| Basic Information | |
|---|---|
| Family ID | F064912 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.12 % |
| % of genes near scaffold ends (potentially truncated) | 60.94 % |
| % of genes from short scaffolds (< 2000 bps) | 89.06 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (39.062 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF07879 | PHB_acc_N | 44.53 |
| PF00108 | Thiolase_N | 39.06 |
| PF02803 | Thiolase_C | 5.47 |
| PF00563 | EAL | 5.47 |
| PF13561 | adh_short_C2 | 1.56 |
| PF00106 | adh_short | 0.78 |
| PF01420 | Methylase_S | 0.78 |
| PF13847 | Methyltransf_31 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 44.53 |
| COG5394 | Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHA | Signal transduction mechanisms [T] | 44.53 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 5.47 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 5.47 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 5.47 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 5.47 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.94 % |
| Unclassified | root | N/A | 39.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01CAJL6 | Not Available | 514 | Open in IMG/M |
| 2170459009|GA8DASG01AHELF | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 523 | Open in IMG/M |
| 2170459019|G14TP7Y02HM4TZ | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 638 | Open in IMG/M |
| 3300000897|JGI12167J12862_102302 | Not Available | 515 | Open in IMG/M |
| 3300001593|JGI12635J15846_10405182 | Not Available | 822 | Open in IMG/M |
| 3300001593|JGI12635J15846_10492476 | Not Available | 724 | Open in IMG/M |
| 3300002077|JGI24744J21845_10085644 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 577 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100534069 | Not Available | 1050 | Open in IMG/M |
| 3300002886|JGI25612J43240_1030074 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 797 | Open in IMG/M |
| 3300002910|JGI25615J43890_1052387 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 675 | Open in IMG/M |
| 3300003992|Ga0055470_10036903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 1015 | Open in IMG/M |
| 3300004070|Ga0055488_10102188 | Not Available | 700 | Open in IMG/M |
| 3300004079|Ga0055514_10040539 | Not Available | 966 | Open in IMG/M |
| 3300005171|Ga0066677_10073671 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1760 | Open in IMG/M |
| 3300005333|Ga0070677_10638374 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 594 | Open in IMG/M |
| 3300005334|Ga0068869_100779333 | Not Available | 820 | Open in IMG/M |
| 3300005340|Ga0070689_101235115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 671 | Open in IMG/M |
| 3300005347|Ga0070668_100697032 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 895 | Open in IMG/M |
| 3300005347|Ga0070668_101999378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 534 | Open in IMG/M |
| 3300005354|Ga0070675_101738078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 575 | Open in IMG/M |
| 3300005355|Ga0070671_101237661 | Not Available | 657 | Open in IMG/M |
| 3300005356|Ga0070674_100472189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 1039 | Open in IMG/M |
| 3300005441|Ga0070700_100165024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1528 | Open in IMG/M |
| 3300005457|Ga0070662_101971544 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 504 | Open in IMG/M |
| 3300005458|Ga0070681_11092290 | Not Available | 718 | Open in IMG/M |
| 3300005518|Ga0070699_100260665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1550 | Open in IMG/M |
| 3300005547|Ga0070693_100761015 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 715 | Open in IMG/M |
| 3300005547|Ga0070693_101527161 | Not Available | 522 | Open in IMG/M |
| 3300005557|Ga0066704_10637552 | Not Available | 679 | Open in IMG/M |
| 3300005576|Ga0066708_10121513 | Not Available | 1575 | Open in IMG/M |
| 3300005591|Ga0070761_10246961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1066 | Open in IMG/M |
| 3300005712|Ga0070764_10113923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1457 | Open in IMG/M |
| 3300006057|Ga0075026_100383365 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 787 | Open in IMG/M |
| 3300006058|Ga0075432_10360026 | Not Available | 619 | Open in IMG/M |
| 3300006176|Ga0070765_100699188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 957 | Open in IMG/M |
| 3300006353|Ga0075370_10407966 | Not Available | 815 | Open in IMG/M |
| 3300006914|Ga0075436_101371692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
| 3300007255|Ga0099791_10381442 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 677 | Open in IMG/M |
| 3300007788|Ga0099795_10591830 | Not Available | 527 | Open in IMG/M |
| 3300009088|Ga0099830_10870140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 744 | Open in IMG/M |
| 3300009551|Ga0105238_11715187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 659 | Open in IMG/M |
| 3300009553|Ga0105249_11377300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 777 | Open in IMG/M |
| 3300009651|Ga0105859_1235460 | Not Available | 551 | Open in IMG/M |
| 3300010321|Ga0134067_10267522 | Not Available | 649 | Open in IMG/M |
| 3300010335|Ga0134063_10561919 | Not Available | 577 | Open in IMG/M |
| 3300010375|Ga0105239_13277785 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 527 | Open in IMG/M |
| 3300011119|Ga0105246_12375758 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 519 | Open in IMG/M |
| 3300011269|Ga0137392_10994816 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 689 | Open in IMG/M |
| 3300012202|Ga0137363_10408458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1132 | Open in IMG/M |
| 3300012202|Ga0137363_11127086 | Not Available | 667 | Open in IMG/M |
| 3300012202|Ga0137363_11140460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300012202|Ga0137363_11399666 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 589 | Open in IMG/M |
| 3300012205|Ga0137362_10061146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3097 | Open in IMG/M |
| 3300012359|Ga0137385_10885222 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 739 | Open in IMG/M |
| 3300012488|Ga0157343_1023063 | Not Available | 578 | Open in IMG/M |
| 3300012892|Ga0157294_10118160 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 702 | Open in IMG/M |
| 3300012908|Ga0157286_10213044 | Not Available | 659 | Open in IMG/M |
| 3300012917|Ga0137395_10956480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 616 | Open in IMG/M |
| 3300012924|Ga0137413_10058260 | Not Available | 2268 | Open in IMG/M |
| 3300012927|Ga0137416_10984242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 753 | Open in IMG/M |
| 3300012929|Ga0137404_10888513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 812 | Open in IMG/M |
| 3300012930|Ga0137407_12293806 | Not Available | 516 | Open in IMG/M |
| 3300012958|Ga0164299_10376134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 903 | Open in IMG/M |
| 3300012960|Ga0164301_10498497 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 878 | Open in IMG/M |
| 3300012972|Ga0134077_10301898 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 673 | Open in IMG/M |
| 3300012985|Ga0164308_11112816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 708 | Open in IMG/M |
| 3300012986|Ga0164304_10184844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1347 | Open in IMG/M |
| 3300012989|Ga0164305_10818555 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 774 | Open in IMG/M |
| 3300013102|Ga0157371_10869596 | Not Available | 682 | Open in IMG/M |
| 3300013306|Ga0163162_10549889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1283 | Open in IMG/M |
| 3300013308|Ga0157375_13736249 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 506 | Open in IMG/M |
| 3300013768|Ga0120155_1112030 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 756 | Open in IMG/M |
| 3300014058|Ga0120149_1216623 | Not Available | 536 | Open in IMG/M |
| 3300014489|Ga0182018_10469802 | Not Available | 667 | Open in IMG/M |
| 3300015242|Ga0137412_11019392 | Not Available | 591 | Open in IMG/M |
| 3300015373|Ga0132257_104547844 | Not Available | 505 | Open in IMG/M |
| 3300018038|Ga0187855_10062779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2286 | Open in IMG/M |
| 3300018431|Ga0066655_11170144 | Not Available | 543 | Open in IMG/M |
| 3300018476|Ga0190274_10473812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1242 | Open in IMG/M |
| 3300019888|Ga0193751_1121166 | Not Available | 975 | Open in IMG/M |
| 3300021363|Ga0193699_10027536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2111 | Open in IMG/M |
| 3300021406|Ga0210386_11081226 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 682 | Open in IMG/M |
| 3300021407|Ga0210383_11687218 | Not Available | 519 | Open in IMG/M |
| 3300021474|Ga0210390_10522175 | Not Available | 999 | Open in IMG/M |
| 3300023260|Ga0247798_1024459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 768 | Open in IMG/M |
| 3300024288|Ga0179589_10521278 | Not Available | 552 | Open in IMG/M |
| 3300025664|Ga0208849_1004541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6069 | Open in IMG/M |
| 3300025916|Ga0207663_11170463 | Not Available | 619 | Open in IMG/M |
| 3300025922|Ga0207646_10932803 | Not Available | 769 | Open in IMG/M |
| 3300025932|Ga0207690_11397271 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 585 | Open in IMG/M |
| 3300025933|Ga0207706_10398960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1192 | Open in IMG/M |
| 3300025936|Ga0207670_10616071 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 892 | Open in IMG/M |
| 3300025937|Ga0207669_10381401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1098 | Open in IMG/M |
| 3300025940|Ga0207691_10220928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300025960|Ga0207651_10541527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1011 | Open in IMG/M |
| 3300026023|Ga0207677_10368961 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300026118|Ga0207675_100644655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1065 | Open in IMG/M |
| 3300026300|Ga0209027_1016238 | Not Available | 2820 | Open in IMG/M |
| 3300026304|Ga0209240_1178552 | Not Available | 644 | Open in IMG/M |
| 3300026316|Ga0209155_1023347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2568 | Open in IMG/M |
| 3300026530|Ga0209807_1013556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4006 | Open in IMG/M |
| 3300026551|Ga0209648_10017860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 6191 | Open in IMG/M |
| 3300026557|Ga0179587_11105639 | Not Available | 522 | Open in IMG/M |
| 3300027119|Ga0209522_1031064 | Not Available | 651 | Open in IMG/M |
| 3300027505|Ga0209218_1099115 | Not Available | 609 | Open in IMG/M |
| 3300027521|Ga0209524_1005102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2493 | Open in IMG/M |
| 3300027546|Ga0208984_1111960 | Not Available | 590 | Open in IMG/M |
| 3300027645|Ga0209117_1023455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1977 | Open in IMG/M |
| 3300027663|Ga0208990_1047374 | Not Available | 1300 | Open in IMG/M |
| 3300027678|Ga0209011_1171859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 602 | Open in IMG/M |
| 3300027681|Ga0208991_1061076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1137 | Open in IMG/M |
| 3300027846|Ga0209180_10419963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 756 | Open in IMG/M |
| 3300027979|Ga0209705_10475156 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 613 | Open in IMG/M |
| 3300028047|Ga0209526_10003076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 11325 | Open in IMG/M |
| 3300028536|Ga0137415_10081837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3087 | Open in IMG/M |
| 3300028786|Ga0307517_10644377 | Not Available | 516 | Open in IMG/M |
| 3300028787|Ga0307323_10233335 | Not Available | 664 | Open in IMG/M |
| 3300030000|Ga0311337_11439380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis | 604 | Open in IMG/M |
| 3300030763|Ga0265763_1016100 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 747 | Open in IMG/M |
| 3300030764|Ga0265720_1003607 | Not Available | 833 | Open in IMG/M |
| 3300031128|Ga0170823_11633996 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 599 | Open in IMG/M |
| 3300031231|Ga0170824_126413352 | Not Available | 595 | Open in IMG/M |
| 3300031249|Ga0265339_10398789 | Not Available | 643 | Open in IMG/M |
| 3300031708|Ga0310686_101249331 | Not Available | 791 | Open in IMG/M |
| 3300031730|Ga0307516_10142560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2164 | Open in IMG/M |
| 3300034129|Ga0370493_0007182 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
| 3300034268|Ga0372943_0531006 | Not Available | 769 | Open in IMG/M |
| 3300034384|Ga0372946_0158067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1084 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.34% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000897 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06209130 | 2170459005 | Grass Soil | MHTEDKEPNGTAEGKTRNASQQSKHFQCGSATVFVHDG |
| F47_08658580 | 2170459009 | Grass Soil | EDGNPTGFAAGQTGNASQQNKHFHGGSATVLCAKVNCKA |
| 4MG_03441030 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | GWSDFAMGSHIDTESGEPDGSAEGQTSSATQQSKHFQCGSATVLCGTVNSKAWRLLRKLPATLF |
| JGI12167J12862_1023022 | 3300000897 | Forest Soil | MGSHMHTEDKEPDGIAEGQTSNATQQSKHFQXGSATVLCATVNSKA* |
| JGI12635J15846_104051822 | 3300001593 | Forest Soil | MHTEDGEPDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLWNVP* |
| JGI12635J15846_104924762 | 3300001593 | Forest Soil | MGSHVHTWEKGKTWDKEPDGVAEGLTSSASQQSKHFQLGSATVLCATVNSKA* |
| JGI24744J21845_100856442 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWN |
| JGIcombinedJ26739_1005340691 | 3300002245 | Forest Soil | LIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA* |
| JGI25612J43240_10300742 | 3300002886 | Grasslands Soil | MHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLCTTVNSEA |
| JGI25615J43890_10523871 | 3300002910 | Grasslands Soil | MHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLCTTVNS |
| Ga0055470_100369031 | 3300003992 | Natural And Restored Wetlands | DFAMGSHINTESGEPDGIADGQTSNATQQSKHFQRGSATVLCGTVNSKAWRLLWKPPSALF* |
| Ga0055488_101021882 | 3300004070 | Natural And Restored Wetlands | TESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSPGSI* |
| Ga0055514_100405391 | 3300004079 | Natural And Restored Wetlands | RLAYFLIVVGWSDFAMGSHIHTESGEPDGFAGGQTSSATQQSKHFQCGSATVLCGTVNSKA* |
| Ga0066677_100736712 | 3300005171 | Soil | MVVGWSDFAMDSHMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS* |
| Ga0070677_106383742 | 3300005333 | Miscanthus Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVN |
| Ga0068869_1007793331 | 3300005334 | Miscanthus Rhizosphere | SGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0070689_1012351151 | 3300005340 | Switchgrass Rhizosphere | EPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0070668_1006970321 | 3300005347 | Switchgrass Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKP |
| Ga0070668_1019993781 | 3300005347 | Switchgrass Rhizosphere | MGSHNAHREREPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKA |
| Ga0070675_1017380781 | 3300005354 | Miscanthus Rhizosphere | PDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLWKLPDALF* |
| Ga0070671_1012376611 | 3300005355 | Switchgrass Rhizosphere | EREPDGFAGGQTSSATQQSKHFQSGSATVLCGTVNPKAWALLWKLSGAPF* |
| Ga0070674_1004721891 | 3300005356 | Miscanthus Rhizosphere | MVVGCSDFAMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSPGSI* |
| Ga0070700_1001650241 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWK |
| Ga0070662_1019715441 | 3300005457 | Corn Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWK |
| Ga0070681_110922902 | 3300005458 | Corn Rhizosphere | LIVVGWSDFAMGSHMHTEDKEPDGIAEGQTDNASQQSKHFQCGSATVLCATVDSKA* |
| Ga0070699_1002606651 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0070693_1007610152 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTEDKEPDGIAEGQTDNASQQSKHFQCGSATVLCATVDSKA* |
| Ga0070693_1015271611 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVGLSVFAMNYPAATESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGSI* |
| Ga0066704_106375522 | 3300005557 | Soil | DFAMGSHIDTESGEPDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPGALF* |
| Ga0066708_101215132 | 3300005576 | Soil | MHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS* |
| Ga0070761_102469612 | 3300005591 | Soil | MGSHMHTWEKGKTWDKEPDGVAEELTSSASQQSKHFQLGSATVLCATVNSKA* |
| Ga0070764_101139233 | 3300005712 | Soil | MGSHVHTEDKEPDGIAEGLTSNATQQSKHFQCGSATVLCGTVNSKA |
| Ga0075026_1003833651 | 3300006057 | Watersheds | PDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKASALLRKLP* |
| Ga0075432_103600261 | 3300006058 | Populus Rhizosphere | EPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGLI* |
| Ga0070765_1006991883 | 3300006176 | Soil | MHTEDKEPDGIAEGLTSNASQQSKHFQRGSATVLCGTVNSEA |
| Ga0075370_104079661 | 3300006353 | Populus Endosphere | MGSHNAHREREPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTL |
| Ga0075436_1013716922 | 3300006914 | Populus Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATILCGTVNSKAWRLLWKLPDALF* |
| Ga0099791_103814422 | 3300007255 | Vadose Zone Soil | MGSHMHTEDKEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSQGSI* |
| Ga0099795_105918302 | 3300007788 | Vadose Zone Soil | MGSHMHTEDKEPAGTAEGKTRNASQQSKHFQCGSATVLCTTVNSEACLQLG |
| Ga0099830_108701402 | 3300009088 | Vadose Zone Soil | MHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA* |
| Ga0105238_117151872 | 3300009551 | Corn Rhizosphere | LIVVGCSDLAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLRKLPAALF* |
| Ga0105249_113773002 | 3300009553 | Switchgrass Rhizosphere | MGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWG |
| Ga0105859_12354602 | 3300009651 | Permafrost Soil | SVFAMGSHMHTEDKEPDGIAEGQKSSASQQSKHFQCGSATVLCATVNSKA* |
| Ga0134067_102675221 | 3300010321 | Grasslands Soil | MGSHKTSREREPDGIAAGPNATHRSKGKHFQRASATVLCGTVNPKASPLLRKLPGQLF* |
| Ga0134063_105619192 | 3300010335 | Grasslands Soil | MDSHMHTEDKEPDGWAEGLTSNATQQSKHFQWGSATVLCGTVNRSG* |
| Ga0105239_132777852 | 3300010375 | Corn Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPS |
| Ga0105246_123757582 | 3300011119 | Miscanthus Rhizosphere | MGSHIDTESGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWRL |
| Ga0137392_109948162 | 3300011269 | Vadose Zone Soil | MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA* |
| Ga0137363_104084582 | 3300012202 | Vadose Zone Soil | MHTEEKEPDGIAEGRTSSASQQSNHFQRGSATVLCAKVNFEA* |
| Ga0137363_111270862 | 3300012202 | Vadose Zone Soil | RFAYFLIVVGWSDFAMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATANSKA* |
| Ga0137363_111404602 | 3300012202 | Vadose Zone Soil | MHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA* |
| Ga0137363_113996661 | 3300012202 | Vadose Zone Soil | MGSHIDTESGEPDGITGGQTSNATQQSKHFQCGSATVLCGTVNPKAWALLWKPPETLI* |
| Ga0137362_100611463 | 3300012205 | Vadose Zone Soil | MGSHMHTEEKEPDGIAEGRTSSASQQSNHFQRGSATVLCAKVNFEA* |
| Ga0137385_108852221 | 3300012359 | Vadose Zone Soil | MGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSGALF* |
| Ga0157343_10230632 | 3300012488 | Arabidopsis Rhizosphere | VVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0157294_101181602 | 3300012892 | Soil | MGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0157286_102130441 | 3300012908 | Soil | NGIAEGQTSNATQQSKHFQCGSATVLCGTVNPKA* |
| Ga0137395_109564802 | 3300012917 | Vadose Zone Soil | MGSHMHTEEKEPDGIAEGWTSNASQQSNHFQCGSATVLCAKVNFEA* |
| Ga0137413_100582603 | 3300012924 | Vadose Zone Soil | MGSHMHTEDKEPDGIAEGRTSNALQQSKHFQLTSATILCATVNFKA* |
| Ga0137416_109842422 | 3300012927 | Vadose Zone Soil | MGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLRKLPEALF* |
| Ga0137404_108885132 | 3300012929 | Vadose Zone Soil | MGSHMHTEEKEPDGIAEGQTSNALQQSKHFQLASATVLCATVNFKA* |
| Ga0137407_122938061 | 3300012930 | Vadose Zone Soil | DGIADGQMSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPPDALF* |
| Ga0164299_103761343 | 3300012958 | Soil | MHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLC |
| Ga0164301_104984971 | 3300012960 | Soil | MGSHMHTEDKEPDGIAEGQTSNATQQSKHFQCGSATVLCATV |
| Ga0134077_103018981 | 3300012972 | Grasslands Soil | MGSHIDTESGEPDGIADGQTSNATQQSKHFQCRSATVLCGTVNSKAWTLLWKP |
| Ga0164308_111128162 | 3300012985 | Soil | MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA* |
| Ga0164304_101848441 | 3300012986 | Soil | MGFTHTHTEDKEPDGIAAGPTSNATQQSKHFQRGSATVLCGTVNS |
| Ga0164305_108185551 | 3300012989 | Soil | RTEPDGIAGEATSNATQQSKHFQWGSATVLCSTVN* |
| Ga0157371_108695961 | 3300013102 | Corn Rhizosphere | RRLAYFLMVVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCRSATVLCGTVNSKAWTLLWKPSWGLF* |
| Ga0163162_105498891 | 3300013306 | Switchgrass Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAW |
| Ga0157375_137362491 | 3300013308 | Miscanthus Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLL |
| Ga0120155_11120301 | 3300013768 | Permafrost | MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQPTSATVLCATVNSKA* |
| Ga0120149_12166232 | 3300014058 | Permafrost | SHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA* |
| Ga0182018_104698021 | 3300014489 | Palsa | MGSHMHTEDKEPDGVAEGLTSSASQQSKHFQWGSATV |
| Ga0137412_110193922 | 3300015242 | Vadose Zone Soil | MGSHMHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA* |
| Ga0132257_1045478441 | 3300015373 | Arabidopsis Rhizosphere | FAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKASTLLWKPSPGSI |
| Ga0187855_100627793 | 3300018038 | Peatland | SRRFAYFLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQWGSATVLCATVNSKA |
| Ga0066655_111701442 | 3300018431 | Grasslands Soil | HTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSG |
| Ga0190274_104738121 | 3300018476 | Soil | MHTEDGEPDGIAEGQTSNASQQSKHFQCGSATVLCGTVN |
| Ga0193751_11211662 | 3300019888 | Soil | MHTEDKEPDGIAEGQTSNASQQSKHFQCSSATVLCATVNSKA |
| Ga0193699_100275362 | 3300021363 | Soil | MHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA |
| Ga0210386_110812262 | 3300021406 | Soil | MHTEDKEPDGIAEGLTSNASQQSKHFQRGSATVLCGTVNSKAWTLHRKR |
| Ga0210383_116872181 | 3300021407 | Soil | LIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA |
| Ga0210390_105221752 | 3300021474 | Soil | HMHTEDKEPDGVAEGLTSSASQQSKHFQLGSATVLCATVNSKA |
| Ga0247798_10244591 | 3300023260 | Soil | RRFAYFLMVVGWSDFAMAHTMHTEDGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGSI |
| Ga0179589_105212782 | 3300024288 | Vadose Zone Soil | MGSHMHTEDKEPDGTAEGQTRNASQQSKHFQCGSATVLCTTVN |
| Ga0208849_10045417 | 3300025664 | Arctic Peat Soil | MGSHMHTEEKEPDGIAEGLTSNASQQSKHFQQGSATVLCGTVNSKA |
| Ga0207663_111704632 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RTEPDGIAGEATSNATQQSKHFQWGSATVLCSTVN |
| Ga0207646_109328032 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPDALF |
| Ga0207690_113972711 | 3300025932 | Corn Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPAPGS |
| Ga0207706_103989603 | 3300025933 | Corn Rhizosphere | MGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSP |
| Ga0207670_106160711 | 3300025936 | Switchgrass Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSP |
| Ga0207669_103814011 | 3300025937 | Miscanthus Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVL |
| Ga0207691_102209282 | 3300025940 | Miscanthus Rhizosphere | TESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF |
| Ga0207651_105415273 | 3300025960 | Switchgrass Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAW |
| Ga0207677_103689611 | 3300026023 | Miscanthus Rhizosphere | PDGITDGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF |
| Ga0207675_1006446551 | 3300026118 | Switchgrass Rhizosphere | MGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGT |
| Ga0209027_10162383 | 3300026300 | Grasslands Soil | MHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSG |
| Ga0209240_11785521 | 3300026304 | Grasslands Soil | MHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCRTVNSRAQGLLGKVKRS |
| Ga0209155_10233472 | 3300026316 | Soil | MHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS |
| Ga0209807_10135566 | 3300026530 | Soil | MHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSN |
| Ga0209648_100178606 | 3300026551 | Grasslands Soil | MHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILATVNSKA |
| Ga0179587_111056392 | 3300026557 | Vadose Zone Soil | DGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPDALF |
| Ga0209522_10310641 | 3300027119 | Forest Soil | TEDGEPDGIAEGLTSNATQQSKHFQQSSATVLCGTVNSKA |
| Ga0209218_10991152 | 3300027505 | Forest Soil | FAYFLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA |
| Ga0209524_10051023 | 3300027521 | Forest Soil | AMGSHVHTEDNEPDGSAEGLTSNATQQSKHFQQGSATVLCGTVNSKA |
| Ga0208984_11119602 | 3300027546 | Forest Soil | MHTEEKEPDGIAEGLTSNATQQSKHFQLTSATVLCGTVNSKA |
| Ga0209117_10234553 | 3300027645 | Forest Soil | MHTEDKEPDGIAEGQTRNASQQSKHFQCGSATVLCATVNSKA |
| Ga0208990_10473742 | 3300027663 | Forest Soil | MGSHMHTEEKEPNGIAEGLTSNATQQSKHFQLTSATVLCATVNSKAWTLLLKLPGASF |
| Ga0209011_11718591 | 3300027678 | Forest Soil | MHTEDGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSK |
| Ga0208991_10610762 | 3300027681 | Forest Soil | MGSHMHTEEKEPDGIAEGLTSNATQQSKHFQLTSATVLCGTVNSKA |
| Ga0209180_104199631 | 3300027846 | Vadose Zone Soil | MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA |
| Ga0209705_104751562 | 3300027979 | Freshwater Sediment | MHTEDGEPNGIAEGQTSNASQQSKHFQRTSATVLCGTVNSKARRLL |
| Ga0209526_1000307612 | 3300028047 | Forest Soil | WSDFAMGSHVHTEDKEPDGSAEGLTSNATQQSKHFQKGSATVLCGTVNSKA |
| Ga0137415_100818373 | 3300028536 | Vadose Zone Soil | MHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA |
| Ga0307517_106443772 | 3300028786 | Ectomycorrhiza | EDKEPAGVAAGAYEHALQQSKHFHCGSATVLCGTVNSKA |
| Ga0307323_102333351 | 3300028787 | Soil | PDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGSI |
| Ga0311337_114393801 | 3300030000 | Fen | TESGEPDGFAGGQTSSATQQSKHFQCGSATVLCGTVNSKAWTLLAKPPDALF |
| Ga0265763_10161002 | 3300030763 | Soil | MHTEDKEPDGIAEGQTGNASQQSKHFQRGSATVLCGTVNSKA |
| Ga0265720_10036072 | 3300030764 | Soil | MHTEEKEPDGIAEGQTSNASQQSKHFQRGSATVLCGTVNSKA |
| Ga0170823_116339961 | 3300031128 | Forest Soil | MHTEEEEPDGIAEGLTSSASQQSKHFQRGSATVLCGTVNSKAWTLHRKRPTTSF |
| Ga0170824_1264133522 | 3300031231 | Forest Soil | MHTEDGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNS |
| Ga0265339_103987891 | 3300031249 | Rhizosphere | WSDFAMGSHMHTEEKEPNGFAVGLTSNAMQQSKHFQCASATVLCGTVNSKA |
| Ga0310686_1012493312 | 3300031708 | Soil | LIVVGWSDFAMGSHMHTEDKEPDGIAEGLTSSASQQSKHFQYDSATVLCATVNSKA |
| Ga0307516_101425604 | 3300031730 | Ectomycorrhiza | LIVVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGSI |
| Ga0370493_0007182_82_210 | 3300034129 | Untreated Peat Soil | MHTEDKEPDGIAEGLTSNATQQSKHFQRGSATVLCSTVNSKA |
| Ga0372943_0531006_57_260 | 3300034268 | Soil | LIVVGVSDFAMGSHNTGGKEPAGFAEGLTGSASQQSKHFQGGSATVLCTTVNCNAQASLRNVREDDF |
| Ga0372946_0158067_164_292 | 3300034384 | Soil | MHTEGKEPDGIAEGLTSNATQQSKHFQCGSATVLCGTVNSKA |
| ⦗Top⦘ |