032954SoilLEFVFWWENGALQAKVAGTPPGRAETTFERDGDGWRAAAGRERGERLRVDGDRMIWAGYAFTRAQEPFTA
Ga0335077_1074373813300033158SoilPGRAETTFERDGDGWRAAAGRERGERLRVDGDRMIWAGYAFTRAQEPFTA
Ga0335077_1143775813300033158SoilFEADGEGFRVVKGRERGERLRVDGDRLVWGGYLFTRSQQPMA
Ga0370501_0103657_788_9583300034195Untreated Peat SoilKVAGTPPGRGETTFERDGDGWRASAGRELGERLRVDGGQLVWSGYAFTRAQEPFKA
Ga0370501_0210352_2_1633300034195Untreated Peat SoilGTPPGRGETTFERDGDGWRASAGRELGERLRVDGGQLVWSGYAFTRAQEPFKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.