| Basic Information | |
|---|---|
| Family ID | F064927 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPPHVTERSNSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.53 % |
| % of genes near scaffold ends (potentially truncated) | 4.69 % |
| % of genes from short scaffolds (< 2000 bps) | 82.03 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.906 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.906 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.875 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01075 | Glyco_transf_9 | 10.16 |
| PF00107 | ADH_zinc_N | 9.38 |
| PF08240 | ADH_N | 6.25 |
| PF13378 | MR_MLE_C | 3.12 |
| PF13602 | ADH_zinc_N_2 | 3.12 |
| PF13414 | TPR_11 | 2.34 |
| PF13432 | TPR_16 | 2.34 |
| PF13417 | GST_N_3 | 0.78 |
| PF00072 | Response_reg | 0.78 |
| PF01052 | FliMN_C | 0.78 |
| PF14559 | TPR_19 | 0.78 |
| PF00753 | Lactamase_B | 0.78 |
| PF08402 | TOBE_2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 10.16 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.91 % |
| Unclassified | root | N/A | 21.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10002847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12631 | Open in IMG/M |
| 3300000567|JGI12270J11330_10005170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 9172 | Open in IMG/M |
| 3300001082|JGI12664J13189_1007689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100213741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1822 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101606072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 548 | Open in IMG/M |
| 3300005538|Ga0070731_10026560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3951 | Open in IMG/M |
| 3300005538|Ga0070731_10305845 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005542|Ga0070732_10000133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 66977 | Open in IMG/M |
| 3300005542|Ga0070732_10269247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300005591|Ga0070761_10050701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
| 3300005591|Ga0070761_10546216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 718 | Open in IMG/M |
| 3300005602|Ga0070762_10039979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2547 | Open in IMG/M |
| 3300005602|Ga0070762_10981175 | Not Available | 579 | Open in IMG/M |
| 3300005602|Ga0070762_10984832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 578 | Open in IMG/M |
| 3300005610|Ga0070763_10832419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300005921|Ga0070766_10737233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 668 | Open in IMG/M |
| 3300006052|Ga0075029_101000866 | Not Available | 577 | Open in IMG/M |
| 3300006102|Ga0075015_100556932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 667 | Open in IMG/M |
| 3300006176|Ga0070765_100226290 | Not Available | 1707 | Open in IMG/M |
| 3300006176|Ga0070765_100293310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
| 3300006176|Ga0070765_100676604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 974 | Open in IMG/M |
| 3300006176|Ga0070765_101172414 | Not Available | 726 | Open in IMG/M |
| 3300006354|Ga0075021_10993630 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006893|Ga0073928_10229389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1433 | Open in IMG/M |
| 3300006893|Ga0073928_10243501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1379 | Open in IMG/M |
| 3300006893|Ga0073928_10806481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 648 | Open in IMG/M |
| 3300006893|Ga0073928_11043957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 555 | Open in IMG/M |
| 3300009522|Ga0116218_1173263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 978 | Open in IMG/M |
| 3300009523|Ga0116221_1266321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300009525|Ga0116220_10476296 | Not Available | 564 | Open in IMG/M |
| 3300009665|Ga0116135_1448657 | Not Available | 529 | Open in IMG/M |
| 3300010379|Ga0136449_100546075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1995 | Open in IMG/M |
| 3300010379|Ga0136449_100833620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1517 | Open in IMG/M |
| 3300010379|Ga0136449_101791238 | Not Available | 919 | Open in IMG/M |
| 3300010379|Ga0136449_102240259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 795 | Open in IMG/M |
| 3300011120|Ga0150983_10099616 | Not Available | 573 | Open in IMG/M |
| 3300011120|Ga0150983_10247989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300011120|Ga0150983_14114705 | Not Available | 511 | Open in IMG/M |
| 3300011120|Ga0150983_15537392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300011120|Ga0150983_15538826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 539 | Open in IMG/M |
| 3300012083|Ga0154000_1098201 | Not Available | 614 | Open in IMG/M |
| 3300012181|Ga0153922_1058501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 857 | Open in IMG/M |
| 3300014164|Ga0181532_10772154 | Not Available | 516 | Open in IMG/M |
| 3300014489|Ga0182018_10139234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
| 3300014489|Ga0182018_10247881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300014489|Ga0182018_10708824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 524 | Open in IMG/M |
| 3300014501|Ga0182024_12654406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 537 | Open in IMG/M |
| 3300014657|Ga0181522_10066910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2040 | Open in IMG/M |
| 3300014657|Ga0181522_10839965 | Not Available | 564 | Open in IMG/M |
| 3300014657|Ga0181522_10953606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300017938|Ga0187854_10331735 | Not Available | 646 | Open in IMG/M |
| 3300017940|Ga0187853_10377046 | Not Available | 631 | Open in IMG/M |
| 3300018034|Ga0187863_10617688 | Not Available | 610 | Open in IMG/M |
| 3300018038|Ga0187855_10538665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 680 | Open in IMG/M |
| 3300019258|Ga0181504_1006483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 529 | Open in IMG/M |
| 3300019258|Ga0181504_1150089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 504 | Open in IMG/M |
| 3300019881|Ga0193707_1084401 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300019888|Ga0193751_1026641 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300020021|Ga0193726_1000073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 178058 | Open in IMG/M |
| 3300020579|Ga0210407_10540927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300020580|Ga0210403_10803255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 748 | Open in IMG/M |
| 3300020581|Ga0210399_10924993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 706 | Open in IMG/M |
| 3300020582|Ga0210395_10001797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 16644 | Open in IMG/M |
| 3300020583|Ga0210401_10261555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1590 | Open in IMG/M |
| 3300020583|Ga0210401_11340499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 573 | Open in IMG/M |
| 3300021088|Ga0210404_10130880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1298 | Open in IMG/M |
| 3300021170|Ga0210400_10469307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1039 | Open in IMG/M |
| 3300021171|Ga0210405_10023870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4933 | Open in IMG/M |
| 3300021181|Ga0210388_11167138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300021401|Ga0210393_10910322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300021401|Ga0210393_11507171 | Not Available | 535 | Open in IMG/M |
| 3300021402|Ga0210385_11070757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 619 | Open in IMG/M |
| 3300021403|Ga0210397_10615918 | Not Available | 830 | Open in IMG/M |
| 3300021404|Ga0210389_10138313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1886 | Open in IMG/M |
| 3300021404|Ga0210389_10831294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 721 | Open in IMG/M |
| 3300021420|Ga0210394_10056071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3435 | Open in IMG/M |
| 3300021420|Ga0210394_10341127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1316 | Open in IMG/M |
| 3300021432|Ga0210384_11216464 | Not Available | 658 | Open in IMG/M |
| 3300021432|Ga0210384_11698279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 537 | Open in IMG/M |
| 3300021474|Ga0210390_10335929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1279 | Open in IMG/M |
| 3300021559|Ga0210409_11671950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 513 | Open in IMG/M |
| 3300021861|Ga0213853_10380743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 519 | Open in IMG/M |
| 3300021861|Ga0213853_11536728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300022499|Ga0242641_1036251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 559 | Open in IMG/M |
| 3300022506|Ga0242648_1029002 | Not Available | 757 | Open in IMG/M |
| 3300022506|Ga0242648_1085337 | Not Available | 533 | Open in IMG/M |
| 3300022510|Ga0242652_1053384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 516 | Open in IMG/M |
| 3300022522|Ga0242659_1083680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 610 | Open in IMG/M |
| 3300022527|Ga0242664_1112968 | Not Available | 569 | Open in IMG/M |
| 3300022527|Ga0242664_1139213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 528 | Open in IMG/M |
| 3300022530|Ga0242658_1214641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 529 | Open in IMG/M |
| 3300022532|Ga0242655_10070697 | Not Available | 904 | Open in IMG/M |
| 3300022533|Ga0242662_10290979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 542 | Open in IMG/M |
| 3300022557|Ga0212123_10073010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2945 | Open in IMG/M |
| 3300022708|Ga0242670_1079305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300022721|Ga0242666_1134868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 594 | Open in IMG/M |
| 3300022722|Ga0242657_1223944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300022726|Ga0242654_10363587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 547 | Open in IMG/M |
| 3300024225|Ga0224572_1035114 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300025494|Ga0207928_1067878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 667 | Open in IMG/M |
| 3300027090|Ga0208604_1000295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7219 | Open in IMG/M |
| 3300027370|Ga0209010_1000855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8672 | Open in IMG/M |
| 3300027439|Ga0209332_1000776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7120 | Open in IMG/M |
| 3300027497|Ga0208199_1067884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 750 | Open in IMG/M |
| 3300027567|Ga0209115_1003987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2910 | Open in IMG/M |
| 3300027570|Ga0208043_1017905 | Not Available | 2277 | Open in IMG/M |
| 3300027583|Ga0209527_1061009 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300027678|Ga0209011_1008573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3458 | Open in IMG/M |
| 3300027842|Ga0209580_10000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1658941 | Open in IMG/M |
| 3300027884|Ga0209275_10696041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 585 | Open in IMG/M |
| 3300027908|Ga0209006_10063914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3288 | Open in IMG/M |
| 3300027908|Ga0209006_10332975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1289 | Open in IMG/M |
| 3300028906|Ga0308309_10664235 | Not Available | 905 | Open in IMG/M |
| 3300028906|Ga0308309_10886915 | Not Available | 774 | Open in IMG/M |
| 3300030743|Ga0265461_12998720 | Not Available | 567 | Open in IMG/M |
| 3300030832|Ga0265752_108253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300030862|Ga0265753_1029257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 880 | Open in IMG/M |
| 3300030873|Ga0265751_115473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 524 | Open in IMG/M |
| 3300030963|Ga0265768_113793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031018|Ga0265773_1048197 | Not Available | 505 | Open in IMG/M |
| 3300031090|Ga0265760_10009234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2818 | Open in IMG/M |
| 3300031708|Ga0310686_103101062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1101 | Open in IMG/M |
| 3300031708|Ga0310686_107374327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300031715|Ga0307476_10001552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 13915 | Open in IMG/M |
| 3300031715|Ga0307476_10642017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 787 | Open in IMG/M |
| 3300032160|Ga0311301_11354280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 893 | Open in IMG/M |
| 3300032160|Ga0311301_11580967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300032805|Ga0335078_11766620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 10.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.34% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.34% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012083 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC084 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030832 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100028477 | 3300000567 | Peatlands Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLIVTIACVFGI* |
| JGI12270J11330_100051704 | 3300000567 | Peatlands Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLVVAIACVFGI* |
| JGI12664J13189_10076892 | 3300001082 | Forest Soil | MPPHVTERSHSSRYDGVEIMTIGLGVLLIVAIACVFGI* |
| JGIcombinedJ26739_1002137412 | 3300002245 | Forest Soil | MPPHVTERSGAPRYDGIEILTIGLGVLLIVTIACVFGI* |
| JGIcombinedJ26739_1016060721 | 3300002245 | Forest Soil | MPPHVTERTSSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0070731_100265602 | 3300005538 | Surface Soil | MPPHVTERSSSSRYDGVEIMTIGLGVLLVVAIACVFGI* |
| Ga0070731_103058453 | 3300005538 | Surface Soil | MPPHVTERSNSSRYDGVEIMTIGLGVLLIVAIACVFGI* |
| Ga0070732_1000013333 | 3300005542 | Surface Soil | MPPHVTEHSSMPRYDGIEIMTIGLGVLLVVAIACVFGI* |
| Ga0070732_102692472 | 3300005542 | Surface Soil | MPPYVTERSSTPRYDGIEIMTIGLGVLLVVAIACVFGI* |
| Ga0070761_100507012 | 3300005591 | Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLIVTIACVFGI* |
| Ga0070761_105462162 | 3300005591 | Soil | MPPHVTERSSAPRYDGIEILTIGLGVLLIVAIACVFGI* |
| Ga0070762_100399793 | 3300005602 | Soil | MPPHVTGSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0070762_109811751 | 3300005602 | Soil | MPPHVTERSSASRYDGIEILTIGLGVLLIVAIACVFGI* |
| Ga0070762_109848322 | 3300005602 | Soil | MPPQVTERSNSSRYDGVEIMTIGLGVVLIVAIACVFGI* |
| Ga0070763_108324191 | 3300005610 | Soil | SSTSEREARVMPPHVTERPNSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0070766_107372332 | 3300005921 | Soil | MPPHVTERSNSSRYDGIEIMTIGIGVLLVVAIACVFGI* |
| Ga0075029_1010008662 | 3300006052 | Watersheds | MPPQVSERSSTPRYDGIEIMTIGLGILLVVTIACVFGI* |
| Ga0075015_1005569323 | 3300006102 | Watersheds | MPPHITERTNSTRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0070765_1002262903 | 3300006176 | Soil | MPPHVTQRSSSSRYDGIEIMTIGLGVLLVVAIACVFGI* |
| Ga0070765_1002933103 | 3300006176 | Soil | MPPHVTERSSAWRYDGIEILTIGLGVLLIVAIACVFGI* |
| Ga0070765_1006766042 | 3300006176 | Soil | MPPHVAERSSASRYDGIEILTIGLGVLLIVAIACVFGI* |
| Ga0070765_1011724142 | 3300006176 | Soil | MPPHVNERSSSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0075021_109936302 | 3300006354 | Watersheds | MPLHVSERTNSSRYDGIEIMTIGVGILLVVTIACVFGI* |
| Ga0073928_102293893 | 3300006893 | Iron-Sulfur Acid Spring | MPPHVTERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0073928_102435013 | 3300006893 | Iron-Sulfur Acid Spring | MPPHVSERSSASRYDGIEILTIGLGVLLVVAIACVFGI* |
| Ga0073928_108064812 | 3300006893 | Iron-Sulfur Acid Spring | MPPHVTERSSSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0073928_110439572 | 3300006893 | Iron-Sulfur Acid Spring | MPPHVTERTSSLRYDGIEMMTIGLGVLLVVTIACVFGI* |
| Ga0116218_11732633 | 3300009522 | Peatlands Soil | MPPHVTERPSSSRYDGIEIMTIGLGVLLIVTIACVFGI* |
| Ga0116221_12663212 | 3300009523 | Peatlands Soil | MPPHVTERTNSSRFDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0116220_104762962 | 3300009525 | Peatlands Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0116135_14486572 | 3300009665 | Peatland | MPPHVTERPNSSRYDGIEIMTIGLGVVLIVAIACVFGI* |
| Ga0136449_1005460751 | 3300010379 | Peatlands Soil | MPPHVTELTISSRFDGNEIMTIGLGVLLVVTIACVFGI* |
| Ga0136449_1008336203 | 3300010379 | Peatlands Soil | MPPHVTERSNASRYDGIEILTIGLGVLLIVAIACVFGV* |
| Ga0136449_1017912382 | 3300010379 | Peatlands Soil | MPPHITERSNSSRYDGIEILTIGLGVLLIVAIACVFGI* |
| Ga0136449_1022402593 | 3300010379 | Peatlands Soil | MPPHVTERSNPSRYDGIEILTIGLGVLLIVTIACVFGI* |
| Ga0150983_100996162 | 3300011120 | Forest Soil | MPPHVTERTNSYDGIESMTIGLGVLLVVTIACVFGI* |
| Ga0150983_102479892 | 3300011120 | Forest Soil | MPPHVSERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0150983_141147052 | 3300011120 | Forest Soil | MPPHITERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI* |
| Ga0150983_155373922 | 3300011120 | Forest Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLVVAIACVFGI* |
| Ga0150983_155388262 | 3300011120 | Forest Soil | MPPHVTERSNSSRYDGIEILTIGLGVLLIVTIACVFGI* |
| Ga0154000_10982011 | 3300012083 | Attine Ant Fungus Gardens | RVMPPHVTERSNSSRYDGVEIMTIGLGVLLIVAIACVFGI* |
| Ga0153922_10585012 | 3300012181 | Attine Ant Fungus Gardens | MPPHVTERSNSSRYDGIEIMTIGIGVLLVVAIVCVFGV* |
| Ga0181532_107721541 | 3300014164 | Bog | MPPHVTERSNSSRYDGVEIMTIGLGVVLIVAIACVFGI* |
| Ga0182018_101392343 | 3300014489 | Palsa | MPPHVTEHSNSSRYDGIEIMTIGLGVLLVVAIACVFGI* |
| Ga0182018_102478811 | 3300014489 | Palsa | MPPHVTERSNASRYDGIEIMTIGLGVVLIVAIACVFGI* |
| Ga0182018_107088241 | 3300014489 | Palsa | MPPHVTECSSASRYDGIEIMTIGLGVLLIVAIACVFGI* |
| Ga0182024_126544061 | 3300014501 | Permafrost | MPPHVTERSSASRYDGIEILTIGLGVLLVVAIACVFGI* |
| Ga0181522_100669103 | 3300014657 | Bog | MPPQISERSSTPRYDGIEIMTIGLGILLVVTIACVFGI* |
| Ga0181522_108399651 | 3300014657 | Bog | MPPHVTERSNASRYDGIEIITIGLGVLLIVAIACVFGV* |
| Ga0181522_109536062 | 3300014657 | Bog | MPPHVTERSNSSRYDGIEIMTIGLGVLLIVAIACVFGI* |
| Ga0187854_103317352 | 3300017938 | Peatland | MPPHVTERSNSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0187853_103770461 | 3300017940 | Peatland | REARVMPPHVTERSNSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0187863_106176882 | 3300018034 | Peatland | MPPHVTERSNSSRYDGVEIMTIGLGVLLIVAIACVFGI |
| Ga0187855_105386652 | 3300018038 | Peatland | MPPHVTERPNSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0181504_10064832 | 3300019258 | Peatland | MPPHVTERSNASRYDGIEIITIGLGVLLIVAIACVFGV |
| Ga0181504_11500892 | 3300019258 | Peatland | MPPQISERSSTPRYDGIEIMTIGLGILLVVTIACVFGI |
| Ga0193707_10844012 | 3300019881 | Soil | MPPHVTEHSNSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0193751_10266413 | 3300019888 | Soil | MPPHVTERTSSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0193726_1000073116 | 3300020021 | Soil | MPPHVTEHSSSSRYDGIEIMTIGLGVLLVVAIACVFGV |
| Ga0210407_105409273 | 3300020579 | Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLIVTIACVFGI |
| Ga0210403_108032552 | 3300020580 | Soil | MPPHVTERTNSSRYDGIEIMTIGLGVLLVVTIACMFGI |
| Ga0210399_109249932 | 3300020581 | Soil | MPPHVTERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210395_100017976 | 3300020582 | Soil | MPPHVTERPNSSRYDGIEIMTIGLGVVLIVAMACVFGI |
| Ga0210401_102615552 | 3300020583 | Soil | MPPHVTERTNSYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210401_113404991 | 3300020583 | Soil | MPPHVTGSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210404_101308803 | 3300021088 | Soil | MPPHVTERSSASRYDGIEILTIGLGVVLIVAIACVFGI |
| Ga0210400_104693073 | 3300021170 | Soil | MPPHVTERSSASRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0210405_100238702 | 3300021171 | Soil | MPPHVSERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210388_111671382 | 3300021181 | Soil | MPPHVTERSSAPRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0210393_109103222 | 3300021401 | Soil | MPPHVTERSSAPRYDGVEILTIGLGVLLIVAIACVFGI |
| Ga0210393_115071712 | 3300021401 | Soil | MPPHVNERSSSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210385_110707572 | 3300021402 | Soil | MPPHVTERSSASRYDGIEILTIGLGVLLIVAIACVF |
| Ga0210397_106159182 | 3300021403 | Soil | EREARVMPPHVTERSSASRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0210389_101383132 | 3300021404 | Soil | MPPHVTGSSRYEGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210389_108312941 | 3300021404 | Soil | MPPHVTERTNSYDGIEILTIGLGVLLVVTIACVFGI |
| Ga0210394_100560713 | 3300021420 | Soil | MPPHVTERSNFSRYDSIEIMTICLGVLLVVTIACVFGI |
| Ga0210394_103411273 | 3300021420 | Soil | MPPHVTERSNSSRYDGIEIMTIGIGVLLVVAIVCVFGV |
| Ga0210384_112164641 | 3300021432 | Soil | MPPHVTERPNSSRYDGIEIMTISLGVVLIVAMACVFGI |
| Ga0210384_116982791 | 3300021432 | Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0210390_103359293 | 3300021474 | Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLIVAIACVFGI |
| Ga0210409_116719501 | 3300021559 | Soil | MPPHVTGSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0213853_103807431 | 3300021861 | Watersheds | MPPHVTERTNSSRYDGIEIMTIGLGVLLVVTIACVFGM |
| Ga0213853_115367281 | 3300021861 | Watersheds | HVSERASSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0242641_10362511 | 3300022499 | Soil | MPPHVTERSSAWRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0242648_10290022 | 3300022506 | Soil | MPPQVTERSSASRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0242648_10853372 | 3300022506 | Soil | MPPHVTERTNPSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0242652_10533842 | 3300022510 | Soil | MPPHVTERTNSSRYDGIEIITIGLGVLLVVTIACVFGI |
| Ga0242659_10836802 | 3300022522 | Soil | MPPYVTERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0242664_11129682 | 3300022527 | Soil | MPPHVTERSSSSRYDGVEIMTIGLGVLLVVAIACVFGI |
| Ga0242664_11392132 | 3300022527 | Soil | MPPHVTERSSASRYDGIEILTIGLGVLLIVAIACVCGI |
| Ga0242658_12146412 | 3300022530 | Soil | MPPHVTERTNSSRYDGVEIMTIGLGVLLVVTIACVFGI |
| Ga0242655_100706972 | 3300022532 | Soil | VMPPHVTERSSAPRYDGVEILTIGLGVLLIVAIACVFGI |
| Ga0242662_102909792 | 3300022533 | Soil | MPPHITERTNSYRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0212123_100730103 | 3300022557 | Iron-Sulfur Acid Spring | MPPHVSERSSASRYDGIEILTIGLGVLLVVAIACVFGI |
| Ga0242670_10793052 | 3300022708 | Soil | MPPHVTGSSRYERIEIMTIGLGVLLVVTIACVFGI |
| Ga0242666_11348682 | 3300022721 | Soil | MPPHVTERPNSSRYDGIEIITIGLGVVLIVAMACVFGI |
| Ga0242657_12239442 | 3300022722 | Soil | MPPHITERTNSSRYDGIEIMTIVLGVLLVVTIACVFGV |
| Ga0242654_103635872 | 3300022726 | Soil | MPPHVSERTTSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0224572_10351143 | 3300024225 | Rhizosphere | MPPHVTERSNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0207928_10678782 | 3300025494 | Arctic Peat Soil | MPPQVTERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0208604_10002953 | 3300027090 | Forest Soil | MPPHVCERTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0209010_10008552 | 3300027370 | Forest Soil | MPPHVTERSHSSRYDGVEIMTIGLGVLLIVAIACVFGI |
| Ga0209332_10007765 | 3300027439 | Forest Soil | MPPHVTGRSNSSRYDGIEIMTIGIGVLLVVAIVCVFGV |
| Ga0208199_10678841 | 3300027497 | Peatlands Soil | MPPHVTERPSSSRYDGIEIMTIGLGVLLIVTIACVFGI |
| Ga0209115_10039872 | 3300027567 | Forest Soil | MPPHVTERSNSPRYDGIEIMTIGLGVLLIVAIACVFGI |
| Ga0208043_10179053 | 3300027570 | Peatlands Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLIVTIACVFGI |
| Ga0209527_10610092 | 3300027583 | Forest Soil | MPPHVTERSSSSRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0209011_10085733 | 3300027678 | Forest Soil | MPPHVTERSSASRYDGIEILTIGVGVLLVVAIACVFGV |
| Ga0209580_10000001846 | 3300027842 | Surface Soil | MPPHVTEHSSMPRYDGIEIMTIGLGVLLVVAIACVFGI |
| Ga0209275_106960411 | 3300027884 | Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLIVAIACVFGI |
| Ga0209006_100639142 | 3300027908 | Forest Soil | MPPHVTERSGAPRYDGIEILTIGLGVLLIVTIACVFGI |
| Ga0209006_103329751 | 3300027908 | Forest Soil | MPPHVTERTNSPRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0308309_106642352 | 3300028906 | Soil | MPPHVAERSSASRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0308309_108869151 | 3300028906 | Soil | MPPQVTERSNSSRYDGVEIMTIGLGVVLIVAIACVFGI |
| Ga0265461_129987202 | 3300030743 | Soil | MPPHFEHSGMSRYDGIEILTVGLGVVLIVTIVLVFGL |
| Ga0265752_1082532 | 3300030832 | Soil | MPPHVSERSSASRYDGIEILTIGLGVLLIVAIACVFGI |
| Ga0265753_10292573 | 3300030862 | Soil | MPPHVTERTNPSRYDGIEIMTIGLGVLLIVTIACVFGI |
| Ga0265751_1154732 | 3300030873 | Soil | MPPHVTERSNSSRYDGVEIMTIGLGVLLIVAISCVFGI |
| Ga0265768_1137932 | 3300030963 | Soil | MPPHVTERSSAWRYDGVEILTIGLGVLLIVAIACVFGI |
| Ga0265773_10481972 | 3300031018 | Soil | MPPHVTERPNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0265760_100092342 | 3300031090 | Soil | MPPHVTERSSASRYDGVEILTIGLGILLIVAIACVFGI |
| Ga0310686_1031010622 | 3300031708 | Soil | MPPHVTERTSSSRYDGIEIMTIGLGVLLVVTIACAFGI |
| Ga0310686_1073743272 | 3300031708 | Soil | MPPHLTERSNSSRYDGVEIMTIGLGVLLIVAIACVFGI |
| Ga0307476_100015526 | 3300031715 | Hardwood Forest Soil | MPPHVSERSNSSRYDGIEIMTIGIGVLLVVAIVCVFGV |
| Ga0307476_106420171 | 3300031715 | Hardwood Forest Soil | MPPHVTDRTNSSRYDGIEIMTIGLGVLLVVTIACVFGI |
| Ga0311301_113542802 | 3300032160 | Peatlands Soil | MPPHVTERSNASRYDGIEILTIGLGVLLIVAIACVFGV |
| Ga0311301_115809673 | 3300032160 | Peatlands Soil | MPPHVTERSNPSRYDGIEILTIGLGVLLIVTIACVFGI |
| Ga0335078_117666202 | 3300032805 | Soil | MPPHVTERSNSSRYDGIEIMTIGLGVLLIVAIACVFGV |
| ⦗Top⦘ |