NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064965

Metagenome / Metatranscriptome Family F064965

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064965
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 56 residues
Representative Sequence MSHATKPARLPVAGRPQLARMPALIILAYAAAVYLLFLAVLGYAAGFFAGF
Number of Associated Samples 111
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.50 %
% of genes near scaffold ends (potentially truncated) 89.84 %
% of genes from short scaffolds (< 2000 bps) 92.19 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.344 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(42.188 % of family members)
Environment Ontology (ENVO) Unclassified
(46.094 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(39.844 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.04%    β-sheet: 0.00%    Coil/Unstructured: 56.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00196GerE 28.91
PF14833NAD_binding_11 12.50
PF07298NnrU 3.12
PF01039Carboxyl_trans 3.12
PF12697Abhydrolase_6 2.34
PF00005ABC_tran 1.56
PF00296Bac_luciferase 1.56
PF03446NAD_binding_2 0.78
PF00561Abhydrolase_1 0.78
PF10011DUF2254 0.78
PF13413HTH_25 0.78
PF07676PD40 0.78
PF13649Methyltransf_25 0.78
PF02518HATPase_c 0.78
PF02738MoCoBD_1 0.78
PF08241Methyltransf_11 0.78
PF01197Ribosomal_L31 0.78
PF08031BBE 0.78
PF01850PIN 0.78
PF04978DUF664 0.78
PF13602ADH_zinc_N_2 0.78
PF12695Abhydrolase_5 0.78
PF05222AlaDh_PNT_N 0.78
PF00583Acetyltransf_1 0.78
PF00293NUDIX 0.78
PF03795YCII 0.78
PF13847Methyltransf_31 0.78
PF13561adh_short_C2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 3.12
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 3.12
COG4094Uncharacterized membrane proteinFunction unknown [S] 3.12
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 3.12
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.56
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 0.78
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.78
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.34 %
UnclassifiedrootN/A22.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005162|Ga0066814_10110997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2523Open in IMG/M
3300005166|Ga0066674_10489383Not Available556Open in IMG/M
3300005333|Ga0070677_10444798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300005337|Ga0070682_101714938Not Available546Open in IMG/M
3300005338|Ga0068868_100338238All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300005434|Ga0070709_10288199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1195Open in IMG/M
3300005434|Ga0070709_11041051All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005434|Ga0070709_11187194Not Available613Open in IMG/M
3300005434|Ga0070709_11242872All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005435|Ga0070714_101624328All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005436|Ga0070713_101628437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300005436|Ga0070713_101628577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300005437|Ga0070710_10102911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1704Open in IMG/M
3300005439|Ga0070711_100739639Not Available830Open in IMG/M
3300005439|Ga0070711_101595549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300005451|Ga0066681_10381910Not Available866Open in IMG/M
3300005456|Ga0070678_100761620All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300005466|Ga0070685_10899533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300005529|Ga0070741_10737189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300005563|Ga0068855_100724500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1062Open in IMG/M
3300005995|Ga0066790_10013189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3650Open in IMG/M
3300006175|Ga0070712_101297058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300006175|Ga0070712_101384909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300006237|Ga0097621_102398204Not Available505Open in IMG/M
3300006573|Ga0074055_11862153Not Available598Open in IMG/M
3300006575|Ga0074053_11680296All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300006954|Ga0079219_10467031All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300009088|Ga0099830_11399244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300009545|Ga0105237_11221996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia758Open in IMG/M
3300010361|Ga0126378_10012836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6955Open in IMG/M
3300010366|Ga0126379_12563865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300010375|Ga0105239_11193202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300010396|Ga0134126_12473771Not Available565Open in IMG/M
3300010397|Ga0134124_11478488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300010401|Ga0134121_10866815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300011119|Ga0105246_10169608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1670Open in IMG/M
3300012210|Ga0137378_11091951Not Available712Open in IMG/M
3300012961|Ga0164302_11039400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300013296|Ga0157374_11310318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300014969|Ga0157376_12246997Not Available584Open in IMG/M
3300015265|Ga0182005_1225856Not Available571Open in IMG/M
3300016270|Ga0182036_10424475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1041Open in IMG/M
3300016294|Ga0182041_11240695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia681Open in IMG/M
3300016319|Ga0182033_11392681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300016341|Ga0182035_10614960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia940Open in IMG/M
3300016422|Ga0182039_12036619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300017974|Ga0187777_11164897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300017975|Ga0187782_10832263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300018058|Ga0187766_10951968Not Available609Open in IMG/M
3300018060|Ga0187765_10741516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300018090|Ga0187770_11004706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300018433|Ga0066667_12273189Not Available507Open in IMG/M
3300019877|Ga0193722_1007040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2829Open in IMG/M
3300020582|Ga0210395_11043592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300021171|Ga0210405_11278389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300021401|Ga0210393_11186388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300021407|Ga0210383_11443625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300021560|Ga0126371_11860459Not Available722Open in IMG/M
3300024331|Ga0247668_1054913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300025910|Ga0207684_10094278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2553Open in IMG/M
3300025915|Ga0207693_10688577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300025916|Ga0207663_10973300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300025931|Ga0207644_11064848Not Available679Open in IMG/M
3300025936|Ga0207670_10660944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae862Open in IMG/M
3300025941|Ga0207711_10949194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300026121|Ga0207683_10041847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4001Open in IMG/M
3300027029|Ga0208731_1017507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300027703|Ga0207862_1035655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → Anaeromyxobacter diazotrophicus1497Open in IMG/M
3300027855|Ga0209693_10517471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300027889|Ga0209380_10499245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300028379|Ga0268266_11593619Not Available628Open in IMG/M
3300028828|Ga0307312_10029118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae3206Open in IMG/M
3300031543|Ga0318516_10000383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13356Open in IMG/M
3300031544|Ga0318534_10484560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300031544|Ga0318534_10563051Not Available649Open in IMG/M
3300031564|Ga0318573_10222079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1004Open in IMG/M
3300031572|Ga0318515_10470067All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300031572|Ga0318515_10531006Not Available627Open in IMG/M
3300031640|Ga0318555_10536838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300031640|Ga0318555_10766480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300031668|Ga0318542_10740227Not Available515Open in IMG/M
3300031681|Ga0318572_10533520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300031682|Ga0318560_10103420Not Available1476Open in IMG/M
3300031724|Ga0318500_10166022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1045Open in IMG/M
3300031747|Ga0318502_10701114All Organisms → cellular organisms → Bacteria → Proteobacteria612Open in IMG/M
3300031751|Ga0318494_10541697Not Available679Open in IMG/M
3300031764|Ga0318535_10122033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300031768|Ga0318509_10751707Not Available540Open in IMG/M
3300031771|Ga0318546_10178102All Organisms → cellular organisms → Bacteria → Terrabacteria group1444Open in IMG/M
3300031778|Ga0318498_10196379Not Available916Open in IMG/M
3300031779|Ga0318566_10627516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300031781|Ga0318547_10610480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300031782|Ga0318552_10303023Not Available812Open in IMG/M
3300031782|Ga0318552_10450536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia657Open in IMG/M
3300031793|Ga0318548_10400785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia673Open in IMG/M
3300031796|Ga0318576_10278668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300031797|Ga0318550_10208381All Organisms → cellular organisms → Bacteria → Terrabacteria group947Open in IMG/M
3300031798|Ga0318523_10451618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300031798|Ga0318523_10685430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300031805|Ga0318497_10193055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1123Open in IMG/M
3300031821|Ga0318567_10089352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1654Open in IMG/M
3300031831|Ga0318564_10151432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1034Open in IMG/M
3300031835|Ga0318517_10056564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1655Open in IMG/M
3300031835|Ga0318517_10235920Not Available825Open in IMG/M
3300031846|Ga0318512_10230952Not Available910Open in IMG/M
3300031860|Ga0318495_10147250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1062Open in IMG/M
3300031860|Ga0318495_10444427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031879|Ga0306919_10678563Not Available794Open in IMG/M
3300031880|Ga0318544_10190855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300031894|Ga0318522_10065522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1306Open in IMG/M
3300031910|Ga0306923_10056769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4337Open in IMG/M
3300031910|Ga0306923_11718203All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300031941|Ga0310912_10391174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300031945|Ga0310913_10276650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1182Open in IMG/M
3300031945|Ga0310913_10532004Not Available834Open in IMG/M
3300032009|Ga0318563_10253340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia951Open in IMG/M
3300032010|Ga0318569_10237780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia846Open in IMG/M
3300032010|Ga0318569_10359442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300032041|Ga0318549_10329705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300032043|Ga0318556_10362268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia758Open in IMG/M
3300032055|Ga0318575_10372154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300032065|Ga0318513_10359633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300032076|Ga0306924_10074275Not Available3801Open in IMG/M
3300032076|Ga0306924_11273443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300032094|Ga0318540_10150952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1113Open in IMG/M
3300032805|Ga0335078_10153917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3249Open in IMG/M
3300032896|Ga0335075_10671532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1004Open in IMG/M
3300033290|Ga0318519_10471927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil42.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.34%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066814_1011099713300005162SoilMSHATKPVRLLVAGRPQPARIPALVILVYAAAVYLFFLAVLGYAAGFFAGFGVPKGIDQG
Ga0066674_1048938313300005166SoilMSHATEPARLPRSVQRPQRASVPALIILAYAVAVYLFFLAVLGYAAGFFAGLGVPKGIDQ
Ga0070677_1044479813300005333Miscanthus RhizosphereMSHTTKPAGLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFA
Ga0070682_10171493813300005337Corn RhizosphereMSHTSKPARRAVAGRPQRARMPALIILVYAVVVYLLFLVV
Ga0068868_10033823813300005338Miscanthus RhizosphereMSHTTKPARLRVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGV
Ga0070709_1028819923300005434Corn, Switchgrass And Miscanthus RhizosphereMSHTTKPARLPVAGRSQQARTPALIIVVYAVVVYLLFLVVLCYAAGF
Ga0070709_1104105123300005434Corn, Switchgrass And Miscanthus RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQG
Ga0070709_1118719413300005434Corn, Switchgrass And Miscanthus RhizosphereMSHATEPAGLPRSVQRPQRASVPALIILAYAVAVYLFFLAVLGYAAGFFA
Ga0070709_1124287223300005434Corn, Switchgrass And Miscanthus RhizosphereMSHTTKPARLPVAGRPQRARTPALIIVVYAVVVYLLFVVVLGYAAGFFAGFGVPKGIDQGSRAA
Ga0070714_10162432823300005435Agricultural SoilMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGVP
Ga0070713_10162843723300005436Corn, Switchgrass And Miscanthus RhizosphereMSHTTRPARLAVAGRPQQARMPALLIVVYAVVVYLLFVVVLCYAAGFFAGFGVPKGIDDGSR
Ga0070713_10162857723300005436Corn, Switchgrass And Miscanthus RhizosphereMSHTTKPARLPVAGRSQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFA
Ga0070710_1010291133300005437Corn, Switchgrass And Miscanthus RhizosphereMSHTIQPARLPVAERGRRTGMPAQFILVYAAAVYMFFLAVLGYAAGFFA
Ga0070711_10073963913300005439Corn, Switchgrass And Miscanthus RhizosphereMSHTTRPARLAVAGRPQQARMPALLIVVYAVVVYLLFVVVLCYAAGFFA
Ga0070711_10159554923300005439Corn, Switchgrass And Miscanthus RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGV
Ga0066681_1038191013300005451SoilMSHTTKSARLPVAGHPQQARMPALIILVYAVVVYLLFLVV
Ga0070678_10076162013300005456Miscanthus RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGV
Ga0070685_1089953323300005466Switchgrass RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFF
Ga0070741_1073718923300005529Surface SoilMSHATKPARLPVAGRPQLARMPALIILAYAAAVYLLFLAVLGYAAGFFAGF
Ga0068855_10072450013300005563Corn RhizosphereMSHTTKPARLAVAGRPQRARMPALIILVYAIVVYLLFLVVLGYA
Ga0066790_1001318973300005995SoilMSHTTEPARLLVAERPQLARVPALIVLGYAVVVYLLWLAVLGYAAGFF
Ga0070712_10129705823300006175Corn, Switchgrass And Miscanthus RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAA
Ga0070712_10138490913300006175Corn, Switchgrass And Miscanthus RhizosphereMSNTTKPARLPVAGRSQQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFA
Ga0097621_10239820423300006237Miscanthus RhizosphereMSHTSKPARRAVAGRPQRARMPALIILVYAVVVYLLFLVVL
Ga0074055_1186215323300006573SoilMSHATKPARLLVAGRPQPARIPALVILVYAAAVYLFFLAVLGYAAGFFAGFGVPKGIDQG
Ga0074053_1168029623300006575SoilMSHATKPVRLLVAGRPQPARIPALVILVYAAAVYLFFLAVLGYAAGFFAGFGVPKGIDQGTR
Ga0079219_1046703113300006954Agricultural SoilMSHATEPARLPRSVQRPQRARVPALIILAYAVAMYLFFLAVLGYAAGFFAGLGVPKGI
Ga0099830_1139924413300009088Vadose Zone SoilMSHATKSVRPRVAVRHPSLASISALLNLLYAAAVYLFFIVMLGYAVGFFIGFGVPKGI
Ga0105237_1122199623300009545Corn RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQG
Ga0126378_1001283613300010361Tropical Forest SoilMSHATKPARLPEAERAQPARMPALIIVGYAAAVYLLYLAVLGYAVGFFAGAGVPKGIDQGPR
Ga0126379_1256386513300010366Tropical Forest SoilMSHATKPARLLAAERAQPARIPALIILVYAAAVYLLFLAVLGYAVGFFAGFGVPK
Ga0105239_1119320213300010375Corn RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVV
Ga0134126_1247377123300010396Terrestrial SoilMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGVPA
Ga0134124_1147848823300010397Terrestrial SoilMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGVPA
Ga0134121_1086681513300010401Terrestrial SoilMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAG
Ga0105246_1016960813300011119Miscanthus RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGF
Ga0137378_1109195113300012210Vadose Zone SoilMSHTTKPARLPVAGRPQQARVPALIILVYAVVVYLLFLVVLGYAAGFFAGFGVPKGIDQGSRAAVPVAV
Ga0164302_1103940013300012961SoilMSHTTQPARLPVAGRPQQARTPALIIVAYAVVVYLLFLVVFCYAAGFFAGFGVPKGIDQ
Ga0157374_1131031813300013296Miscanthus RhizosphereMSHTTQPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGVPAAV
Ga0157376_1224699713300014969Miscanthus RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVEF
Ga0182005_122585613300015265RhizosphereMSYATKPAGLPRSVQHRQRAGGPALIILAYAVAVYLFFLAVLGYAAAFFAGRGV
Ga0182036_1042447513300016270SoilMSHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGID
Ga0182041_1124069533300016294SoilMSHTTKPARLPVAGRPQLARMPALIILVYAVAAYLLLLAVLGYAAGFFAGFGVPTGIDQGPRAAVLPAA
Ga0182033_1139268123300016319SoilMSHATKPARLPVAGRPQPARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVG
Ga0182035_1061496023300016341SoilMSHTTKPARLPVAGRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVLTASTRAARR
Ga0182039_1203661923300016422SoilMPHATQPARPLAGAERPQPAGKPALIILVYAAAVYLLFLAVLVYAVGFFAGLGVPKES
Ga0187777_1116489713300017974Tropical PeatlandMSHVTKPTSFPVAGHPQRARVPARIILAYAVAVYLVFLAVLGYAAGFFAGLDVPKGIDQGPHAAVPVAT
Ga0187782_1083226323300017975Tropical PeatlandMSRVTEPAGPVADVRRPQLASLPSLAIAVYAAAVYLFFLAVLGYTVGFFAGVGVPK
Ga0187766_1095196823300018058Tropical PeatlandMSHATLPARPLAGVQRVRPRVPALIVVVYAAAVYLIFLAVLGYAVGFF
Ga0187765_1074151623300018060Tropical PeatlandMSHATKPTSFPVAEHPQRARVPARIILAYAVAVYLVFLAVLGYAAGFFAGLDVPKGIDQGPHAAVPVATGID
Ga0187770_1100470623300018090Tropical PeatlandMSRATEPAGPVADVQRPQLASLPSLAIAVYAAAVYLFFLAVLGYTVGFFADFGVPKGIDQGPRATVPAAVAI
Ga0066667_1227318913300018433Grasslands SoilMSHATQSARLPVAERPQRAKMPALFILVYAAAVYLFFLAVLGYAVGFFAGLGVPKGIDQGTRAALP
Ga0193722_100704013300019877SoilMSHTTKPARLAVAGRPQRARMPALIILVYAVVVYLLF
Ga0210395_1104359213300020582SoilMSHATNPVRLLVAERARLARMPALIIVVYAVAAYRLFLAVLGYAVGS
Ga0210405_1127838913300021171SoilMSHTTKPARLPVTGRPQQARMPALIILVYAAVVYLLFL
Ga0210393_1118638813300021401SoilMSRVTKPARLQGAGRPQLARLPALVILLYAAAVYLLFLGVLGYAAGFFAGFGVPKGID
Ga0210383_1144362523300021407SoilMSYATKPARLPVAERLQPARMPALITLVYAAAVYLFFLAVLGYTVGFF
Ga0126371_1186045913300021560Tropical Forest SoilMSHAAKPDLLVVAGHPRSARVPALIILVYAAAVYLFFVAVLGYASAFLAGLGVSKGIDQGPRTAGPAAVAI
Ga0247668_105491313300024331SoilMSHTTKPARLPVAGRPPQARTPALIIVVYAVVVYLIFLVVLCYAA
Ga0207684_1009427813300025910Corn, Switchgrass And Miscanthus RhizosphereMSHTTGSARLPVAGRPQRAGTPALVIVAYAVAVYLLLLAVFGC
Ga0207693_1068857713300025915Corn, Switchgrass And Miscanthus RhizosphereMSQTTKRARLPVAGRAQQARMPALIILVYAAVVYL
Ga0207663_1097330013300025916Corn, Switchgrass And Miscanthus RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRA
Ga0207644_1106484823300025931Switchgrass RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGAPA
Ga0207670_1066094413300025936Switchgrass RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGVPAAVA
Ga0207711_1094919423300025941Switchgrass RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFA
Ga0207683_1004184743300026121Miscanthus RhizosphereMSHTTKPARLPVAGRPQQARTPALIIVVYAVVVYLLFLVVFCYAAG
Ga0208731_101750713300027029Forest SoilMSHATNPVRLLVAERARLARMPALIIVVYAVAAYRLFLAVL
Ga0207862_103565513300027703Tropical Forest SoilMSYATKPARLLVAGRPVRASVPARIILAYAAAVYLFFLAVLGYAAGFF
Ga0209693_1051747123300027855SoilMSCPVKPARPPAAVPDRRAARLPARFILGYAVAVYLFFLAVLGYAAGFFADLGVPRG
Ga0209380_1049924513300027889SoilMSHATNPVRLLLAERAQLARMPALIIVVYAAAVYLLFLAVLGYAVGFSAGFGV
Ga0268266_1159361913300028379Switchgrass RhizosphereMSHTTQPARLPVAGRPQQARTPALIIAVYAVVVYLLFLVVLCYAAGFFAGFGVPKGIDQGSRAGMPAAVA
Ga0307312_1002911813300028828SoilMSHGTKPARLLVAGRPQPTRMPALVILVYAAAVYLFFLAALGYAAGFFAGFGVPKGIDQGTRA
Ga0318516_1000038353300031543SoilMAHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGID
Ga0318534_1048456013300031544SoilMTHATKLARLPAAQRPQLARMDTLIILVYSVAAYLLFVAVLGYAAGFFAGFGVPTAHPCRPAAA
Ga0318534_1056305113300031544SoilMSHATRSAEPRTGAQRPQLASVPALIIMVYAAAVYLFFLAVLGYAVGFFADFG
Ga0318573_1022207913300031564SoilCRGIAHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGI
Ga0318515_1047006723300031572SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVPTAST
Ga0318515_1053100613300031572SoilMSHAAKPDLLVVAGHPRSARVPALIILVYAAAVYLFFVAVLGYAVGFFAGLGVSRSIDQGPRAAG
Ga0318555_1053683813300031640SoilMSHATKPARPVGAAGRRAPARMPALIILAYAVAVYLFFLAVLGYAAGFFADFGVPKGIG
Ga0318555_1076648023300031640SoilMSQATRPARLPEPRRAPSASRPAPIIVGYAAAVYLLFVALLGYSVGFFADAGVPKGIDQG
Ga0318542_1074022713300031668SoilMSHATKPAGSLADVQRPQLARIPALIILAYAAAVYLFFLAVLGYAAGFFAGLGVPK
Ga0318572_1053352023300031681SoilMSQATKPARPLAAERPQLASMPAPVISLYAAAVYLLFLGVLCYSVGFFADFGVPKGIDQG
Ga0318560_1010342023300031682SoilMSQATRQVRLPEHGRAQSARVPAPIIAAYAAAVYLLFLAVLCYAVGFFANAGVPKGINQG
Ga0318500_1016602223300031724SoilMSQATRQVRLPEHGRAQSARVPAPIIAAYAAAVYLLFLAVLCYAVGFFANAGVPKGINQGPRAAVPVA
Ga0318502_1070111423300031747SoilMTHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFF
Ga0318494_1054169713300031751SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFTGFGVPTASTRGAAPLRRAAQLGLMS
Ga0318535_1012203313300031764SoilHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGID
Ga0318509_1075170713300031768SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVPTASTRGRAPLGRAAQLGLM
Ga0318546_1017810213300031771SoilMSHATKPAGSLADVQRPQLARIPALIILAYAAAVYLFFLAVLGYAAGFFAGLGVPKGID
Ga0318498_1019637913300031778SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVPTASTRGRAPLGRAAQLGLMSGSA
Ga0318566_1062751623300031779SoilMTHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFTGFGVPTASTRGAARR
Ga0318547_1061048013300031781SoilMSQPTRQVCLPEPGSAQSARTPARIILVYAAAIYLFFLAVLGYAVGFFADVGVPKGIDQGPHAAVPVAAGID
Ga0318552_1030302313300031782SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFTGFGVPTASTRGPRR
Ga0318552_1045053633300031782SoilMSHTTKPARLPVAGRPQLARMPALIILVYAVAAYLLLLAVLGYAAGFF
Ga0318548_1040078513300031793SoilMSHATKPARLPVAGRPQPARMPALIILGYAVAVYLIFLAMLGYAVGF
Ga0318576_1027866813300031796SoilMSHATKPARLRMAGRQRSARMPALIILGYAVAVYLIFLAILGYAVGFFAG
Ga0318550_1020838133300031797SoilMSHATKPAGSLADVQRPQLARIPALIILAYAAAVYLFFLAVLGYAAGFFAGLG
Ga0318523_1045161823300031798SoilMSQATKPARPLAAERPQLASMPAPVIVLYAAAAYLLFLGVLGYAVGFFADFGVPKGIDQGPRGAAPVAVG
Ga0318523_1068543023300031798SoilMSHATKPARLPDAAARPQPARMTALILLVYAVVVYLLF
Ga0318497_1019305523300031805SoilMSHATKPARLLVAERPQRARVPAGTILAYAAGVYLFFLAVLGYVAGFFA
Ga0318567_1008935213300031821SoilMSHATKPARLLAGAERPPRASMPALIILVYAAAVYLLFLAVLGYAVGFFAGF
Ga0318564_1015143213300031831SoilMSQATRQVRLPEHGRAQSARVPAPIIAAYAAAVYLLFLAVLCYAVGFFANAGVPKGINQGPRAAVP
Ga0318517_1005656413300031835SoilAHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGID
Ga0318517_1023592013300031835SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAA
Ga0318512_1023095223300031846SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVPTASTRGRAPLGRAAQLGLMSG
Ga0318495_1014725023300031860SoilMPHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFTGFGVPTASTRGAARR
Ga0318495_1044442723300031860SoilMSHTTKPARLPVAGRPQLARMPALIILVYAVAAYLLLLAMLG
Ga0306919_1067856323300031879SoilMSHATKPAGSLADVQRPQLARIPALIILAYAAAVYLFFLAVLGYAAGFFAGLGVPKGIDQ
Ga0318544_1019085523300031880SoilMSHTTKPARLPVAGRPQLARMPALIILVYAVAAYLLLLAVLGYAAGFFAGFGVPTGIDQGPRAAVLPAAAIDLLLL
Ga0318522_1006552233300031894SoilARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGID
Ga0306923_1005676953300031910SoilMSQATRQVRLPEHGRAQSARVPAPIIAAYAAAVYLLFLAVLCYAVGFFANA
Ga0306923_1171820313300031910SoilMTHATKPARLPAAQRSQLARMPALIILVYSVAAYLLFAAVLGYA
Ga0310912_1039117423300031941SoilMTHATKPARLPAAQRSQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGVGVPTASTRGARR
Ga0310913_1027665013300031945SoilMTHATKPARLPAAQRSQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVLTASTRAARR
Ga0310913_1053200423300031945SoilMSHATKPAGSLADVQRPQLARIPALIILAYAAAVYLFFLAVLGYAAGFFAGLGVPKGIDQGTRAAVPVA
Ga0318563_1025334013300032009SoilMSHATKPARLLVAERPQRARVPAGTILAYAAGVYLFFLAVLGYAAGFFAGFGVPKGID
Ga0318569_1023778033300032010SoilMSHTTKPARLPVAGRPQLARMPALIILVYAVAAYLLLLAVLGYAAGFFAGFGVPT
Ga0318569_1035944223300032010SoilMSQATRQARLPEPGRAQPARMPAPIIVVYAAAVYLLFLAVLGYAVGFFAD
Ga0318549_1032970513300032041SoilMSQATRQARFAEPGRAQSARMPAPIIAVYAAAVYLLFLAVLGYAVGFFANAG
Ga0318556_1036226823300032043SoilMSQPTRQVCLPEPGSAQSARTPARIILVYAAAIYLFFLAVLGYAVGFFADVGVPKGIDQGPHA
Ga0318575_1037215413300032055SoilCRGMAHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGI
Ga0318513_1035963323300032065SoilMSQATRQARFAEPGRAQSARMPAPIIAVYAAAVYLLFLAVLGYAVGFFANAGVPKGI
Ga0306924_1007427513300032076SoilMSHATKPARLLVAERPQRARVPAGTILAYAAGVYLFFLAVLGYAAGFFAG
Ga0306924_1127344323300032076SoilMSHATKPARPVGAAGRRPPARMPALIILAYAVAVYLFFLAVLGYAAGFFADFGVP
Ga0318540_1015095223300032094SoilMAHATKPARLLVAGRPQSARMPALIILGYAVAVYLIFLAMLGYAVGFFAGVGVPKGI
Ga0335078_1015391713300032805SoilMSHAAKPDLLVVAGHPRSARVPAPIILVYAAAVYLFFVAVLGYAAGFFADLGVSKGIDQGPRTAGPAR
Ga0335075_1067153223300032896SoilMTNQKCHARATRPIRLRVAERAQLAKMPPLIIVVYTAAVYLLFLAVLGYAVGFFAGFGVPKGID
Ga0318519_1047192713300033290SoilMTHATKPARLPAAQRPQLARMPALIILVYSVAAYLLFAAVLGYAAGFFAGFGVPTASTRGAARR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.