| Basic Information | |
|---|---|
| Family ID | F064937 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VRRYLLVLDMDLLAVDEELDLEPINYLVARQEQEPCEVVVMSL |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.81 % |
| % of genes near scaffold ends (potentially truncated) | 70.31 % |
| % of genes from short scaffolds (< 2000 bps) | 71.09 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.781 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 19.72% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 16.41 |
| PF00296 | Bac_luciferase | 2.34 |
| PF04075 | F420H2_quin_red | 1.56 |
| PF01243 | Putative_PNPOx | 1.56 |
| PF02441 | Flavoprotein | 1.56 |
| PF00890 | FAD_binding_2 | 1.56 |
| PF00723 | Glyco_hydro_15 | 1.56 |
| PF01527 | HTH_Tnp_1 | 1.56 |
| PF08327 | AHSA1 | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF04978 | DUF664 | 0.78 |
| PF00128 | Alpha-amylase | 0.78 |
| PF04525 | LOR | 0.78 |
| PF01695 | IstB_IS21 | 0.78 |
| PF13450 | NAD_binding_8 | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF02861 | Clp_N | 0.78 |
| PF13977 | TetR_C_6 | 0.78 |
| PF01544 | CorA | 0.78 |
| PF04014 | MazE_antitoxin | 0.78 |
| PF13411 | MerR_1 | 0.78 |
| PF01909 | NTP_transf_2 | 0.78 |
| PF02566 | OsmC | 0.78 |
| PF00665 | rve | 0.78 |
| PF00270 | DEAD | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF13350 | Y_phosphatase3 | 0.78 |
| PF08546 | ApbA_C | 0.78 |
| PF13847 | Methyltransf_31 | 0.78 |
| PF00795 | CN_hydrolase | 0.78 |
| PF01152 | Bac_globin | 0.78 |
| PF00579 | tRNA-synt_1b | 0.78 |
| PF00501 | AMP-binding | 0.78 |
| PF00106 | adh_short | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.34 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.56 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.78 |
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.78 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.78 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.78 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.78 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.78 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.78 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.78 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.78 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.78 % |
| All Organisms | root | All Organisms | 49.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig96059 | Not Available | 609 | Open in IMG/M |
| 3300004156|Ga0062589_101132399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300005168|Ga0066809_10180460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 562 | Open in IMG/M |
| 3300005332|Ga0066388_103862565 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005434|Ga0070709_10433151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
| 3300005435|Ga0070714_101741802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300005436|Ga0070713_101228748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300005524|Ga0070737_10024331 | All Organisms → cellular organisms → Bacteria | 4007 | Open in IMG/M |
| 3300005610|Ga0070763_10777294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300005718|Ga0068866_10070258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1848 | Open in IMG/M |
| 3300005764|Ga0066903_104290323 | Not Available | 762 | Open in IMG/M |
| 3300005764|Ga0066903_108551391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300005764|Ga0066903_108608060 | Not Available | 519 | Open in IMG/M |
| 3300006028|Ga0070717_10024768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4769 | Open in IMG/M |
| 3300006176|Ga0070765_100133949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2190 | Open in IMG/M |
| 3300006852|Ga0075433_11853565 | Not Available | 518 | Open in IMG/M |
| 3300006914|Ga0075436_100652197 | Not Available | 778 | Open in IMG/M |
| 3300009038|Ga0099829_11432482 | Not Available | 571 | Open in IMG/M |
| 3300009553|Ga0105249_13524650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300009700|Ga0116217_10588582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300010154|Ga0127503_11068244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300010361|Ga0126378_11759432 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300010366|Ga0126379_12673911 | Not Available | 596 | Open in IMG/M |
| 3300010375|Ga0105239_11966554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300010396|Ga0134126_11796577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300010398|Ga0126383_10380245 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300010398|Ga0126383_10593933 | Not Available | 1178 | Open in IMG/M |
| 3300010398|Ga0126383_11735743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300010399|Ga0134127_11844181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300010400|Ga0134122_12892343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300012189|Ga0137388_10780112 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012210|Ga0137378_10831728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300012519|Ga0157352_1001456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1771 | Open in IMG/M |
| 3300012930|Ga0137407_11363916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300012971|Ga0126369_12957806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 556 | Open in IMG/M |
| 3300015372|Ga0132256_100720991 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300018060|Ga0187765_10287072 | Not Available | 982 | Open in IMG/M |
| 3300020002|Ga0193730_1171793 | Not Available | 554 | Open in IMG/M |
| 3300020582|Ga0210395_10600249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300021088|Ga0210404_10775118 | Not Available | 548 | Open in IMG/M |
| 3300021168|Ga0210406_10287946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1339 | Open in IMG/M |
| 3300021404|Ga0210389_10526798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300021478|Ga0210402_11355841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300024288|Ga0179589_10582983 | Not Available | 523 | Open in IMG/M |
| 3300025474|Ga0208479_1056857 | Not Available | 764 | Open in IMG/M |
| 3300025885|Ga0207653_10023687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1957 | Open in IMG/M |
| 3300025927|Ga0207687_10990499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300025929|Ga0207664_10263720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1507 | Open in IMG/M |
| 3300025941|Ga0207711_10720460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 930 | Open in IMG/M |
| 3300026088|Ga0207641_10434713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300027047|Ga0208730_1036887 | Not Available | 571 | Open in IMG/M |
| 3300027725|Ga0209178_1411983 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027775|Ga0209177_10054517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1145 | Open in IMG/M |
| 3300027908|Ga0209006_10418554 | Not Available | 1126 | Open in IMG/M |
| 3300027908|Ga0209006_11168077 | Not Available | 603 | Open in IMG/M |
| 3300028047|Ga0209526_10843324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300028784|Ga0307282_10297173 | Not Available | 778 | Open in IMG/M |
| 3300031474|Ga0170818_114106460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300031546|Ga0318538_10197246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1074 | Open in IMG/M |
| 3300031546|Ga0318538_10561699 | Not Available | 619 | Open in IMG/M |
| 3300031546|Ga0318538_10685156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 556 | Open in IMG/M |
| 3300031561|Ga0318528_10251048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 949 | Open in IMG/M |
| 3300031572|Ga0318515_10111293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1442 | Open in IMG/M |
| 3300031640|Ga0318555_10271010 | Not Available | 918 | Open in IMG/M |
| 3300031679|Ga0318561_10758884 | Not Available | 533 | Open in IMG/M |
| 3300031708|Ga0310686_108535222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300031736|Ga0318501_10282126 | Not Available | 884 | Open in IMG/M |
| 3300031765|Ga0318554_10363514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 822 | Open in IMG/M |
| 3300031769|Ga0318526_10251655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
| 3300031779|Ga0318566_10539978 | Not Available | 570 | Open in IMG/M |
| 3300031821|Ga0318567_10661170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300031821|Ga0318567_10690472 | Not Available | 579 | Open in IMG/M |
| 3300031880|Ga0318544_10289298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300031890|Ga0306925_10676630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1082 | Open in IMG/M |
| 3300031890|Ga0306925_11331233 | Not Available | 712 | Open in IMG/M |
| 3300031910|Ga0306923_11679957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 657 | Open in IMG/M |
| 3300031912|Ga0306921_10354846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1714 | Open in IMG/M |
| 3300031954|Ga0306926_11104842 | Not Available | 937 | Open in IMG/M |
| 3300032008|Ga0318562_10632680 | Not Available | 617 | Open in IMG/M |
| 3300032009|Ga0318563_10173585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1160 | Open in IMG/M |
| 3300032025|Ga0318507_10048366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1662 | Open in IMG/M |
| 3300032035|Ga0310911_10094821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1629 | Open in IMG/M |
| 3300032039|Ga0318559_10553948 | Not Available | 536 | Open in IMG/M |
| 3300032063|Ga0318504_10443106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 621 | Open in IMG/M |
| 3300032076|Ga0306924_10343550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1712 | Open in IMG/M |
| 3300032076|Ga0306924_12133618 | Not Available | 573 | Open in IMG/M |
| 3300032090|Ga0318518_10534181 | Not Available | 600 | Open in IMG/M |
| 3300032090|Ga0318518_10554624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300032091|Ga0318577_10307796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300032160|Ga0311301_11733874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300032180|Ga0307471_101909546 | Not Available | 743 | Open in IMG/M |
| 3300032205|Ga0307472_102016437 | Not Available | 578 | Open in IMG/M |
| 3300032261|Ga0306920_101994888 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300034199|Ga0370514_163186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.78% | |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00006680 | 2124908016 | MVMQRYLLVLDMDLPGLDEELDLEPVNYLAGRHEQERGEVVVLSV | |
| Ga0062589_1011323991 | 3300004156 | Soil | VRRYLLVLDMDLLAVDEELDLEPINYLVARQEQEPCEVVVMSLV |
| Ga0066809_101804601 | 3300005168 | Soil | MGMRRYLVVLDMDLLAADEELDLEPINYLTAQQEREPCEAVVLSLANTRQV |
| Ga0066388_1038625651 | 3300005332 | Tropical Forest Soil | MRRYLLVLDMDLLALDEELDLQPINHLIARQEQERGEVVVLSLAAT |
| Ga0070709_104331511 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVM |
| Ga0070714_1017418022 | 3300005435 | Agricultural Soil | VRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQEPCEVVVMSLVRSRQARLPAME |
| Ga0070713_1012287482 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEVMGVRRYLLVLDMDLLAVDEELDLKPINHLVARQEEGPCEVVVMSLVRSRQARL |
| Ga0070737_100243314 | 3300005524 | Surface Soil | VRRYLLVLDMDLLAVDDELDLEPINYLVAQQEREPCTVVVLSLVDTRQARLPSLG* |
| Ga0070763_107772942 | 3300005610 | Soil | MGVRRYLLVLDMDLLAVDEQCDPGPIGYLAGRQEHEPCEVAVLSLATGQP |
| Ga0068866_100702582 | 3300005718 | Miscanthus Rhizosphere | VRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQEPCEVVVMSLVRSRQA |
| Ga0066903_1042903231 | 3300005764 | Tropical Forest Soil | MRRYLLVLDMDLLALDAELDLQPINYLVAQQEQQPCEVVVLSLVA |
| Ga0066903_1085513911 | 3300005764 | Tropical Forest Soil | MRRYLLVLDMDLLALGEELGQEPINYLVARQEQERAEVVVLS |
| Ga0066903_1086080602 | 3300005764 | Tropical Forest Soil | MRRYLLVLDMDLLALDEELDLQPINYLVAQQEQQPCEVVVLSLVATRQAKLSP |
| Ga0068863_1012341691 | 3300005841 | Switchgrass Rhizosphere | MGVRRYLLVLDMDLLAVDEQCDPGPISYLAGRQEH |
| Ga0070717_100247682 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVQRYLLVLDMDLLTVGQQLIWINYLVARQEQEPAK* |
| Ga0070765_1001339494 | 3300006176 | Soil | MGVRRYLLVLDMDLLALDEELELQPINYLVERQEKEPCQV |
| Ga0074062_100187792 | 3300006606 | Soil | MDVRRYLLVLDMDLLAVDKQCELGPISYLVARQEHEQCE |
| Ga0075433_118535651 | 3300006852 | Populus Rhizosphere | MGVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVM |
| Ga0075436_1006521971 | 3300006914 | Populus Rhizosphere | MRRYLLVLDMDLLALDEELDLEPINYLVAQQEQQPCDVVVLSLVAT |
| Ga0099829_114324822 | 3300009038 | Vadose Zone Soil | MGVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVLPAIP* |
| Ga0105249_135246501 | 3300009553 | Switchgrass Rhizosphere | MAMRRYLLVLDMDLLAQNEELDLEPINYLVARQEQERGEVVVL |
| Ga0116217_105885822 | 3300009700 | Peatlands Soil | MGVRRYLLVLDMDLLAVDEELGLEPINYLVARQEEEPCEVVVMSLVRSRQARLP |
| Ga0127503_110682441 | 3300010154 | Soil | MRRYLLVLDMDLLAQNEELDLEPINYLAARQEQERGEVVVLSVVANR |
| Ga0126378_117594322 | 3300010361 | Tropical Forest Soil | MRRYLLVLDMDLLALDEELDLQPINYFVAQQEQQPCEVVVLSLVASRQA |
| Ga0126379_126739111 | 3300010366 | Tropical Forest Soil | MAMRRFLLVLDMDLLALNEELGLQPVNYLAAQLEQQPCEVVVLSMVATR |
| Ga0105239_119665542 | 3300010375 | Corn Rhizosphere | MGVRRYLLVLDMDLLAVDEELDLEPINHLVAQQEQEPCEVVVMSLVRSRQA |
| Ga0134126_117965772 | 3300010396 | Terrestrial Soil | VRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQEPCEVVVMSLVRS |
| Ga0134124_102213701 | 3300010397 | Terrestrial Soil | MDVRRYLLVLDMDLLAVDEQCELGPISYLAARQEHE |
| Ga0126383_103802451 | 3300010398 | Tropical Forest Soil | MGRYLLVLDMDLLALDEELDLEPINYLVERQAQEPC |
| Ga0126383_105939331 | 3300010398 | Tropical Forest Soil | MAMRRYLLVLDMDLLALGEELSQEPINYLVARQERERADHS* |
| Ga0126383_117357432 | 3300010398 | Tropical Forest Soil | MGRYLLVLGMDMLALDEELDLEPINYLVERQEQEPCEVVVLSLVDT |
| Ga0134127_118441812 | 3300010399 | Terrestrial Soil | MGVRRYLLVLDMDLLAVDSELDLEPINHFVARQEQEPCEVVVMSLVRSRQA |
| Ga0134122_128923432 | 3300010400 | Terrestrial Soil | MGVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVMSLVRSRLARLPA |
| Ga0137388_107801121 | 3300012189 | Vadose Zone Soil | LLVLDMDLLAVDEKFDLEPVSYLLARQEQEPCEVVVLSLVGTRQ |
| Ga0137378_108317282 | 3300012210 | Vadose Zone Soil | MAMRRYLLVLDMDLLAQNEELDLEPINYLVARQEQERGEVVVLSVVA |
| Ga0137385_112466203 | 3300012359 | Vadose Zone Soil | MDVRRYLLVLDMDLLAVDEQCDPGPISYLVARQEHE |
| Ga0157352_10014561 | 3300012519 | Unplanted Soil | MGVRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQEPCE |
| Ga0137407_109968611 | 3300012930 | Vadose Zone Soil | LKEVMDMRRYLLVLDMDLLAMDEEHDLEPISYLVAKQEQEPCEV |
| Ga0137407_113639161 | 3300012930 | Vadose Zone Soil | LTEVIDVRRYLLVLDMDLLAVDSELDLKPINHLVARQEQEPCEVVVMSL |
| Ga0126369_129578062 | 3300012971 | Tropical Forest Soil | MPRHLLVLDMDLLAVDEQFDLEPINYLVARQEQQPCEVTVLSLVDTS |
| Ga0157375_125129412 | 3300013308 | Miscanthus Rhizosphere | MGVRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQE |
| Ga0137418_111190041 | 3300015241 | Vadose Zone Soil | LKEVMGMRRYLLVLDMDLLAMDEEHDLEPISYLVAKQE |
| Ga0132256_1007209912 | 3300015372 | Arabidopsis Rhizosphere | MRRYLVVLDMDLLAADEELDLEPISYLATQQEREPCEAVVLSLANTRQVR |
| Ga0182040_107431041 | 3300016387 | Soil | MGMRRYLLVLVMDLLAMDEEHDLEPINYLIAKQEHEPC |
| Ga0187765_102870721 | 3300018060 | Tropical Peatland | MRRYLLVLDMDLLALDEELDLQPINYLVERQEQEPGDVVVLSLAATRQAKLSKLE |
| Ga0187773_110002831 | 3300018064 | Tropical Peatland | MQRILLVLDMDLLAVDEHFDLAPINHLVARQDQEPCEVTVLSLVDT |
| Ga0193730_11717931 | 3300020002 | Soil | VRRYLLVLDMDLLAVDEELDLEPINHLIAQQEQEQE |
| Ga0210395_106002493 | 3300020582 | Soil | MQRYLLVLDTDLLALDEELGLEPINYLVERQEQEPCEVVVLSLVD |
| Ga0210404_107751181 | 3300021088 | Soil | VRRYLLVLDMDLLAVDEELDLKPINHLVARQEQEP |
| Ga0210406_102879461 | 3300021168 | Soil | MRRYLLVLDMDLLAQNEELDLEPINYLAARQEQERGEVVVLSVIA |
| Ga0210388_115433692 | 3300021181 | Soil | MRLREVIGMRRYLLVLDMDLLAMDEEHDLEPINYLVAKQEQE |
| Ga0210389_105267983 | 3300021404 | Soil | MGVRRYLLVLDMDLLAADEQCDLGLIGYLAGRQEHEPCEVVVLSLATG |
| Ga0210386_113175991 | 3300021406 | Soil | MRLREVMGMRRYLLVLDMDLLAMDEEHDLQPINYLVA |
| Ga0210402_113558411 | 3300021478 | Soil | MRRYLLVLDMDLLAQNEELDLEPINYLAARQEQERGEVVV |
| Ga0210402_115676281 | 3300021478 | Soil | VRRYLLVLDMDLLAVDEELDLKPINHLVARQEQEPCEV |
| Ga0126371_104189271 | 3300021560 | Tropical Forest Soil | MRRYLLVLDMDLLAMDEEHDLEPINYLVAKEQQEPCEVV |
| Ga0224564_10114053 | 3300024271 | Soil | MGIQRYLLVLDEDLLTVDEELGLEPISYLVARQEQDECRQVVWPH |
| Ga0179589_105829831 | 3300024288 | Vadose Zone Soil | VRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVV |
| Ga0208479_10568572 | 3300025474 | Arctic Peat Soil | MRRYLVVLDMDFLAADEELDLEPINYLVAQQQREPCEAVVLSLAST |
| Ga0207653_100236871 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEP |
| Ga0207684_100370119 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMRRYLLVLDMDLLAMDEEHDLEPINCLVAKQEQESCE |
| Ga0207687_109904991 | 3300025927 | Miscanthus Rhizosphere | VRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVMSLVRSRQAR |
| Ga0207664_102637202 | 3300025929 | Agricultural Soil | VRRYLLVLDMDLLAVDEELDLEPINYLVARQEQEPCEVVVMSL |
| Ga0207711_107204601 | 3300025941 | Switchgrass Rhizosphere | VRRYLLVLDMDLLAVDEELDLQPINHLVAQQEQEPCEV |
| Ga0207711_115128021 | 3300025941 | Switchgrass Rhizosphere | MDVRRYLLVLDMDLLAVDEQCELGPISYLAARQEHEQCE |
| Ga0207689_118128071 | 3300025942 | Miscanthus Rhizosphere | MGVRRYLLVLDMDLLAVDEQCDPGPISYLAGRQEHEPCEVVV |
| Ga0207712_111929632 | 3300025961 | Switchgrass Rhizosphere | MGVRRYLLVLDMDLLAVDEQCDPGPISYLAGRQEHEPCE |
| Ga0207641_104347133 | 3300026088 | Switchgrass Rhizosphere | MRRYLLVLDMDLLALDEELGLEPINYLVAQQEQQPCEVVVLSLVAT |
| Ga0208730_10368871 | 3300027047 | Forest Soil | MGMRRYLLVLDMDLLAVDAELDLAPINYLVARQEQEPCEVVVMSLVRSR |
| Ga0209178_14119832 | 3300027725 | Agricultural Soil | MRRYLVVLDMDLLAADEELDLEPINYLIAQQEREPCEAVVLSLAN |
| Ga0209177_100545172 | 3300027775 | Agricultural Soil | MRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVAVMSLIRSRQER |
| Ga0209006_104185541 | 3300027908 | Forest Soil | MQRYLLVLDMDLLAMDEEHDLEPISYLVARQEREPCEVVVLSLTATGPKMPVELLA |
| Ga0209006_111680772 | 3300027908 | Forest Soil | MRRYLLVLDMDLLAVDSELDLEPINHLVALQDQAPGEVVVMSLVRSRQAK |
| Ga0209526_108433241 | 3300028047 | Forest Soil | VMSVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVMSLVR |
| Ga0307282_102971732 | 3300028784 | Soil | MQRYLLVLDMDLLGPDEELDLEPVNYLAARHEQEQGEVV |
| Ga0170818_1141064602 | 3300031474 | Forest Soil | VMGVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQGPCEVVVMSLVRSRQAR |
| Ga0318541_107257841 | 3300031545 | Soil | VVRRYLLVLDMDLLAVDERLGLEPISYLLARQQQQP |
| Ga0318538_101972461 | 3300031546 | Soil | VWRYLLVLDMDLLAVDEEFDLEPINYLVTRQEREPCQVLVMSL |
| Ga0318538_105616991 | 3300031546 | Soil | MGMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVVLSLVDTSQT |
| Ga0318538_106851562 | 3300031546 | Soil | MGRYLLVLDTDLLAPDEELHLGPIGYLVERQKQEPCEVVVLSLAD |
| Ga0318528_102510483 | 3300031561 | Soil | MGRYLLVLDTDLLAPDEELHLGPIGYLVERQKQEPCEV |
| Ga0318515_101112931 | 3300031572 | Soil | MVRRYLLVLDMDLLAVDERLSLEPISYLLAQQQEQPCEVVVL |
| Ga0310915_104631041 | 3300031573 | Soil | MDIRRYLLVLDMDLLAMDEEHDLEPINYLIAKQEQE |
| Ga0318555_102710103 | 3300031640 | Soil | VWRYLLVLDMDLLAVDEEFDLEPINYLVTRQEREPCEVLVMSLVW |
| Ga0318561_107588841 | 3300031679 | Soil | MDMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVVLSLVDT |
| Ga0318574_105168932 | 3300031680 | Soil | MGMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVV |
| Ga0310686_1085352222 | 3300031708 | Soil | MRRYLLVLDMDLLAMDEEHNLEPISYLVAKQEQEPCEVVVLSLAD |
| Ga0318501_102821262 | 3300031736 | Soil | MGRYLLVLDLDLLTLNEELDLEPVNYLVARQEQKRGEVVV |
| Ga0318554_103635141 | 3300031765 | Soil | MRRYLLVLDMDLLAMDSEHDLEPINYLVARQEQEPCE |
| Ga0318526_102516551 | 3300031769 | Soil | MRRYLLVLDMDLLALDEELGQEPISYLVAQQEQQPCDVVVLSIVATRQAKLS |
| Ga0318566_105399781 | 3300031779 | Soil | MDMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVVLSLVDTSQT |
| Ga0318550_102540181 | 3300031797 | Soil | VVRRYLLVLDMDLLAVDERLGLEPISYLLARQQQQ |
| Ga0318568_104902622 | 3300031819 | Soil | MGMRRYLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCE |
| Ga0318567_106611702 | 3300031821 | Soil | MRRYLLVLDTDLLALDEELNQEPVNYLVAQQEQQPCEVVVLSMVATRQSK |
| Ga0318567_106904721 | 3300031821 | Soil | MGRYLLVLDTDLLALDEELDLGPINYLVERQEQEPCEVVVLSL |
| Ga0318544_102892981 | 3300031880 | Soil | MVRRYLLVLDMDLLAVDERLGLEPISYLLAQQQEQPCEVVVL |
| Ga0306925_106766301 | 3300031890 | Soil | MGMRRYLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVVLSLVDTSQT |
| Ga0306925_113312332 | 3300031890 | Soil | MRRYLLVLDMDLLALDEELDQEPVNYLVTQQERQSCEVVVLSMVATR |
| Ga0318536_103074191 | 3300031893 | Soil | MDMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHE |
| Ga0306923_112125881 | 3300031910 | Soil | VVRRYLLVLDMDLLAVDERLGLEPISYLLARQQQQPCDVVVL |
| Ga0306923_116799572 | 3300031910 | Soil | MRRYLLVLDMDLLALDKELDLGPIDYLVARQEQDPSEVVVLSLVATRQ |
| Ga0306923_120556961 | 3300031910 | Soil | MDMRRYLLVLDMDLLAMDEEHDLEPINYLIAKQEQEPCEVVVLSL |
| Ga0306921_103548461 | 3300031912 | Soil | MGMRRYLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEVVVLSLVDTS |
| Ga0306921_115676842 | 3300031912 | Soil | MRRYLLVLDMDLLAVDEQLGLEPISYLLARQEEQPAEV |
| Ga0306926_111048421 | 3300031954 | Soil | MRRYLLVLDMDLLALDKELDLGPIDYLVARQEQDPSEVVVLS |
| Ga0318562_106326802 | 3300032008 | Soil | MRRYLLVLDMDLLALDEELDQEPVNYLVTQQERQSCEVVVLSMVATQQ |
| Ga0318563_101735852 | 3300032009 | Soil | MRRYLLVLDMDLLALGEELGQEPINYLVARQEQERTEVVVLSL |
| Ga0318507_100483664 | 3300032025 | Soil | MGMLRILLVLDMDLLAVDEHFDLAPINHLVARQDQEPCEVTVLSLV |
| Ga0310911_100948211 | 3300032035 | Soil | MGMLRILLVLDMDLLAVDEHFDLAPINHLVARQDQEPCEVTVLSLVDTRQTRLP |
| Ga0318559_105539482 | 3300032039 | Soil | VWRYLLVLDMDLLAVDEEFDLEPINYLVTRQEREPCQVLVMSLVWT |
| Ga0318570_105583421 | 3300032054 | Soil | MDMRRFLLVLDMDLLAMDEEHDLEPINYLIAKQEHEPCEV |
| Ga0318504_104431062 | 3300032063 | Soil | VVRRYLLVLDMDLLAADERLGLEPISYLLARQQEQPCEVVVLS |
| Ga0318510_105004641 | 3300032064 | Soil | MVRRYLLVLDMDLLAVDEQLGLEPISYLLAQQQEQ |
| Ga0318513_100480321 | 3300032065 | Soil | LRRFLLVLDMDLLAVDERLGLEPISYLLARQQEQPCEVVVLSL |
| Ga0318524_101209202 | 3300032067 | Soil | LRRFLLVLDMDLLAVDERLGLEPISYLLARQQEQPCEVVVLS |
| Ga0318524_101931993 | 3300032067 | Soil | VVRRYLLVLDMDLLAVDERLGLEPISYLLARQQQQPCDVVVLS |
| Ga0306924_103435504 | 3300032076 | Soil | MRRYLLVLDMDLLALDKELDLGPIDYLVARQEQDPSEVVVLSLVA |
| Ga0306924_121336181 | 3300032076 | Soil | MRRYLLVLDMDLLALDEELDQEPVNYLVTQQERQSCEVVVLSMVATRQAKLSP |
| Ga0318518_105341811 | 3300032090 | Soil | MRRYLLVLDTDLSALDEELDLGPIDYLVARQEQEQSEVVVL |
| Ga0318518_105546242 | 3300032090 | Soil | MGMLRILLVLDMDLLAVDEHFDLEPINHLVARQSQEPCEVTVLSLVD |
| Ga0318577_103077961 | 3300032091 | Soil | VRRYLLVLDMDLLALDEELDLEPINYLVTRQEQERSEVVVLSL |
| Ga0311301_117338742 | 3300032160 | Peatlands Soil | MQGYLLVLDMDLLAADEKFDLEPINYLVAQQEREPCQVVVLSLADTA |
| Ga0307470_115617981 | 3300032174 | Hardwood Forest Soil | MGMRRYLLVLDMDLLAMDEEHDLEPINYLVARQAQESS |
| Ga0307471_1019095462 | 3300032180 | Hardwood Forest Soil | MRRYLLVLDMDLLALDEELDQGPISYLIAQQEQQPCEVVVLSLVA |
| Ga0307472_1020164371 | 3300032205 | Hardwood Forest Soil | MGVRRYLLVLDMDLLAVDEELDLEPINHLVARQEQEPCEVVVMSLVRS |
| Ga0306920_1019948881 | 3300032261 | Soil | MRRYLLVLDMDLLARNEEVDLEPVNYLVARQAQEPGEVVVLAVAA |
| Ga0335076_111117902 | 3300032955 | Soil | MGMRRYLLVLDMDLLAMDEEHDLEPINYLVARQEQD |
| Ga0370514_163186_440_574 | 3300034199 | Untreated Peat Soil | MGVQRYLLVLDMDLLALDEQLDLEPINYLVARQERGPCDVVVLSL |
| ⦗Top⦘ |