NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064892

Metagenome / Metatranscriptome Family F064892

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064892
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 40 residues
Representative Sequence GFADGPAAAKHPAHDNLDAMHEWPGDPIAAQHNLWPPVLL
Number of Associated Samples 105
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.34 %
% of genes near scaffold ends (potentially truncated) 96.88 %
% of genes from short scaffolds (< 2000 bps) 89.84 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.625 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.781 % of family members)
Environment Ontology (ENVO) Unclassified
(24.219 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.219 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.76%    β-sheet: 0.00%    Coil/Unstructured: 88.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF04185Phosphoesterase 10.94
PF00294PfkB 5.47
PF08450SGL 5.47
PF02771Acyl-CoA_dh_N 4.69
PF03372Exo_endo_phos 4.69
PF01259SAICAR_synt 3.12
PF04542Sigma70_r2 2.34
PF02481DNA_processg_A 2.34
PF06114Peptidase_M78 1.56
PF13231PMT_2 1.56
PF08241Methyltransf_11 0.78
PF13649Methyltransf_25 0.78
PF13936HTH_38 0.78
PF03704BTAD 0.78
PF00082Peptidase_S8 0.78
PF13560HTH_31 0.78
PF00248Aldo_ket_red 0.78
PF13522GATase_6 0.78
PF01554MatE 0.78
PF00005ABC_tran 0.78
PF12770CHAT 0.78
PF00230MIP 0.78
PF01494FAD_binding_3 0.78
PF01040UbiA 0.78
PF05977MFS_3 0.78
PF08281Sigma70_r4_2 0.78
PF03795YCII 0.78
PF13368Toprim_C_rpt 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 10.94
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 5.47
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 5.47
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 4.69
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 4.69
COG0152Phosphoribosylaminoimidazole-succinocarboxamide synthaseNucleotide transport and metabolism [F] 3.12
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.34
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.34
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.34
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.34
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.56
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.78
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.78
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.78
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.78
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.78
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.78
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.78
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.62 %
UnclassifiedrootN/A34.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001403|JGI20205J14842_1008070All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300005332|Ga0066388_108088683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300005434|Ga0070709_10047256All Organisms → cellular organisms → Bacteria2680Open in IMG/M
3300005434|Ga0070709_10353526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1086Open in IMG/M
3300005445|Ga0070708_100140762All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300005518|Ga0070699_101716596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300005569|Ga0066705_10516363All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005610|Ga0070763_10126666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1314Open in IMG/M
3300005618|Ga0068864_101178025Not Available764Open in IMG/M
3300005952|Ga0080026_10006663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2694Open in IMG/M
3300006028|Ga0070717_10098671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2477Open in IMG/M
3300006028|Ga0070717_10505124Not Available1093Open in IMG/M
3300006041|Ga0075023_100636396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300006176|Ga0070765_102107743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300006575|Ga0074053_11993264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300006806|Ga0079220_10209088All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300009089|Ga0099828_11322818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300009177|Ga0105248_11627252Not Available732Open in IMG/M
3300009792|Ga0126374_11653254Not Available531Open in IMG/M
3300010048|Ga0126373_10111053All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300010048|Ga0126373_13262986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300010048|Ga0126373_13321551Not Available500Open in IMG/M
3300010154|Ga0127503_10469518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae1507Open in IMG/M
3300010337|Ga0134062_10667477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300010359|Ga0126376_10476117All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300010359|Ga0126376_10623521Not Available1024Open in IMG/M
3300010360|Ga0126372_12376894Not Available580Open in IMG/M
3300010360|Ga0126372_12856180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300010361|Ga0126378_10098805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2875Open in IMG/M
3300010361|Ga0126378_11128093Not Available884Open in IMG/M
3300010366|Ga0126379_11195164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium867Open in IMG/M
3300010376|Ga0126381_100680771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1470Open in IMG/M
3300010376|Ga0126381_103137328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae654Open in IMG/M
3300012096|Ga0137389_11531073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300012096|Ga0137389_11715779Not Available524Open in IMG/M
3300012189|Ga0137388_10204353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1781Open in IMG/M
3300012201|Ga0137365_11287419Not Available519Open in IMG/M
3300012204|Ga0137374_10953198Not Available625Open in IMG/M
3300012207|Ga0137381_10631086Not Available933Open in IMG/M
3300012210|Ga0137378_10189290Not Available1915Open in IMG/M
3300012361|Ga0137360_11277501Not Available634Open in IMG/M
3300012971|Ga0126369_10064175All Organisms → cellular organisms → Bacteria3194Open in IMG/M
3300012986|Ga0164304_11365162Not Available580Open in IMG/M
3300012989|Ga0164305_11798554Not Available553Open in IMG/M
3300014655|Ga0181516_10317500Not Available793Open in IMG/M
3300016445|Ga0182038_10151221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1772Open in IMG/M
3300017926|Ga0187807_1035228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1550Open in IMG/M
3300017928|Ga0187806_1106905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300017932|Ga0187814_10154661All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300017959|Ga0187779_10738772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura668Open in IMG/M
3300017970|Ga0187783_11261067Not Available532Open in IMG/M
3300017973|Ga0187780_10467009Not Available899Open in IMG/M
3300017999|Ga0187767_10127404Not Available738Open in IMG/M
3300018007|Ga0187805_10294852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300018007|Ga0187805_10494602Not Available573Open in IMG/M
3300018044|Ga0187890_10487610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300018060|Ga0187765_11138180Not Available544Open in IMG/M
3300018482|Ga0066669_10651370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300020199|Ga0179592_10103339All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300021403|Ga0210397_10233431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1328Open in IMG/M
3300021403|Ga0210397_11479580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300021404|Ga0210389_11517032Not Available509Open in IMG/M
3300021405|Ga0210387_11462372Not Available586Open in IMG/M
3300021407|Ga0210383_11044701Not Available691Open in IMG/M
3300021420|Ga0210394_10665110Not Available914Open in IMG/M
3300021433|Ga0210391_11099701Not Available617Open in IMG/M
3300021474|Ga0210390_10671547All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300021477|Ga0210398_10655961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300021478|Ga0210402_10208236Not Available1798Open in IMG/M
3300021560|Ga0126371_11726960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300024271|Ga0224564_1020270Not Available1202Open in IMG/M
3300025474|Ga0208479_1103875Not Available515Open in IMG/M
3300025627|Ga0208220_1022951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1984Open in IMG/M
3300025922|Ga0207646_10635216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia957Open in IMG/M
3300025922|Ga0207646_10944005Not Available764Open in IMG/M
3300025929|Ga0207664_10015470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5539Open in IMG/M
3300025929|Ga0207664_10089979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2514Open in IMG/M
3300027567|Ga0209115_1134598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300027874|Ga0209465_10601688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300028906|Ga0308309_10467995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1087Open in IMG/M
3300028906|Ga0308309_11493290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300029999|Ga0311339_10413095Not Available1403Open in IMG/M
3300030524|Ga0311357_10802511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300030626|Ga0210291_11194499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1101Open in IMG/M
3300030706|Ga0310039_10380645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300030740|Ga0265460_10005323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales2378Open in IMG/M
3300031231|Ga0170824_115645902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300031446|Ga0170820_10959773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1588Open in IMG/M
3300031543|Ga0318516_10669175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300031545|Ga0318541_10148607All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300031549|Ga0318571_10209193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300031668|Ga0318542_10455408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300031668|Ga0318542_10570190All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300031680|Ga0318574_10610076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300031708|Ga0310686_114453266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300031719|Ga0306917_10355006All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300031719|Ga0306917_10604208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300031724|Ga0318500_10746492Not Available500Open in IMG/M
3300031744|Ga0306918_10123713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1878Open in IMG/M
3300031744|Ga0306918_10970727Not Available661Open in IMG/M
3300031770|Ga0318521_10607474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces661Open in IMG/M
3300031781|Ga0318547_10791603Not Available590Open in IMG/M
3300031782|Ga0318552_10369700All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031795|Ga0318557_10149099Not Available1056Open in IMG/M
3300031798|Ga0318523_10396492Not Available686Open in IMG/M
3300031910|Ga0306923_10080038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3660Open in IMG/M
3300031910|Ga0306923_11691952Not Available654Open in IMG/M
3300032059|Ga0318533_11041173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces600Open in IMG/M
3300032060|Ga0318505_10606924Not Available514Open in IMG/M
3300032063|Ga0318504_10463089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300032067|Ga0318524_10179188Not Available1079Open in IMG/M
3300032076|Ga0306924_10309801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1811Open in IMG/M
3300032094|Ga0318540_10610629Not Available525Open in IMG/M
3300032261|Ga0306920_101377949Not Available1011Open in IMG/M
3300032261|Ga0306920_101997700All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300032770|Ga0335085_10817789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1024Open in IMG/M
3300032895|Ga0335074_10055763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5419Open in IMG/M
3300032896|Ga0335075_10699559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus975Open in IMG/M
3300032896|Ga0335075_11643586Not Available526Open in IMG/M
3300032898|Ga0335072_10380646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1526Open in IMG/M
3300033134|Ga0335073_10023642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8523Open in IMG/M
3300033134|Ga0335073_10988027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium873Open in IMG/M
3300033158|Ga0335077_11969761Not Available543Open in IMG/M
3300033289|Ga0310914_10942756All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300033290|Ga0318519_10104689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1528Open in IMG/M
3300033290|Ga0318519_10423364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300033290|Ga0318519_10483765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300033829|Ga0334854_037916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis1157Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.12%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.56%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001403Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20205J14842_100807023300001403Arctic Peat SoilVNLLHGFADGPAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPTVL*
Ga0066388_10808868323300005332Tropical Forest SoilAFADGPAAAGHPAHDNLAAMHEWAGDPIAAHHDLWPPVVL*
Ga0070709_1004725633300005434Corn, Switchgrass And Miscanthus RhizosphereLLGFAGGPAAASHPATDNLDAMHEWPGDPIAAQQNLWPPIRL*
Ga0070709_1035352613300005434Corn, Switchgrass And Miscanthus RhizosphereRAFADGPAASRHPARDNLQVTHEWAGDPIAAGHDLWPPVQP*
Ga0070708_10014076213300005445Corn, Switchgrass And Miscanthus RhizosphereLLHGFADGPAASKYRAQDNLDAMQEWSGDPIAAQHSLWPPVVL*
Ga0070699_10171659623300005518Corn, Switchgrass And Miscanthus RhizosphereANLLHAFAHGPAAGKYPAHDNLAATREWPGDPIAAQHDLWPPVVL*
Ga0066705_1051636323300005569SoilGPAAARHPAHDNLDATPEWPGDPIAAQHNLWPPVRL*
Ga0070763_1012666633300005610SoilEGPAAAKHPAQDNLGAMHEWPGDPMGAQHNLWPPVVL*
Ga0068864_10117802513300005618Switchgrass RhizosphereAAASHPVTDNLDAMHEWPGDPIAAQQNLWPPIRL*
Ga0080026_1000666323300005952Permafrost SoilVLRAFADGPAAASTGRDNLRQLGEWAGDPIAGRHSLWT*
Ga0070717_1009867153300006028Corn, Switchgrass And Miscanthus RhizosphereEGPAAAKYPAHDNLDSMNEWAGDPIAGQHNLWPPVVL*
Ga0070717_1050512423300006028Corn, Switchgrass And Miscanthus RhizosphereAFADGPAAAKHPARDNLAAMQEWPGDAIAAQHNLWPPVVL*
Ga0075023_10063639623300006041WatershedsSSILHAFAGGPAAAKYPAQDNLHSMQEWAGDPIAAQHDLWPPVTL*
Ga0070765_10210774323300006176SoilFADGPAAARCPARDNLDAMREYAGDPIAAQHDLWPPVIL*
Ga0074053_1199326413300006575SoilVTANLLHGFAHGPAAVEHPADDNLDAMHEWPGDPIAAEYNLWPPLRL*
Ga0079220_1020908813300006806Agricultural SoilLRAFADGPAAARYPARDNLRAMREWPGDPIAAQHNLW*
Ga0099828_1132281823300009089Vadose Zone SoilSDGPAAAKFPARDNLDAMKEWPGDPIAAGHDLWPPVVL*
Ga0105248_1162725223300009177Switchgrass RhizosphereLGFAGGPAAASHPVTDNLDAMHEWPGDPIAAQQNLWPPIRL*
Ga0126374_1165325413300009792Tropical Forest SoilAFADGPAAAKHPARDNLAATREWPGDPLTAGHNLWPPVVL*
Ga0126373_1011105343300010048Tropical Forest SoilTRNVLHAFADGPAAAKYPAHDNLAAMNEWAGDPIASHHNLWPPIHL*
Ga0126373_1326298613300010048Tropical Forest SoilRAFAEGPAAAKYPAHDNLAATGEWAGDPIAAGHNLWPPIRL*
Ga0126373_1332155113300010048Tropical Forest SoilPAAAKYPAHDNLAAMDEWAGDPIASRHNLWPPTHL*
Ga0127503_1046951823300010154SoilAGGPAAAMHPAHDNLDAMHQWPGDPIAAQYNLWPPIRL*
Ga0134062_1066747713300010337Grasslands SoilRDVTANLLRACADGPAAAKYPAHDNLAAMHEFAGDPIAAHHNLWPPQVR*
Ga0126376_1047611713300010359Tropical Forest SoilGPAAAKYPAHDNLAAMNEWAGDPIASHHNLWPPIHL*
Ga0126376_1062352123300010359Tropical Forest SoilLRAFADGPAAAKHPAHDNLAAMHEWAGDPIAAHHNLWPPVVL*
Ga0126372_1237689413300010360Tropical Forest SoilLGFADGPAGAEHPADDNLDAMHEWPGDPIAAQYNLWPPIRL*
Ga0126372_1285618013300010360Tropical Forest SoilLLHAFADGPAAAKHPARDNLGATQEWPGDPIAAQHNLWPPVVL*
Ga0126378_1009880513300010361Tropical Forest SoilADGPAAAKYPANDNLDSMQEWPGDPIAAKHSLWPPTVL*
Ga0126378_1112809313300010361Tropical Forest SoilNVLRAFADGPAAHKHPARDNLDAIKPWAGNPIASGHNLW*
Ga0126379_1119516423300010366Tropical Forest SoilTRNVLGAFADGPAAAKHPARDNLAATREWPGDPLTAGHNLWPPVVL*
Ga0126381_10068077133300010376Tropical Forest SoilLLRAFADGPAAAKYSAHDNLAAMHEWAGDPIAARHNLWPPVVL*
Ga0126381_10313732823300010376Tropical Forest SoilLRAFADGPAAAKYPAHDNLHAMREWPGDPIAARHDLWPPVVL*
Ga0137389_1153107323300012096Vadose Zone SoilVNLLHGFAEGPAAARYPAHDNLDSMHEWPGDPIAGQHNLWPPTVL*
Ga0137389_1171577913300012096Vadose Zone SoilGPAAARYPAADNLAAMREWPGDPIAARHNLWPPVVR*
Ga0137388_1020435323300012189Vadose Zone SoilGPAAAKYPATDNLAAIHEWPGDPIAASHNLWPPVVR*
Ga0137365_1128741923300012201Vadose Zone SoilPAAAKHPARDNLDAMHEWPGDPIAAQHNLWPPVVR*
Ga0137374_1095319823300012204Vadose Zone SoilQVTANLLHGFAGGPAAAAYPAHDNLGSMHEWPGDPIAARHNLWPPAVL*
Ga0137381_1063108613300012207Vadose Zone SoilLRAFADGPAAAKYPAHDNLAEMHEWPGDPIAARHNLWPPVIL*
Ga0137378_1018929033300012210Vadose Zone SoilPAAAKYPAHDNLDAMHEWPGDPIAARHNLWPPVIL*
Ga0137360_1127750113300012361Vadose Zone SoilAAAAYPAHDNLDSMHEWAGDPIAGQHNLWPPVVL*
Ga0126369_1006417543300012971Tropical Forest SoilVLQAFADGPAAAKHPANDNLDSMQEWPGDPIAAHHDLWPPTVL*
Ga0164304_1136516213300012986SoilRRTTANLLHGFADGPAAAGHPATDNLDAMHEWPGDPIAALQNLWPPIRL*
Ga0164305_1179855423300012989SoilLGFAGGPAAASHPAHDNLDAMHEWRGDPIAAQYNLWPPIRL*
Ga0181516_1031750023300014655BogVLRAFADGPAAANYPAHDNLDSMDEWAGDPLASGHNLWPPIVL*
Ga0182038_1015122133300016445SoilADGPAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL
Ga0187807_103522813300017926Freshwater SedimentPAAAKYPANDNLDAMQEWPGDPVAGQHNLWPPVVL
Ga0187806_110690513300017928Freshwater SedimentHAFADGPAAAKHPAHDNLAAMQEWAGDPIAAQHNLWPPIHL
Ga0187814_1015466123300017932Freshwater SedimentAFADGPAAAKYPARDNLDAMDEWPGDPIAAQHNLWPPVHL
Ga0187779_1073877213300017959Tropical PeatlandDGPAAARFPAHDNLDAMHEWPGDPIAAGHNLWPPVVL
Ga0187783_1126106723300017970Tropical PeatlandDGQAADKHPAQDNLDAMQEWAGDPIAAQHDLWPPVVL
Ga0187780_1046700923300017973Tropical PeatlandAAAAKYPAHDNLDAMQEWSGDPIAAQHDLWPPVTL
Ga0187767_1012740423300017999Tropical PeatlandADGPAAASHPAHDNLDSMDEWPGDPIAAQHNLWPPVVL
Ga0187805_1029485223300018007Freshwater SedimentGPAAAKYPANDNLDQMQEWAGDPIAGGHNLWPPTVL
Ga0187805_1049460223300018007Freshwater SedimentLHAFADGPAAARHPAHDNLAAMHEWAGDPIAAQHNLWPPVHL
Ga0187890_1048761013300018044PeatlandNVLRAFADGPAAAKYPAQDNLDAMSEWPGDPIAAQHDLWPPVIL
Ga0187765_1113818023300018060Tropical PeatlandRAFADGPAAAKYPARDNLDAMQEWAGDPIAAQHDLWPPVVL
Ga0066669_1065137013300018482Grasslands SoilLLHGFARGPAAARHPAHDNLAAMHEFAGDPIAAHHNLWPPQVR
Ga0179592_1010333923300020199Vadose Zone SoilLLRGFADGPAAAKHPARDNLNAVQEWPGDPIAAQHNLWPPVRR
Ga0210397_1023343133300021403SoilAGGPAAAKHPAHDNLDAMHEWPGDPMAAHHDLWPPVRL
Ga0210397_1147958023300021403SoilSNVLHAFADGPAAAKYPAHDNLAQMQEWAGDPIAAGHNLWPPVVL
Ga0210389_1151703213300021404SoilPAAAKYPAHDNLDSMHEWAGDPIAGQHDLWPPVHL
Ga0210387_1146237213300021405SoilTTNLLHGFADGPAAAKYPAHDNLGSMHEWAGDPIAGQHNLWPPVVL
Ga0210383_1104470123300021407SoilPAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPVVL
Ga0210394_1066511013300021420SoilLLQGFADGPAAAKHPAHDNLHAMNEWPGDPIAAQNNLWPPVVL
Ga0210391_1109970123300021433SoilPAAGKHPAQDNLDAMQEWPGDPIAAQHDLWPPVVL
Ga0210390_1067154713300021474SoilHGFAGGPAAARHPAHDNLDAMHEWPGDPMAAHHDLWPPVRL
Ga0210398_1065596123300021477SoilLLRGFADGPAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL
Ga0210402_1020823613300021478SoilFADGPAAAKHPAHDNLAATKEWAGDPVAAQHNLWPPVVL
Ga0126371_1172696023300021560Tropical Forest SoilLQAFAQGPAAAKYPAKDNLVAMQEWPGDPIAAHHNLWPPTVL
Ga0224564_102027013300024271SoilVKRVSANLLRGFADGPAAGKHPAQDNLDAMQEWPGDPIAAQHDLWPPVVL
Ga0208479_110387523300025474Arctic Peat SoilLLHGFAGGPAAASHPAQDNLDSMHEWPGDPIAARRDLWPPVVL
Ga0208220_102295113300025627Arctic Peat SoilLLRGFAEGPAAAKFPAHDNLDSMHEWPGDPIAAQHNLWPPVVL
Ga0207646_1063521613300025922Corn, Switchgrass And Miscanthus RhizosphereLAAAKHPAHDNLAAMHEWAGDPIAAHHNLWPPVVL
Ga0207646_1094400513300025922Corn, Switchgrass And Miscanthus RhizosphereARGPAAAKYPATDNLAAMHEWPGDPIAASHNLWPPVVR
Ga0207664_1001547053300025929Agricultural SoilPAAARYPAHDNLAAMHEWPGDPIAAQHDLWPPVVR
Ga0207664_1008997943300025929Agricultural SoilADGPAAARYPARDNLAAMQEWPGDPIAAQHSLWPPVVR
Ga0209115_113459813300027567Forest SoilFADGPAAAKHPARDNLDAMHEWPGDPISAGHNLWPPITL
Ga0209465_1060168823300027874Tropical Forest SoilLHGFADGPAAAKHPARDNLAATHEWPGDPIAAQHNLWPSVVR
Ga0308309_1046799513300028906SoilFADGPAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPVVL
Ga0308309_1149329013300028906SoilAFADGPAAARCPARDNLDAMREYAGDPIAAQHDLWPPVIL
Ga0311339_1041309513300029999PalsaAFADGPAAASHPAQDNLDAMDEYAGDPIAAQHNLW
Ga0311357_1080251113300030524PalsaDGPAAAKYPAHDNLEEMREWPGDPIAAQHDLWPPVLL
Ga0210291_1119449923300030626SoilVLKAFADGPAAHQHPAHDNVEAMHAWAGDPITTGHTLW
Ga0310039_1038064513300030706Peatlands SoilLRAFADGPAAARYPAQDNLDAMDEWPGDPIAAQHDLWPPVVL
Ga0265460_1000532333300030740SoilAFADGPAAHKHPAHDNVEALQAWPGDPISAGHNLWPPVIL
Ga0170824_11564590213300031231Forest SoilQVTTNLLHGFADGPAAAKYPAHDNLGSMHEWAGDPIAGQHNLWPPVVL
Ga0170820_1095977313300031446Forest SoilPAAIRFGATDNLAAQHEWPGDPVAAHHNLWPPVVR
Ga0318516_1066917513300031543SoilDGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0318541_1014860723300031545SoilRAFADGPAAAKYPAHDNLDALREWAGDPIAAQHDLWPPVTL
Ga0318571_1020919313300031549SoilPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0318542_1045540823300031668SoilLCWAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0318542_1057019023300031668SoilFADGPAAAKHPAHDNLDAMDEWAGDPIAAQHNLWPPVHL
Ga0318574_1061007623300031680SoilFADGPAAARHPAHDNLPAMQEWAGDPIAAQHNLWPPMVL
Ga0310686_11445326613300031708SoilHVTLNILRGFADGPAAAKYPAHDNLDSMHEWAGDPIAGQHSLWPPVTL
Ga0306917_1035500613300031719SoilLRAFADGPAAAKYPARDNLEAMQEWAGDPIAAQHDLWPPVTL
Ga0306917_1060420813300031719SoilGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0318500_1074649223300031724SoilLLRGFADGPAAAKHPARDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0306918_1012371313300031744SoilLRAFADGPVAAKHPAHDNLAAMQEWAGDPIAAHHNLWPPMVL
Ga0306918_1097072713300031744SoilATTANLLRGFADGPAAAKHPAHDNLDAMQEWPGDPIAAQHNLWPPVLL
Ga0318521_1060747413300031770SoilRAFADGPAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL
Ga0318547_1079160323300031781SoilTANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0318552_1036970023300031782SoilGPAAAKYPARDNLGALREWAGDPIAAQHDLWPPVTL
Ga0318557_1014909923300031795SoilNLLRAYAGGPAAAKHPAHDNLAAMQAWPGDPIAGHHNLWPPIVL
Ga0318523_1039649213300031798SoilGFADGPAAAKHPAHDNLDAMHEWPGDPIAAQHNLWPPVLL
Ga0306923_1008003813300031910SoilDGPAAAKHPAHDNLAAMHEWPGDPIAAQHNLWPPVVR
Ga0306923_1169195223300031910SoilKATTANLLRGFADGPAAAKHPAHDNLDAMQEWPGDPIAAQHNLWPPVVL
Ga0318533_1104117323300032059SoilPAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL
Ga0318505_1060692423300032060SoilAATANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0318504_1046308913300032063SoilLRAYADGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0318524_1017918823300032067SoilACMAAKHPAHDNLAAMQAWPGDPIAGHHNLWPPIVL
Ga0306924_1030980133300032076SoilGPVAAKHPAHDNLAAMQEWAGDPIAAHHNLWPPMVL
Ga0318540_1061062923300032094SoilSTANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0306920_10137794913300032261SoilYADGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0306920_10199770023300032261SoilLRAFADGPAAAKYPARDNLDAMQEWAGDPIAAQHDLWPPVTR
Ga0335085_1081778923300032770SoilNVLRAFAEGPAAAKHSAHDNLAAMHEWPGDPIAAKHDLWPPVVL
Ga0335074_1005576313300032895SoilAFADGPAAAKYPARDNLGSMHEWPGDPIAAQHNLWPPVVL
Ga0335075_1069955923300032896SoilHAFADGPAADKYPAHDNLDAMHEWAGDPMAAQHNLWPPIVL
Ga0335075_1164358623300032896SoilRGFADGPAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL
Ga0335072_1038064613300032898SoilLHAFADGPAAARYPARDNLASMHEWPGDPIAGQHNLWPPVVL
Ga0335073_10023642103300033134SoilPAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL
Ga0335073_1098802723300033134SoilFADGPAAARYPARDNLEAMHEWPGDPLAAGHNLWPPVQL
Ga0335077_1196976123300033158SoilFADGPAAARYPAHDNLAAMHEWPGDPLAAGHNLWPPVVL
Ga0310914_1094275613300033289SoilDGPAAAKYPAHDNLDAMQEWAGDPIAAQHNLWPPVTL
Ga0318519_1010468913300033290SoilAFADGPAAAKHPAHDNLAAMHEWPGDPIAAQHNLWPPVVR
Ga0318519_1042336413300033290SoilYADGPAAAKHRAHDNLAAMHEWAGDPIAANHNLWPPVVL
Ga0318519_1048376513300033290SoilANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL
Ga0334854_037916_26_1423300033829SoilVLRAFADGPAAASYPAHDNLDAMDEWPGDPIAAQHDLW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.