| Basic Information | |
|---|---|
| Family ID | F064939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RRLGRYGDARALLRDTVDRLERILPDGDPLITELRQSLADIGDE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.84 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.312 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.031 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF13374 | TPR_10 | 4.69 |
| PF00196 | GerE | 4.69 |
| PF01638 | HxlR | 3.91 |
| PF00270 | DEAD | 3.91 |
| PF00106 | adh_short | 3.12 |
| PF00440 | TetR_N | 2.34 |
| PF01625 | PMSR | 2.34 |
| PF08044 | DUF1707 | 2.34 |
| PF00487 | FA_desaturase | 2.34 |
| PF02861 | Clp_N | 2.34 |
| PF07690 | MFS_1 | 2.34 |
| PF13671 | AAA_33 | 1.56 |
| PF01244 | Peptidase_M19 | 1.56 |
| PF13469 | Sulfotransfer_3 | 1.56 |
| PF00797 | Acetyltransf_2 | 1.56 |
| PF00248 | Aldo_ket_red | 1.56 |
| PF00903 | Glyoxalase | 1.56 |
| PF04199 | Cyclase | 1.56 |
| PF00144 | Beta-lactamase | 0.78 |
| PF01202 | SKI | 0.78 |
| PF01212 | Beta_elim_lyase | 0.78 |
| PF00004 | AAA | 0.78 |
| PF03631 | Virul_fac_BrkB | 0.78 |
| PF02151 | UVR | 0.78 |
| PF07687 | M20_dimer | 0.78 |
| PF13424 | TPR_12 | 0.78 |
| PF08376 | NIT | 0.78 |
| PF08240 | ADH_N | 0.78 |
| PF12697 | Abhydrolase_6 | 0.78 |
| PF07311 | Dodecin | 0.78 |
| PF02467 | Whib | 0.78 |
| PF04545 | Sigma70_r4 | 0.78 |
| PF13537 | GATase_7 | 0.78 |
| PF00326 | Peptidase_S9 | 0.78 |
| PF16864 | Dimerisation2 | 0.78 |
| PF13185 | GAF_2 | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF04542 | Sigma70_r2 | 0.78 |
| PF00072 | Response_reg | 0.78 |
| PF13191 | AAA_16 | 0.78 |
| PF02604 | PhdYeFM_antitox | 0.78 |
| PF13561 | adh_short_C2 | 0.78 |
| PF01145 | Band_7 | 0.78 |
| PF12802 | MarR_2 | 0.78 |
| PF08281 | Sigma70_r4_2 | 0.78 |
| PF12680 | SnoaL_2 | 0.78 |
| PF01546 | Peptidase_M20 | 0.78 |
| PF13522 | GATase_6 | 0.78 |
| PF12029 | DUF3516 | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF01042 | Ribonuc_L-PSP | 0.78 |
| PF14246 | TetR_C_7 | 0.78 |
| PF01494 | FAD_binding_3 | 0.78 |
| PF13466 | STAS_2 | 0.78 |
| PF13377 | Peripla_BP_3 | 0.78 |
| PF00005 | ABC_tran | 0.78 |
| PF00652 | Ricin_B_lectin | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.91 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 2.34 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 2.34 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 2.34 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 2.34 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.56 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.56 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.56 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.78 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.78 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.78 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.78 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.78 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.78 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.78 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.78 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.78 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.78 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.78 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.78 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.78 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.78 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.78 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.78 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.78 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.78 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.78 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.78 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.78 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.78 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.31 % |
| Unclassified | root | N/A | 4.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100351988 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100420350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1215 | Open in IMG/M |
| 3300003368|JGI26340J50214_10148327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300005332|Ga0066388_101655849 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005332|Ga0066388_102219786 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005332|Ga0066388_103137164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 844 | Open in IMG/M |
| 3300005434|Ga0070709_10899223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300005435|Ga0070714_102143883 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005458|Ga0070681_11948811 | Not Available | 515 | Open in IMG/M |
| 3300005602|Ga0070762_10795179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300005610|Ga0070763_10112096 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300006028|Ga0070717_10103333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2422 | Open in IMG/M |
| 3300006176|Ga0070765_100088390 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
| 3300009038|Ga0099829_10776600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
| 3300009137|Ga0066709_104543278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300009525|Ga0116220_10518912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300009631|Ga0116115_1146930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300009762|Ga0116130_1106067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 883 | Open in IMG/M |
| 3300010048|Ga0126373_12146795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300010048|Ga0126373_13161867 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010366|Ga0126379_11842915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. Ae706_Ps2 | 709 | Open in IMG/M |
| 3300010373|Ga0134128_10376040 | Not Available | 1587 | Open in IMG/M |
| 3300010376|Ga0126381_102406821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
| 3300010398|Ga0126383_12994576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300013104|Ga0157370_10269269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1574 | Open in IMG/M |
| 3300014153|Ga0181527_1286053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300016341|Ga0182035_10909799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300016357|Ga0182032_10595547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300016387|Ga0182040_11057812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300016422|Ga0182039_12176170 | Not Available | 511 | Open in IMG/M |
| 3300016445|Ga0182038_11135079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300017975|Ga0187782_10094597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2196 | Open in IMG/M |
| 3300018006|Ga0187804_10570595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300018017|Ga0187872_10435221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus atacamensis | 551 | Open in IMG/M |
| 3300018021|Ga0187882_1154961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 928 | Open in IMG/M |
| 3300018034|Ga0187863_10116531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
| 3300018037|Ga0187883_10015451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4253 | Open in IMG/M |
| 3300018040|Ga0187862_10049144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3075 | Open in IMG/M |
| 3300018046|Ga0187851_10132481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1522 | Open in IMG/M |
| 3300018047|Ga0187859_10165129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1176 | Open in IMG/M |
| 3300018047|Ga0187859_10305314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
| 3300020581|Ga0210399_11046803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300020582|Ga0210395_10188896 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300021170|Ga0210400_10335483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1244 | Open in IMG/M |
| 3300021180|Ga0210396_10110964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2477 | Open in IMG/M |
| 3300021181|Ga0210388_10640463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium HGW-Actinobacteria-4 | 928 | Open in IMG/M |
| 3300021388|Ga0213875_10214104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300021401|Ga0210393_11548228 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021404|Ga0210389_10765282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
| 3300021406|Ga0210386_11440095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300021420|Ga0210394_10808126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300021420|Ga0210394_11496297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300021433|Ga0210391_10076134 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300021433|Ga0210391_10981373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
| 3300021559|Ga0210409_10392903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
| 3300025633|Ga0208480_1001715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7881 | Open in IMG/M |
| 3300025633|Ga0208480_1120770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300025928|Ga0207700_10827931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300025929|Ga0207664_11173202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300027517|Ga0209113_1048652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300027855|Ga0209693_10092995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1491 | Open in IMG/M |
| 3300027855|Ga0209693_10428331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300027895|Ga0209624_10856941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300027895|Ga0209624_10938419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300028877|Ga0302235_10136554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1099 | Open in IMG/M |
| 3300028906|Ga0308309_11380232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300029913|Ga0311362_10142603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2954 | Open in IMG/M |
| 3300029920|Ga0302142_1111283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 846 | Open in IMG/M |
| 3300029943|Ga0311340_10026728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 7138 | Open in IMG/M |
| 3300029943|Ga0311340_10472144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1129 | Open in IMG/M |
| 3300029944|Ga0311352_10812097 | Not Available | 730 | Open in IMG/M |
| 3300029994|Ga0302283_1259630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300029999|Ga0311339_11951518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300030007|Ga0311338_11098615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 763 | Open in IMG/M |
| 3300030057|Ga0302176_10153512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300030399|Ga0311353_10651743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300030580|Ga0311355_10694153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 947 | Open in IMG/M |
| 3300030763|Ga0265763_1022798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300030814|Ga0265741_112527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300030997|Ga0073997_12228370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300031544|Ga0318534_10304748 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300031640|Ga0318555_10394966 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031668|Ga0318542_10111065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 1333 | Open in IMG/M |
| 3300031680|Ga0318574_10667425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora tropica | 609 | Open in IMG/M |
| 3300031682|Ga0318560_10083305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 1634 | Open in IMG/M |
| 3300031708|Ga0310686_106969320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6251 | Open in IMG/M |
| 3300031708|Ga0310686_108148400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 580 | Open in IMG/M |
| 3300031715|Ga0307476_10440875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300031719|Ga0306917_11418318 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031723|Ga0318493_10357660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300031724|Ga0318500_10645463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora rosea | 538 | Open in IMG/M |
| 3300031748|Ga0318492_10355947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 766 | Open in IMG/M |
| 3300031751|Ga0318494_10696955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300031751|Ga0318494_10751294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031754|Ga0307475_11396647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300031782|Ga0318552_10727301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora rosea | 506 | Open in IMG/M |
| 3300031792|Ga0318529_10440272 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031796|Ga0318576_10363769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527 | 683 | Open in IMG/M |
| 3300031797|Ga0318550_10458738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300031805|Ga0318497_10293602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300031860|Ga0318495_10078659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300031879|Ga0306919_10132323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1799 | Open in IMG/M |
| 3300031910|Ga0306923_11004788 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031910|Ga0306923_11485344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300031941|Ga0310912_11206146 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031947|Ga0310909_11222467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300031959|Ga0318530_10380727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300032025|Ga0318507_10197704 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300032043|Ga0318556_10312368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300032043|Ga0318556_10598295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300032044|Ga0318558_10156844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1098 | Open in IMG/M |
| 3300032055|Ga0318575_10264878 | Not Available | 868 | Open in IMG/M |
| 3300032063|Ga0318504_10102065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 1285 | Open in IMG/M |
| 3300032063|Ga0318504_10390444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300032066|Ga0318514_10282048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300032074|Ga0308173_11223632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 702 | Open in IMG/M |
| 3300032805|Ga0335078_12542342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 527 | Open in IMG/M |
| 3300032895|Ga0335074_10554598 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300032896|Ga0335075_11165246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300032898|Ga0335072_11803946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300032954|Ga0335083_10562356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 945 | Open in IMG/M |
| 3300032955|Ga0335076_10162570 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300033134|Ga0335073_10020490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9215 | Open in IMG/M |
| 3300033134|Ga0335073_10350290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
| 3300033134|Ga0335073_10430751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1531 | Open in IMG/M |
| 3300033134|Ga0335073_10457944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1471 | Open in IMG/M |
| 3300033134|Ga0335073_11222134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300033134|Ga0335073_11734263 | Not Available | 587 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1003519883 | 3300002245 | Forest Soil | RAELALVYRQLGRYGDARALLRDTIDRLDRILPRHDPLIVELREVLADIGDE* |
| JGIcombinedJ26739_1004203501 | 3300002245 | Forest Soil | GDIRALLRDTVHRLERTLPEGDPLIIELRQSLAGIGEQ* |
| JGI26340J50214_101483272 | 3300003368 | Bog Forest Soil | RLGRYGDARALLRNTLDRLERILPDDDPLITELRESLADIGDE* |
| Ga0066388_1016558493 | 3300005332 | Tropical Forest Soil | LAQVYSRLGRYGDARVLLRDTVDRLERTLPDGDPLITELRDSLADIGDE* |
| Ga0066388_1022197862 | 3300005332 | Tropical Forest Soil | YGDARALLRDTVNRLESTLPKNDPLIRELRESLADIGEE* |
| Ga0066388_1031371641 | 3300005332 | Tropical Forest Soil | YGDARVLLRDTVDRLERTLPEDDPLIRELREDLADIGEE* |
| Ga0070709_108992231 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GRYGDARALLRDTVDRLDRILPPGDPLITDLRAILADIGDE* |
| Ga0070714_1021438831 | 3300005435 | Agricultural Soil | LALVYSRLGRYGDARALLRDTVGRLEHLLPPHDPLISELREVLSDIGDE* |
| Ga0070681_119488111 | 3300005458 | Corn Rhizosphere | LARVYHKLGRYGDARALLLNTVNRLQRILSDDDPLILELREILADIGDE* |
| Ga0070762_107951792 | 3300005602 | Soil | LARVYSRLGRYGDARALLRDTVGRLQRILPPHDPLITELRELLADIGDE* |
| Ga0070763_101120961 | 3300005610 | Soil | YRQLGRYGDARALLRDTTDRLERILPEGDPLIAELRQNLADIGEE* |
| Ga0070717_101033333 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YGDARALLRDTVNRLESTLPKDDPLIIELRESLADIGQE* |
| Ga0070765_1000883901 | 3300006176 | Soil | GRLGRYGDERALLRSTVDRLERTLPKDDPLIKELRESLADIGEE* |
| Ga0099829_107766001 | 3300009038 | Vadose Zone Soil | GDARALLRDTVDRLERTLPNGDPLITELRESVTDIGEE* |
| Ga0066709_1045432782 | 3300009137 | Grasslands Soil | PDTLRSRARLAQMYLRLGRYGDARALLRDTVGRLERTLPDGDPLITELRRSLADIGDE* |
| Ga0116220_105189121 | 3300009525 | Peatlands Soil | LGRYGDARALLPETVGRLQRLLPPHDPLITELRELLADIGDE* |
| Ga0116115_11469303 | 3300009631 | Peatland | GDARALLRDTVDRLERILPDGDPLITELRQSLADIGDE* |
| Ga0116130_11060673 | 3300009762 | Peatland | LAQVYRQLGRYGDARTLLRDTADRLQRILPDGDPLIAELRQSLADIGEE* |
| Ga0126373_121467951 | 3300010048 | Tropical Forest Soil | GRYGDARALLRDTVGRLERLLPHDDPLIIELREILVDIGHE* |
| Ga0126373_131618671 | 3300010048 | Tropical Forest Soil | AGLAQVYSRLGRYGDARVLLRDTVDRLERTLPDGDPLIIELRQSLADIGEE* |
| Ga0126379_118429152 | 3300010366 | Tropical Forest Soil | LGRYGDARALLRDTVERLDRILPDGDPLVAQLRQSLDNIGEE* |
| Ga0134128_103760401 | 3300010373 | Terrestrial Soil | CALLRDTVGRLERISPHGDPLITELRGMLADIGDE* |
| Ga0126381_1024068211 | 3300010376 | Tropical Forest Soil | VYHQLGRYGDARALLRDTVGRLERILPRDDPLTPELREILADIGDE* |
| Ga0126383_129945762 | 3300010398 | Tropical Forest Soil | RLGRYGDARVLLRDTVDRLERALPDGDPLITELRQSLADIGEE* |
| Ga0157370_102692691 | 3300013104 | Corn Rhizosphere | DARPLLRDTVDRLQRILPNDDPLITELRESLADIGDE* |
| Ga0181527_12860533 | 3300014153 | Bog | QVYRRLGRYGDARALLRDTVDRLERILPDGDPLITELRQSLADIGDE* |
| Ga0182035_109097992 | 3300016341 | Soil | AQVYSRLGRYGDARVLLRDTVDRLERTLPDGDPLISELRQSLADIGEE |
| Ga0182032_105955471 | 3300016357 | Soil | RSRAGLAQVYRRLGRYGDARALLRDTADRLERILPDGDPLIIELRQSLADIGEE |
| Ga0182040_110578121 | 3300016387 | Soil | PRHPDTLCSRAELALVYHRLGRYGDARALLRDTVGRLELILSHDDPLITELREILADIGD |
| Ga0182039_121761701 | 3300016422 | Soil | SRLGRYGDARVLLRDTVDRLERTLPDGDPLISELRQSLADIGEE |
| Ga0182038_111350792 | 3300016445 | Soil | LGRYGDARVLLRDTVDRLERTLPDGDPLISELRQSLADIGEE |
| Ga0187782_100945973 | 3300017975 | Tropical Peatland | YGDARVLLRDTVDRLERILPDGDPLITELRQSLVDIGEE |
| Ga0187804_105705951 | 3300018006 | Freshwater Sediment | RSRAELAQVYRRLGRYGDARALLRDTVYRLERTLPDGDPLITELRRSLADIGEE |
| Ga0187872_104352211 | 3300018017 | Peatland | AQVYRRLGRYGDARALLRDTVDRLERTLPDGDPLITELRQSLADIGEE |
| Ga0187882_11549612 | 3300018021 | Peatland | HAGLAQVYRQLGRYGDARTLLRDTADRLQRILPDGDPLIAELRQSLADIGEE |
| Ga0187863_101165311 | 3300018034 | Peatland | QLGRYGNARALLRDTADRLQRILPDGDPLITELRQSLADIGDE |
| Ga0187883_100154516 | 3300018037 | Peatland | RRLGRYGDARALLRDTVDRLERILPDGDPLITELRQSLADIGDE |
| Ga0187862_100491444 | 3300018040 | Peatland | LAQVYRQLGRYGNARALLRDTADRLQAILPDGDPLIIELRQSLADIGEE |
| Ga0187851_101324814 | 3300018046 | Peatland | RARLAQVYLQLGRYGNARALLRDTADRLQRILPDGDPLITELRQSLADIGDE |
| Ga0187859_101651293 | 3300018047 | Peatland | RQLGRYGNARALLRDTADRLQRILPDGDPLITELRQSLADIGDE |
| Ga0187859_103053141 | 3300018047 | Peatland | RVYRQLGRYGDARALLRDTVDRLQRALPYNDPLVTELREMLADIGDE |
| Ga0210399_110468032 | 3300020581 | Soil | RAGLAQVYSRLGRYGDARALLRDTVDRLERILPNGDPLITELRQSLADIGEG |
| Ga0210395_101888961 | 3300020582 | Soil | VYSRLGRYGDARALLRDTVGRLQRVLPPHDPLITELRELLADIGDE |
| Ga0210400_103354833 | 3300021170 | Soil | YGDARALLRDTVDRLQRIVPPDDPLVTELREILADIGDE |
| Ga0210396_101109641 | 3300021180 | Soil | RYGDARALLRDTVDRLERILPKDDPLIAELREILADIGDE |
| Ga0210388_106404632 | 3300021181 | Soil | RSHAGLAQVYRQLGRYGDARALLRDTADRLQIILPDGDPLIAELRQSLVDIGEE |
| Ga0213875_102141043 | 3300021388 | Plant Roots | GDARALLRDTVDRLERILPDDDPLIIELRESLADIGDA |
| Ga0210393_115482281 | 3300021401 | Soil | RLGRYGDARALLRDTVGRLQRVLPPHDPLVTELRELLADIGDE |
| Ga0210389_107652821 | 3300021404 | Soil | LGRYGDARALLRDTVYRLERILPHNDPLLTELREILADIGDE |
| Ga0210386_114400951 | 3300021406 | Soil | ELARVYGRLGRYGDERALLRGTVDRLERTLPKDDPLIAELRESLADIGEE |
| Ga0210394_108081261 | 3300021420 | Soil | LGRYGDARALLRDTVGRLQRILPPHDPLITELRELLADIGDE |
| Ga0210394_114962971 | 3300021420 | Soil | LGRYGDARALLRDTVGRLEHLLPPHDPLISELREVLSDIGDE |
| Ga0210391_100761341 | 3300021433 | Soil | GRYGDERALLRGTVDRLERTLPKDDPLIAELRESLADIGEE |
| Ga0210391_109813731 | 3300021433 | Soil | GRYGDERALLRSTVDRLERTLPKDDPLIKELRESLADIGEE |
| Ga0210409_103929032 | 3300021559 | Soil | RALLRDTVDRLERVLPDGDPLIIELRQSLVDIGEE |
| Ga0208480_10017151 | 3300025633 | Arctic Peat Soil | YGDARALLRDTADRLQRILPDGDPLITELRQSLSDIGEE |
| Ga0208480_11207701 | 3300025633 | Arctic Peat Soil | YGDARALLRDTADRLQRILPDGDPLITELRQSLADIGEE |
| Ga0207700_108279311 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YGDARALLRDTVGRLEHLLPPHDPLISELREVLSDIGDE |
| Ga0207664_111732021 | 3300025929 | Agricultural Soil | ARALLRDTVDRLRRVLPHDDPLIIELREILADIGEE |
| Ga0209113_10486522 | 3300027517 | Forest Soil | DALRSRAELARVYCQLGRYGDARVLLRDTVGRLEVILAPGDPLIAELRQILADIGEE |
| Ga0209693_100929952 | 3300027855 | Soil | DTLRCRVELARVYGRLGRYGDERALLRSTVDRLERTLPKDDPLIKELRESLADIGEE |
| Ga0209693_104283312 | 3300027855 | Soil | QVYRQLGRYGDARALLRDTTDRLERILPEGDPLIAELRQNLADIGEE |
| Ga0209624_108569411 | 3300027895 | Forest Soil | AGLGRVRAGARPRHPDALRSRASLAQVYSRLGRYGDIRALLRDTVHRLERTLPEGDPLIIELRQSLAGIGEE |
| Ga0209624_109384191 | 3300027895 | Forest Soil | ALVYRQLGRYGDARALLRDTVDHLQRIVPHDDPLIIELREVLADIGDE |
| Ga0302235_101365541 | 3300028877 | Palsa | NARALLRDTADRLQRILPDDDPLITELRQSLADIGEE |
| Ga0308309_113802321 | 3300028906 | Soil | GRLGRYGDERALLRSTVDRLERTLPKDDPLIKELRESLADIGEE |
| Ga0311362_101426037 | 3300029913 | Bog | YRQLGRYGNARALLRDTADRLQRILPDDDPLITELRQSLADIGEE |
| Ga0302142_11112831 | 3300029920 | Bog | ALAQVYRQLGRYGNARALLRDTADRLQRILPDDDPLITELRQSLADIGEE |
| Ga0311340_100267288 | 3300029943 | Palsa | RVLLRDTVGRLERALPDGDPLITELRQSLADIGEE |
| Ga0311340_104721442 | 3300029943 | Palsa | RALLRDTADRLQRILPDDDPLITELRQSLADIGEE |
| Ga0311352_108120971 | 3300029944 | Palsa | YGNARDLLRDTADRLQRILPDGDPLITELRQSLADIGEE |
| Ga0302283_12596302 | 3300029994 | Fen | QVYRQLGRYGNARALLRDTADRLQRILPDDDPLITELRQSLADIGEE |
| Ga0311339_119515182 | 3300029999 | Palsa | WSRARLAQVYRRLGRYGDARVLLRDTVGRLERALPDGDPLIAELRQSLADIGEE |
| Ga0311338_110986153 | 3300030007 | Palsa | RMYRQLGRYGDARALLRDTVDRLQPILPHNDPLITELREILADIGVE |
| Ga0302176_101535122 | 3300030057 | Palsa | RLAQVYRRLGRYGDARVLLRDTVGRLERALPDGDPLITELRQSLADIGEE |
| Ga0311353_106517431 | 3300030399 | Palsa | LVYRQLGRYGDARALLRDTVDRLERILPRHDPLIVELREVLADIGDE |
| Ga0311355_106941532 | 3300030580 | Palsa | SRARLAQVYRRLGRYGDARVLLRDTVGRLERALPDGDPLITELRQSLADIGEE |
| Ga0265763_10227981 | 3300030763 | Soil | RVYSRLGRYGDARALLRDTVGRLQRVLPPHDPLITELRELLADIGDE |
| Ga0265741_1125272 | 3300030814 | Soil | LGRYGDARALLRDTVGRLQRVLPPHDPLITELRELLADIGDE |
| Ga0073997_122283701 | 3300030997 | Soil | GDARALLRDTVDRLERILPKDDPLIAELRGILADIGDE |
| Ga0318534_103047482 | 3300031544 | Soil | YGDARALLRDTVDRLERILPHDDPLIPELREILTDIGDE |
| Ga0318555_103949661 | 3300031640 | Soil | VYSRLGRYGDARVLLRDTVDRLERTLPDGDPLITELRQSLADIGEE |
| Ga0318542_101110651 | 3300031668 | Soil | RLGRYGDARVLLRDTVDRLERTLPDGDPLITELRQNLADIGENNSR |
| Ga0318574_106674252 | 3300031680 | Soil | GDARVLLRDTVDRLERTLPDGDPLITELRQNLADIGEE |
| Ga0318560_100833051 | 3300031682 | Soil | YGDARVLLRDTVDRLERTLPDGDPLITELRQNLADIGEE |
| Ga0310686_10696932010 | 3300031708 | Soil | QLGRYGDARALLRDTVDRLERILPRHDPLIVELREVLADIGDE |
| Ga0310686_1081484001 | 3300031708 | Soil | YGDARALLRDTVGRLQRVLPPNDPLITELREILADIGDE |
| Ga0307476_104408753 | 3300031715 | Hardwood Forest Soil | GRYGDARALLRDTTDRLERILPQGDPLIAELRQNLADIGEE |
| Ga0306917_114183181 | 3300031719 | Soil | RYGDARVLLRDTVDRLERTLPDGDPLITELRQSLADIGEE |
| Ga0318493_103576602 | 3300031723 | Soil | RRLGRYGDARALLRDTVDRLTRILPDGDPLITELRQSLADIGEE |
| Ga0318500_106454632 | 3300031724 | Soil | VYRQLGRYGDARALLRDTVDRLERILPHDDPLIPELREILADIGDE |
| Ga0318492_103559471 | 3300031748 | Soil | VYRQLGRYGDARTLLRDTVDRLERILPHDDPLIPELREILADIGDE |
| Ga0318494_106969552 | 3300031751 | Soil | RVLLRDTVDRLERALPDGDPLITELRQSLADIGEE |
| Ga0318494_107512942 | 3300031751 | Soil | QLGRYGDARALLHDTVDRLERILPAGDPLITELRQSLADIGEE |
| Ga0307475_113966471 | 3300031754 | Hardwood Forest Soil | RALLRDTVDRLERVPLHNDQLITELREILADIGDE |
| Ga0318552_107273011 | 3300031782 | Soil | RALLRDTVDRLERILPHDDPLIPELREILADIGDE |
| Ga0318529_104402722 | 3300031792 | Soil | YGDARVLLRDAVDRLERVLPNDDPLIPELREILADIGDE |
| Ga0318576_103637692 | 3300031796 | Soil | RALLRDTVDRLERILPHDDPLIPELREILTDIGDE |
| Ga0318550_104587381 | 3300031797 | Soil | GDARALLRDTVDRLTRILPDGDPLITELRQSLADIGEE |
| Ga0318497_102936023 | 3300031805 | Soil | RLGRYGDARALLRDTVDRLERILPDSDPLLIGLRQNLADIGEE |
| Ga0318495_100786591 | 3300031860 | Soil | AQVYRRLGRYGDARALLRDTVDRLQRILPDGDPLITELRQSLADIGEE |
| Ga0306919_101323233 | 3300031879 | Soil | QLGRYGDARVLLHDTIGRLERTLPDDDPLLTELRQSLADIGEE |
| Ga0306923_110047882 | 3300031910 | Soil | RYGDARALLRDTVDRLERILPHDDPLIPELREILTDIGDE |
| Ga0306923_114853442 | 3300031910 | Soil | RAELARVYRRLGRYGDARALLRNTFDRLERILPDDDPLITELRESLADIGDE |
| Ga0310912_112061461 | 3300031941 | Soil | RYGDARVLLRDTVDRLERTLPDGDPLITELRQNLADIGEE |
| Ga0310909_112224672 | 3300031947 | Soil | GRLGRYGDARVLLRDTVDRLERTLPDGDPLITELRQSLADIGEE |
| Ga0318530_103807271 | 3300031959 | Soil | LYSRLGRYGDARALLRDTVDRLERALPDGDPLIIELRQRLADIGEE |
| Ga0318507_101977042 | 3300032025 | Soil | VYRQLGRYGDARALLRDTVDRLERILPHDDPLIPELREILTDIGDE |
| Ga0318556_103123682 | 3300032043 | Soil | LGRYGDARVLLRDTVDRLERTLPEDDPLIRELREDLADIGEE |
| Ga0318556_105982952 | 3300032043 | Soil | RALLRDTVDRLERALPDGDPLIIELRQRLADIGEE |
| Ga0318558_101568441 | 3300032044 | Soil | RQLGRYGDARALLRDTVDRLERILPEGDPLITELRQSLADIGEE |
| Ga0318575_102648781 | 3300032055 | Soil | HQLGRYGDARVLLHDTIERLGRTLPDDDPLLTELRQSLADIGEE |
| Ga0318504_101020652 | 3300032063 | Soil | SRLGRYGDARVLLRDTVDRLERTLPDGDPLITELRQNLADIGEE |
| Ga0318504_103904442 | 3300032063 | Soil | YRLGRYGDARVLLRDTVDRLERTLPEDDPLIRELREDLADIGEE |
| Ga0318514_102820481 | 3300032066 | Soil | GLAQVYRRLGRYGDARALLRDTVDRLQRILPDGDPLIIELRQSLADIGEE |
| Ga0308173_112236322 | 3300032074 | Soil | RYGDARALLRDTVGRLERTLPHGDPLITELREILADIGDE |
| Ga0335078_125423422 | 3300032805 | Soil | ELARIYGRLGRYGDARALLRGTVDRLERTLPKDDPLIRELRDSLADIGEE |
| Ga0335074_105545981 | 3300032895 | Soil | YSRLGRYGDARALLRDTVGRLEHLLPPHDPLISELREVLSDIGDE |
| Ga0335075_111652461 | 3300032896 | Soil | QVYRRLGRYGDARALLRDTVDRLERALPDGDPLIAELRQSLADIGEE |
| Ga0335072_118039462 | 3300032898 | Soil | DARALLRDTVDRLERILPRHDPLIVELREVLADIGDE |
| Ga0335083_105623561 | 3300032954 | Soil | QLGRYGDARALLRDTVGRLERILPADDPLVTELRMSLADIGDE |
| Ga0335076_101625701 | 3300032955 | Soil | SRAELALVYSRLGRYGDARALLRDTVGRLENLLPPHDPLITELREVLSDIGDE |
| Ga0335073_100204901 | 3300033134 | Soil | LRSRAELALVYSRLGRYGDARALLRDTVGRLEHLLPPHDPLIGELREVLSDIGDE |
| Ga0335073_103502901 | 3300033134 | Soil | LRSRAELALVYSRLGRYGDARALLRDTVGRLEHLLPPHDPLISELREVLSDIGDE |
| Ga0335073_104307511 | 3300033134 | Soil | YGDARALLRDTVDRLDRILPQGDPLITDLRAILADIGDE |
| Ga0335073_104579441 | 3300033134 | Soil | RLGRYGDARALLRDTVGRLEHLLPPHDPLITELREVLSDIGDE |
| Ga0335073_112221342 | 3300033134 | Soil | PDTLRNRAELALVYRQLGRYGDARALLRDTVDRLDRILPPRDPLILELREVLADIGDE |
| Ga0335073_117342633 | 3300033134 | Soil | DARALLRDTVDRLERILPDGDPLITELRQSLADIGEE |
| ⦗Top⦘ |