NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064912

Metagenome / Metatranscriptome Family F064912

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064912
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 49 residues
Representative Sequence MGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA
Number of Associated Samples 122
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 3.12 %
% of genes near scaffold ends (potentially truncated) 60.94 %
% of genes from short scaffolds (< 2000 bps) 89.06 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (39.062 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.625 % of family members)
Environment Ontology (ENVO) Unclassified
(33.594 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.094 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF07879PHB_acc_N 44.53
PF00108Thiolase_N 39.06
PF02803Thiolase_C 5.47
PF00563EAL 5.47
PF13561adh_short_C2 1.56
PF00106adh_short 0.78
PF01420Methylase_S 0.78
PF13847Methyltransf_31 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 44.53
COG5394Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHASignal transduction mechanisms [T] 44.53
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 5.47
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 5.47
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 5.47
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 5.47
COG0732Restriction endonuclease S subunitDefense mechanisms [V] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.94 %
UnclassifiedrootN/A39.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01CAJL6Not Available514Open in IMG/M
2170459009|GA8DASG01AHELFAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512523Open in IMG/M
2170459019|G14TP7Y02HM4TZAll Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus638Open in IMG/M
3300000897|JGI12167J12862_102302Not Available515Open in IMG/M
3300001593|JGI12635J15846_10405182Not Available822Open in IMG/M
3300001593|JGI12635J15846_10492476Not Available724Open in IMG/M
3300002077|JGI24744J21845_10085644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus577Open in IMG/M
3300002245|JGIcombinedJ26739_100534069Not Available1050Open in IMG/M
3300002886|JGI25612J43240_1030074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus797Open in IMG/M
3300002910|JGI25615J43890_1052387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus675Open in IMG/M
3300003992|Ga0055470_10036903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis1015Open in IMG/M
3300004070|Ga0055488_10102188Not Available700Open in IMG/M
3300004079|Ga0055514_10040539Not Available966Open in IMG/M
3300005171|Ga0066677_10073671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus1760Open in IMG/M
3300005333|Ga0070677_10638374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus594Open in IMG/M
3300005334|Ga0068869_100779333Not Available820Open in IMG/M
3300005340|Ga0070689_101235115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis671Open in IMG/M
3300005347|Ga0070668_100697032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus895Open in IMG/M
3300005347|Ga0070668_101999378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus534Open in IMG/M
3300005354|Ga0070675_101738078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis575Open in IMG/M
3300005355|Ga0070671_101237661Not Available657Open in IMG/M
3300005356|Ga0070674_100472189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis1039Open in IMG/M
3300005441|Ga0070700_100165024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1528Open in IMG/M
3300005457|Ga0070662_101971544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus504Open in IMG/M
3300005458|Ga0070681_11092290Not Available718Open in IMG/M
3300005518|Ga0070699_100260665All Organisms → cellular organisms → Bacteria → Proteobacteria1550Open in IMG/M
3300005547|Ga0070693_100761015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus715Open in IMG/M
3300005547|Ga0070693_101527161Not Available522Open in IMG/M
3300005557|Ga0066704_10637552Not Available679Open in IMG/M
3300005576|Ga0066708_10121513Not Available1575Open in IMG/M
3300005591|Ga0070761_10246961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1066Open in IMG/M
3300005712|Ga0070764_10113923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1457Open in IMG/M
3300006057|Ga0075026_100383365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus787Open in IMG/M
3300006058|Ga0075432_10360026Not Available619Open in IMG/M
3300006176|Ga0070765_100699188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.957Open in IMG/M
3300006353|Ga0075370_10407966Not Available815Open in IMG/M
3300006914|Ga0075436_101371692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium535Open in IMG/M
3300007255|Ga0099791_10381442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus677Open in IMG/M
3300007788|Ga0099795_10591830Not Available527Open in IMG/M
3300009088|Ga0099830_10870140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium744Open in IMG/M
3300009551|Ga0105238_11715187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis659Open in IMG/M
3300009553|Ga0105249_11377300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus777Open in IMG/M
3300009651|Ga0105859_1235460Not Available551Open in IMG/M
3300010321|Ga0134067_10267522Not Available649Open in IMG/M
3300010335|Ga0134063_10561919Not Available577Open in IMG/M
3300010375|Ga0105239_13277785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus527Open in IMG/M
3300011119|Ga0105246_12375758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus519Open in IMG/M
3300011269|Ga0137392_10994816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus689Open in IMG/M
3300012202|Ga0137363_10408458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1132Open in IMG/M
3300012202|Ga0137363_11127086Not Available667Open in IMG/M
3300012202|Ga0137363_11140460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium663Open in IMG/M
3300012202|Ga0137363_11399666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus589Open in IMG/M
3300012205|Ga0137362_10061146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3097Open in IMG/M
3300012359|Ga0137385_10885222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus739Open in IMG/M
3300012488|Ga0157343_1023063Not Available578Open in IMG/M
3300012892|Ga0157294_10118160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus702Open in IMG/M
3300012908|Ga0157286_10213044Not Available659Open in IMG/M
3300012917|Ga0137395_10956480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium616Open in IMG/M
3300012924|Ga0137413_10058260Not Available2268Open in IMG/M
3300012927|Ga0137416_10984242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium753Open in IMG/M
3300012929|Ga0137404_10888513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium812Open in IMG/M
3300012930|Ga0137407_12293806Not Available516Open in IMG/M
3300012958|Ga0164299_10376134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium903Open in IMG/M
3300012960|Ga0164301_10498497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus878Open in IMG/M
3300012972|Ga0134077_10301898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus673Open in IMG/M
3300012985|Ga0164308_11112816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium708Open in IMG/M
3300012986|Ga0164304_10184844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1347Open in IMG/M
3300012989|Ga0164305_10818555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus774Open in IMG/M
3300013102|Ga0157371_10869596Not Available682Open in IMG/M
3300013306|Ga0163162_10549889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1283Open in IMG/M
3300013308|Ga0157375_13736249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus506Open in IMG/M
3300013768|Ga0120155_1112030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus756Open in IMG/M
3300014058|Ga0120149_1216623Not Available536Open in IMG/M
3300014489|Ga0182018_10469802Not Available667Open in IMG/M
3300015242|Ga0137412_11019392Not Available591Open in IMG/M
3300015373|Ga0132257_104547844Not Available505Open in IMG/M
3300018038|Ga0187855_10062779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2286Open in IMG/M
3300018431|Ga0066655_11170144Not Available543Open in IMG/M
3300018476|Ga0190274_10473812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1242Open in IMG/M
3300019888|Ga0193751_1121166Not Available975Open in IMG/M
3300021363|Ga0193699_10027536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2111Open in IMG/M
3300021406|Ga0210386_11081226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus682Open in IMG/M
3300021407|Ga0210383_11687218Not Available519Open in IMG/M
3300021474|Ga0210390_10522175Not Available999Open in IMG/M
3300023260|Ga0247798_1024459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis768Open in IMG/M
3300024288|Ga0179589_10521278Not Available552Open in IMG/M
3300025664|Ga0208849_1004541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6069Open in IMG/M
3300025916|Ga0207663_11170463Not Available619Open in IMG/M
3300025922|Ga0207646_10932803Not Available769Open in IMG/M
3300025932|Ga0207690_11397271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus585Open in IMG/M
3300025933|Ga0207706_10398960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1192Open in IMG/M
3300025936|Ga0207670_10616071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus892Open in IMG/M
3300025937|Ga0207669_10381401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1098Open in IMG/M
3300025940|Ga0207691_10220928All Organisms → cellular organisms → Bacteria → Proteobacteria1643Open in IMG/M
3300025960|Ga0207651_10541527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1011Open in IMG/M
3300026023|Ga0207677_10368961All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300026118|Ga0207675_100644655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1065Open in IMG/M
3300026300|Ga0209027_1016238Not Available2820Open in IMG/M
3300026304|Ga0209240_1178552Not Available644Open in IMG/M
3300026316|Ga0209155_1023347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2568Open in IMG/M
3300026530|Ga0209807_1013556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4006Open in IMG/M
3300026551|Ga0209648_10017860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi6191Open in IMG/M
3300026557|Ga0179587_11105639Not Available522Open in IMG/M
3300027119|Ga0209522_1031064Not Available651Open in IMG/M
3300027505|Ga0209218_1099115Not Available609Open in IMG/M
3300027521|Ga0209524_1005102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi2493Open in IMG/M
3300027546|Ga0208984_1111960Not Available590Open in IMG/M
3300027645|Ga0209117_1023455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1977Open in IMG/M
3300027663|Ga0208990_1047374Not Available1300Open in IMG/M
3300027678|Ga0209011_1171859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus602Open in IMG/M
3300027681|Ga0208991_1061076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1137Open in IMG/M
3300027846|Ga0209180_10419963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus756Open in IMG/M
3300027979|Ga0209705_10475156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus613Open in IMG/M
3300028047|Ga0209526_10003076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi11325Open in IMG/M
3300028536|Ga0137415_10081837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3087Open in IMG/M
3300028786|Ga0307517_10644377Not Available516Open in IMG/M
3300028787|Ga0307323_10233335Not Available664Open in IMG/M
3300030000|Ga0311337_11439380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis604Open in IMG/M
3300030763|Ga0265763_1016100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus747Open in IMG/M
3300030764|Ga0265720_1003607Not Available833Open in IMG/M
3300031128|Ga0170823_11633996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus599Open in IMG/M
3300031231|Ga0170824_126413352Not Available595Open in IMG/M
3300031249|Ga0265339_10398789Not Available643Open in IMG/M
3300031708|Ga0310686_101249331Not Available791Open in IMG/M
3300031730|Ga0307516_10142560All Organisms → cellular organisms → Bacteria → Proteobacteria2164Open in IMG/M
3300034129|Ga0370493_0007182All Organisms → cellular organisms → Bacteria3163Open in IMG/M
3300034268|Ga0372943_0531006Not Available769Open in IMG/M
3300034384|Ga0372946_0158067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1084Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.34%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza1.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.78%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.78%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.78%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000897Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004079Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025664Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030764Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300034129Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_062091302170459005Grass SoilMHTEDKEPNGTAEGKTRNASQQSKHFQCGSATVFVHDG
F47_086585802170459009Grass SoilEDGNPTGFAAGQTGNASQQNKHFHGGSATVLCAKVNCKA
4MG_034410302170459019Switchgrass, Maize And Mischanthus LitterGWSDFAMGSHIDTESGEPDGSAEGQTSSATQQSKHFQCGSATVLCGTVNSKAWRLLRKLPATLF
JGI12167J12862_10230223300000897Forest SoilMGSHMHTEDKEPDGIAEGQTSNATQQSKHFQXGSATVLCATVNSKA*
JGI12635J15846_1040518223300001593Forest SoilMHTEDGEPDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLWNVP*
JGI12635J15846_1049247623300001593Forest SoilMGSHVHTWEKGKTWDKEPDGVAEGLTSSASQQSKHFQLGSATVLCATVNSKA*
JGI24744J21845_1008564423300002077Corn, Switchgrass And Miscanthus RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWN
JGIcombinedJ26739_10053406913300002245Forest SoilLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA*
JGI25612J43240_103007423300002886Grasslands SoilMHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLCTTVNSEA
JGI25615J43890_105238713300002910Grasslands SoilMHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLCTTVNS
Ga0055470_1003690313300003992Natural And Restored WetlandsDFAMGSHINTESGEPDGIADGQTSNATQQSKHFQRGSATVLCGTVNSKAWRLLWKPPSALF*
Ga0055488_1010218823300004070Natural And Restored WetlandsTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSPGSI*
Ga0055514_1004053913300004079Natural And Restored WetlandsRLAYFLIVVGWSDFAMGSHIHTESGEPDGFAGGQTSSATQQSKHFQCGSATVLCGTVNSKA*
Ga0066677_1007367123300005171SoilMVVGWSDFAMDSHMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS*
Ga0070677_1063837423300005333Miscanthus RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVN
Ga0068869_10077933313300005334Miscanthus RhizosphereSGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0070689_10123511513300005340Switchgrass RhizosphereEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0070668_10069703213300005347Switchgrass RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKP
Ga0070668_10199937813300005347Switchgrass RhizosphereMGSHNAHREREPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKA
Ga0070675_10173807813300005354Miscanthus RhizospherePDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLWKLPDALF*
Ga0070671_10123766113300005355Switchgrass RhizosphereEREPDGFAGGQTSSATQQSKHFQSGSATVLCGTVNPKAWALLWKLSGAPF*
Ga0070674_10047218913300005356Miscanthus RhizosphereMVVGCSDFAMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSPGSI*
Ga0070700_10016502413300005441Corn, Switchgrass And Miscanthus RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWK
Ga0070662_10197154413300005457Corn RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWK
Ga0070681_1109229023300005458Corn RhizosphereLIVVGWSDFAMGSHMHTEDKEPDGIAEGQTDNASQQSKHFQCGSATVLCATVDSKA*
Ga0070699_10026066513300005518Corn, Switchgrass And Miscanthus RhizosphereDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0070693_10076101523300005547Corn, Switchgrass And Miscanthus RhizosphereMHTEDKEPDGIAEGQTDNASQQSKHFQCGSATVLCATVDSKA*
Ga0070693_10152716113300005547Corn, Switchgrass And Miscanthus RhizosphereMVVGLSVFAMNYPAATESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGSI*
Ga0066704_1063755223300005557SoilDFAMGSHIDTESGEPDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPGALF*
Ga0066708_1012151323300005576SoilMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS*
Ga0070761_1024696123300005591SoilMGSHMHTWEKGKTWDKEPDGVAEELTSSASQQSKHFQLGSATVLCATVNSKA*
Ga0070764_1011392333300005712SoilMGSHVHTEDKEPDGIAEGLTSNATQQSKHFQCGSATVLCGTVNSKA
Ga0075026_10038336513300006057WatershedsPDGIAGGQTSNATQQSKHFQCGSATVLCGTVNSKASALLRKLP*
Ga0075432_1036002613300006058Populus RhizosphereEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGLI*
Ga0070765_10069918833300006176SoilMHTEDKEPDGIAEGLTSNASQQSKHFQRGSATVLCGTVNSEA
Ga0075370_1040796613300006353Populus EndosphereMGSHNAHREREPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTL
Ga0075436_10137169223300006914Populus RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATILCGTVNSKAWRLLWKLPDALF*
Ga0099791_1038144223300007255Vadose Zone SoilMGSHMHTEDKEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSQGSI*
Ga0099795_1059183023300007788Vadose Zone SoilMGSHMHTEDKEPAGTAEGKTRNASQQSKHFQCGSATVLCTTVNSEACLQLG
Ga0099830_1087014023300009088Vadose Zone SoilMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA*
Ga0105238_1171518723300009551Corn RhizosphereLIVVGCSDLAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWRLLRKLPAALF*
Ga0105249_1137730023300009553Switchgrass RhizosphereMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWG
Ga0105859_123546023300009651Permafrost SoilSVFAMGSHMHTEDKEPDGIAEGQKSSASQQSKHFQCGSATVLCATVNSKA*
Ga0134067_1026752213300010321Grasslands SoilMGSHKTSREREPDGIAAGPNATHRSKGKHFQRASATVLCGTVNPKASPLLRKLPGQLF*
Ga0134063_1056191923300010335Grasslands SoilMDSHMHTEDKEPDGWAEGLTSNATQQSKHFQWGSATVLCGTVNRSG*
Ga0105239_1327778523300010375Corn RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPS
Ga0105246_1237575823300011119Miscanthus RhizosphereMGSHIDTESGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWRL
Ga0137392_1099481623300011269Vadose Zone SoilMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA*
Ga0137363_1040845823300012202Vadose Zone SoilMHTEEKEPDGIAEGRTSSASQQSNHFQRGSATVLCAKVNFEA*
Ga0137363_1112708623300012202Vadose Zone SoilRFAYFLIVVGWSDFAMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATANSKA*
Ga0137363_1114046023300012202Vadose Zone SoilMHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA*
Ga0137363_1139966613300012202Vadose Zone SoilMGSHIDTESGEPDGITGGQTSNATQQSKHFQCGSATVLCGTVNPKAWALLWKPPETLI*
Ga0137362_1006114633300012205Vadose Zone SoilMGSHMHTEEKEPDGIAEGRTSSASQQSNHFQRGSATVLCAKVNFEA*
Ga0137385_1088522213300012359Vadose Zone SoilMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSGALF*
Ga0157343_102306323300012488Arabidopsis RhizosphereVVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0157294_1011816023300012892SoilMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0157286_1021304413300012908SoilNGIAEGQTSNATQQSKHFQCGSATVLCGTVNPKA*
Ga0137395_1095648023300012917Vadose Zone SoilMGSHMHTEEKEPDGIAEGWTSNASQQSNHFQCGSATVLCAKVNFEA*
Ga0137413_1005826033300012924Vadose Zone SoilMGSHMHTEDKEPDGIAEGRTSNALQQSKHFQLTSATILCATVNFKA*
Ga0137416_1098424223300012927Vadose Zone SoilMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLRKLPEALF*
Ga0137404_1088851323300012929Vadose Zone SoilMGSHMHTEEKEPDGIAEGQTSNALQQSKHFQLASATVLCATVNFKA*
Ga0137407_1229380613300012930Vadose Zone SoilDGIADGQMSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPPDALF*
Ga0164299_1037613433300012958SoilMHTEDKEPDGTAAGQTRNASQQSKHFQCGSATVLC
Ga0164301_1049849713300012960SoilMGSHMHTEDKEPDGIAEGQTSNATQQSKHFQCGSATVLCATV
Ga0134077_1030189813300012972Grasslands SoilMGSHIDTESGEPDGIADGQTSNATQQSKHFQCRSATVLCGTVNSKAWTLLWKP
Ga0164308_1111281623300012985SoilMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA*
Ga0164304_1018484413300012986SoilMGFTHTHTEDKEPDGIAAGPTSNATQQSKHFQRGSATVLCGTVNS
Ga0164305_1081855513300012989SoilRTEPDGIAGEATSNATQQSKHFQWGSATVLCSTVN*
Ga0157371_1086959613300013102Corn RhizosphereRRLAYFLMVVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCRSATVLCGTVNSKAWTLLWKPSWGLF*
Ga0163162_1054988913300013306Switchgrass RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAW
Ga0157375_1373624913300013308Miscanthus RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLL
Ga0120155_111203013300013768PermafrostMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQPTSATVLCATVNSKA*
Ga0120149_121662323300014058PermafrostSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA*
Ga0182018_1046980213300014489PalsaMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQWGSATV
Ga0137412_1101939223300015242Vadose Zone SoilMGSHMHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA*
Ga0132257_10454784413300015373Arabidopsis RhizosphereFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKASTLLWKPSPGSI
Ga0187855_1006277933300018038PeatlandSRRFAYFLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQWGSATVLCATVNSKA
Ga0066655_1117014423300018431Grasslands SoilHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSG
Ga0190274_1047381213300018476SoilMHTEDGEPDGIAEGQTSNASQQSKHFQCGSATVLCGTVN
Ga0193751_112116623300019888SoilMHTEDKEPDGIAEGQTSNASQQSKHFQCSSATVLCATVNSKA
Ga0193699_1002753623300021363SoilMHTEDKEPDGIAEGQTSSASQQSKHFQCGSATVLCATVNSKA
Ga0210386_1108122623300021406SoilMHTEDKEPDGIAEGLTSNASQQSKHFQRGSATVLCGTVNSKAWTLHRKR
Ga0210383_1168721813300021407SoilLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA
Ga0210390_1052217523300021474SoilHMHTEDKEPDGVAEGLTSSASQQSKHFQLGSATVLCATVNSKA
Ga0247798_102445913300023260SoilRRFAYFLMVVGWSDFAMAHTMHTEDGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGSI
Ga0179589_1052127823300024288Vadose Zone SoilMGSHMHTEDKEPDGTAEGQTRNASQQSKHFQCGSATVLCTTVN
Ga0208849_100454173300025664Arctic Peat SoilMGSHMHTEEKEPDGIAEGLTSNASQQSKHFQQGSATVLCGTVNSKA
Ga0207663_1117046323300025916Corn, Switchgrass And Miscanthus RhizosphereRTEPDGIAGEATSNATQQSKHFQWGSATVLCSTVN
Ga0207646_1093280323300025922Corn, Switchgrass And Miscanthus RhizosphereTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPDALF
Ga0207690_1139727113300025932Corn RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPAPGS
Ga0207706_1039896033300025933Corn RhizosphereMGSHINTESGEPGGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSP
Ga0207670_1061607113300025936Switchgrass RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSP
Ga0207669_1038140113300025937Miscanthus RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVL
Ga0207691_1022092823300025940Miscanthus RhizosphereTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF
Ga0207651_1054152733300025960Switchgrass RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGTVNSKAW
Ga0207677_1036896113300026023Miscanthus RhizospherePDGITDGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGLF
Ga0207675_10064465513300026118Switchgrass RhizosphereMGSHINTESGEPDGLADGQTSNATQQSKHFQCGSATVLCGT
Ga0209027_101623833300026300Grasslands SoilMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSG
Ga0209240_117855213300026304Grasslands SoilMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCRTVNSRAQGLLGKVKRS
Ga0209155_102334723300026316SoilMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSS
Ga0209807_101355663300026530SoilMHTEDKEPDGGAEGLTSNATQQSKHFQWGSATVLCGTVNRSN
Ga0209648_1001786063300026551Grasslands SoilMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILATVNSKA
Ga0179587_1110563923300026557Vadose Zone SoilDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKLPDALF
Ga0209522_103106413300027119Forest SoilTEDGEPDGIAEGLTSNATQQSKHFQQSSATVLCGTVNSKA
Ga0209218_109911523300027505Forest SoilFAYFLIVVGWSDFAMGSHMHTEDKEPDGVAEGLTSSASQQSKHFQCGSATVLCATVNSKA
Ga0209524_100510233300027521Forest SoilAMGSHVHTEDNEPDGSAEGLTSNATQQSKHFQQGSATVLCGTVNSKA
Ga0208984_111196023300027546Forest SoilMHTEEKEPDGIAEGLTSNATQQSKHFQLTSATVLCGTVNSKA
Ga0209117_102345533300027645Forest SoilMHTEDKEPDGIAEGQTRNASQQSKHFQCGSATVLCATVNSKA
Ga0208990_104737423300027663Forest SoilMGSHMHTEEKEPNGIAEGLTSNATQQSKHFQLTSATVLCATVNSKAWTLLLKLPGASF
Ga0209011_117185913300027678Forest SoilMHTEDGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSK
Ga0208991_106107623300027681Forest SoilMGSHMHTEEKEPDGIAEGLTSNATQQSKHFQLTSATVLCGTVNSKA
Ga0209180_1041996313300027846Vadose Zone SoilMGSHMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATILCATVNSKA
Ga0209705_1047515623300027979Freshwater SedimentMHTEDGEPNGIAEGQTSNASQQSKHFQRTSATVLCGTVNSKARRLL
Ga0209526_10003076123300028047Forest SoilWSDFAMGSHVHTEDKEPDGSAEGLTSNATQQSKHFQKGSATVLCGTVNSKA
Ga0137415_1008183733300028536Vadose Zone SoilMHTEDKEPDGIAEGQTSNASQQSKHFQCGSATVLCATVNSKA
Ga0307517_1064437723300028786EctomycorrhizaEDKEPAGVAAGAYEHALQQSKHFHCGSATVLCGTVNSKA
Ga0307323_1023333513300028787SoilPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSWGSI
Ga0311337_1143938013300030000FenTESGEPDGFAGGQTSSATQQSKHFQCGSATVLCGTVNSKAWTLLAKPPDALF
Ga0265763_101610023300030763SoilMHTEDKEPDGIAEGQTGNASQQSKHFQRGSATVLCGTVNSKA
Ga0265720_100360723300030764SoilMHTEEKEPDGIAEGQTSNASQQSKHFQRGSATVLCGTVNSKA
Ga0170823_1163399613300031128Forest SoilMHTEEEEPDGIAEGLTSSASQQSKHFQRGSATVLCGTVNSKAWTLHRKRPTTSF
Ga0170824_12641335223300031231Forest SoilMHTEDGEPDGIAEGQTSNATQQSKHFQCGSATVLCGTVNS
Ga0265339_1039878913300031249RhizosphereWSDFAMGSHMHTEEKEPNGFAVGLTSNAMQQSKHFQCASATVLCGTVNSKA
Ga0310686_10124933123300031708SoilLIVVGWSDFAMGSHMHTEDKEPDGIAEGLTSSASQQSKHFQYDSATVLCATVNSKA
Ga0307516_1014256043300031730EctomycorrhizaLIVVGWSDFAMGSHIDTESGEPDGIADGQTSNATQQSKHFQCGSATVLCGTVNSKAWTLLWKPSRGSI
Ga0370493_0007182_82_2103300034129Untreated Peat SoilMHTEDKEPDGIAEGLTSNATQQSKHFQRGSATVLCSTVNSKA
Ga0372943_0531006_57_2603300034268SoilLIVVGVSDFAMGSHNTGGKEPAGFAEGLTGSASQQSKHFQGGSATVLCTTVNCNAQASLRNVREDDF
Ga0372946_0158067_164_2923300034384SoilMHTEGKEPDGIAEGLTSNATQQSKHFQCGSATVLCGTVNSKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.