Metagenome / Metatranscriptome Family F064865

Basic Information
Family ID	F064865
Family Type	Metagenome / Metatranscriptome
Number of Sequences	128
Average Sequence Length	40 residues
Representative Sequence	GGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRERLG
Number of Associated Samples	115
Number of Associated Scaffolds	128

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	48.44 %
% of genes near scaffold ends (potentially truncated)	49.22 %
% of genes from short scaffolds (< 2000 bps)	91.41 %
Associated GOLD sequencing projects	112
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Bacteria (89.062 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.062 % of family members)
Environment Ontology (ENVO)	Unclassified (32.812 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (43.750 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 18.46% β-sheet: 20.00% Coil/Unstructured: 61.54%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF10262	Rdx	10.16
PF13456	RVT_3	9.38
PF00326	Peptidase_S9	8.59
PF01243	Putative_PNPOx	2.34
PF07690	MFS_1	2.34
PF09954	DUF2188	1.56
PF02558	ApbA	1.56
PF10604	Polyketide_cyc2	1.56
PF00171	Aldedh	1.56
PF00202	Aminotran_3	1.56
PF00285	Citrate_synt	1.56
PF08281	Sigma70_r4_2	1.56
PF13520	AA_permease_2	1.56
PF05239	PRC	1.56
PF13561	adh_short_C2	1.56
PF01497	Peripla_BP_2	0.78
PF01061	ABC2_membrane	0.78
PF01381	HTH_3	0.78
PF14312	FG-GAP_2	0.78
PF00999	Na_H_Exchanger	0.78
PF03193	RsgA_GTPase	0.78
PF01878	EVE	0.78
PF01266	DAO	0.78
PF01047	MarR	0.78
PF14224	DUF4331	0.78
PF01844	HNH	0.78
PF16925	TetR_C_13	0.78
PF00248	Aldo_ket_red	0.78
PF02142	MGS	0.78
PF03069	FmdA_AmdA	0.78
PF00005	ABC_tran	0.78
PF00589	Phage_integrase	0.78
PF00211	Guanylate_cyc	0.78
PF13515	FUSC_2	0.78
PF13177	DNA_pol3_delta2	0.78
PF01522	Polysacc_deac_1	0.78
PF07681	DoxX	0.78
PF00903	Glyoxalase	0.78
PF00196	GerE	0.78
PF01434	Peptidase_M41	0.78

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG0372	Citrate synthase	Energy production and conversion [C]	1.56
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	1.56
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	1.56
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	1.56
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.78
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.78
COG4607	ABC-type enterochelin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.78
COG4594	ABC-type Fe3+-citrate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.78
COG4592	ABC-type Fe2+-enterobactin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.78
COG4558	ABC-type hemin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.78
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.78
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.78
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.78
COG2947	Predicted RNA-binding protein, contains EVE domain	General function prediction only [R]	0.78
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	0.78
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.78
COG1673	Predicted RNA-binding protein, contains PUA-like EVE domain	General function prediction only [R]	0.78
COG1162	Ribosome biogenesis GTPase RsgA	Translation, ribosomal structure and biogenesis [J]	0.78
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.78
COG0614	ABC-type Fe3+-hydroxamate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.78
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.78
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.78
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.06 %
Unclassified	root	N/A	10.94 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.06 %
Unclassified	root	N/A	10.94 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.06 %
Unclassified	root	N/A	10.94 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	46.88 %
Unclassified	root	N/A	10.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.12 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	44.53 %
Unclassified	root	N/A	10.94 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.78 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.78 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	32.81 %
Unclassified	root	N/A	10.94 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3.12 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.78 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	0.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.78 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.78 %

Name	Rank	Taxonomy	Distribution
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	32.03 %
Unclassified	root	N/A	10.94 %
unclassified Thermoleophilia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia	1.56 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.56 %
Actinobacteria bacterium RBG_16_68_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12	0.78 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.78 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.78 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	32.03 %
Unclassified	root	N/A	10.94 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1.56 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	0.78 %
Acidobacteriales bacterium 13_2_20CM_55_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8	0.78 %
Actinobacteria bacterium RBG_16_68_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12	0.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.78 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.78 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	32.03 %
Unclassified	root	N/A	10.94 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1.56 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	0.78 %
Acidobacteriales bacterium 13_2_20CM_55_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8	0.78 %
Actinobacteria bacterium RBG_16_68_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12	0.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.78 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0630415	Not Available	882	Open in IMG/M
3300000559\|F14TC_100933625	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300000881\|JGI10215J12807_1141775	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300000881\|JGI10215J12807_1170097	All Organisms → cellular organisms → Bacteria	1422	Open in IMG/M
3300000890\|JGI11643J12802_12255290	All Organisms → cellular organisms → Bacteria	1602	Open in IMG/M
3300001213\|JGIcombinedJ13530_109850731	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300002568\|C688J35102_119772979	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300002568\|C688J35102_120701759	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300004114\|Ga0062593_100452249	All Organisms → cellular organisms → Bacteria	1171	Open in IMG/M
3300004156\|Ga0062589_100362435	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300004156\|Ga0062589_101207545	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300004479\|Ga0062595_101516304	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300004480\|Ga0062592_101710725	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300004643\|Ga0062591_100654554	All Organisms → cellular organisms → Bacteria	940	Open in IMG/M
3300004643\|Ga0062591_101539197	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300004778\|Ga0062383_10191396	All Organisms → cellular organisms → Bacteria	939	Open in IMG/M
3300005333\|Ga0070677_10699544	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300005437\|Ga0070710_10023969	All Organisms → cellular organisms → Bacteria	3213	Open in IMG/M
3300005444\|Ga0070694_101176837	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300005450\|Ga0066682_10486478	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300005455\|Ga0070663_102178708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	500	Open in IMG/M
3300005467\|Ga0070706_101881174	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	543	Open in IMG/M
3300005468\|Ga0070707_101284396	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	698	Open in IMG/M
3300005518\|Ga0070699_101415059	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300005526\|Ga0073909_10490529	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300005529\|Ga0070741_10011004	All Organisms → cellular organisms → Bacteria	16861	Open in IMG/M
3300005530\|Ga0070679_100699542	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300005536\|Ga0070697_100551354	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1011	Open in IMG/M
3300005719\|Ga0068861_100951812	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300005719\|Ga0068861_101423191	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300005764\|Ga0066903_100775546	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1709	Open in IMG/M
3300005937\|Ga0081455_10947341	All Organisms → cellular organisms → Bacteria → Proteobacteria	534	Open in IMG/M
3300006196\|Ga0075422_10013064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	2738	Open in IMG/M
3300006854\|Ga0075425_101767972	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300006881\|Ga0068865_101228124	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	664	Open in IMG/M
3300006931\|Ga0097620_100449742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1384	Open in IMG/M
3300006953\|Ga0074063_12153985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	598	Open in IMG/M
3300009088\|Ga0099830_10862954	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8	748	Open in IMG/M
3300009094\|Ga0111539_12196727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	640	Open in IMG/M
3300009098\|Ga0105245_12034875	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300009147\|Ga0114129_11134117	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300009148\|Ga0105243_11160051	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	784	Open in IMG/M
3300009162\|Ga0075423_10208042	All Organisms → cellular organisms → Bacteria	2052	Open in IMG/M
3300009177\|Ga0105248_10537401	All Organisms → cellular organisms → Bacteria → Proteobacteria	1318	Open in IMG/M
3300009545\|Ga0105237_11959809	Not Available	594	Open in IMG/M
3300009597\|Ga0105259_1136048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	594	Open in IMG/M
3300009792\|Ga0126374_10749811	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300009836\|Ga0105068_1106645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	550	Open in IMG/M
3300009873\|Ga0131077_10941974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	741	Open in IMG/M
3300010364\|Ga0134066_10358263	Not Available	543	Open in IMG/M
3300010397\|Ga0134124_12021680	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	614	Open in IMG/M
3300010400\|Ga0134122_12406931	All Organisms → cellular organisms → Bacteria → Proteobacteria	574	Open in IMG/M
3300010400\|Ga0134122_13042515	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523	Open in IMG/M
3300011403\|Ga0137313_1054279	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300012022\|Ga0120191_10114297	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300012204\|Ga0137374_10111428	All Organisms → cellular organisms → Bacteria	2547	Open in IMG/M
3300012206\|Ga0137380_10719376	Not Available	866	Open in IMG/M
3300012211\|Ga0137377_11394345	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	629	Open in IMG/M
3300012212\|Ga0150985_100825788	Not Available	670	Open in IMG/M
3300012350\|Ga0137372_10020314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	6231	Open in IMG/M
3300012354\|Ga0137366_10100059	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2198	Open in IMG/M
3300012355\|Ga0137369_10474254	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300012901\|Ga0157288_10059044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	922	Open in IMG/M
3300012903\|Ga0157289_10184297	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	669	Open in IMG/M
3300012914\|Ga0157297_10424574	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300012931\|Ga0153915_12045885	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300012958\|Ga0164299_10147815	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1296	Open in IMG/M
3300012960\|Ga0164301_11042818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	646	Open in IMG/M
3300012984\|Ga0164309_10687309	Not Available	810	Open in IMG/M
3300012988\|Ga0164306_10516765	All Organisms → cellular organisms → Bacteria → Terrabacteria group	921	Open in IMG/M
3300012989\|Ga0164305_10120736	All Organisms → cellular organisms → Bacteria	1725	Open in IMG/M
3300013105\|Ga0157369_11746463	Not Available	632	Open in IMG/M
3300013306\|Ga0163162_10493237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1356	Open in IMG/M
3300013308\|Ga0157375_11299574	Not Available	855	Open in IMG/M
3300014150\|Ga0134081_10371958	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	530	Open in IMG/M
3300014325\|Ga0163163_10097206	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2965	Open in IMG/M
3300014326\|Ga0157380_12402617	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	592	Open in IMG/M
3300014745\|Ga0157377_10954539	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	645	Open in IMG/M
3300015086\|Ga0167655_1033206	Not Available	832	Open in IMG/M
3300015200\|Ga0173480_10084310	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1508	Open in IMG/M
3300015359\|Ga0134085_10447056	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	585	Open in IMG/M
3300015371\|Ga0132258_12114057	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1415	Open in IMG/M
3300015371\|Ga0132258_12606515	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1263	Open in IMG/M
3300015371\|Ga0132258_13261633	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1118	Open in IMG/M
3300015372\|Ga0132256_101992261	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	687	Open in IMG/M
3300015374\|Ga0132255_103783811	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300017965\|Ga0190266_10358457	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300017994\|Ga0187822_10391753	Not Available	510	Open in IMG/M
3300018052\|Ga0184638_1244342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	620	Open in IMG/M
3300018422\|Ga0190265_11953781	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	693	Open in IMG/M
3300018469\|Ga0190270_10010018	All Organisms → cellular organisms → Bacteria	5315	Open in IMG/M
3300018476\|Ga0190274_10582530	Not Available	1141	Open in IMG/M
3300018476\|Ga0190274_11218542	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300018476\|Ga0190274_13949344	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	502	Open in IMG/M
3300020020\|Ga0193738_1079371	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300021082\|Ga0210380_10507296	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	553	Open in IMG/M
3300021560\|Ga0126371_10258783	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1857	Open in IMG/M
3300021560\|Ga0126371_13818204	Not Available	508	Open in IMG/M
3300022893\|Ga0247787_1001956	All Organisms → cellular organisms → Bacteria	2138	Open in IMG/M
3300022901\|Ga0247788_1015093	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
3300025899\|Ga0207642_10485449	All Organisms → cellular organisms → Bacteria	754	Open in IMG/M
3300025925\|Ga0207650_10687064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	864	Open in IMG/M
3300025981\|Ga0207640_11691453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	571	Open in IMG/M
3300025981\|Ga0207640_11906804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12	538	Open in IMG/M
3300025986\|Ga0207658_11711785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	574	Open in IMG/M
3300026118\|Ga0207675_100395991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	1360	Open in IMG/M
3300026547\|Ga0209156_10170793	All Organisms → cellular organisms → Bacteria	1047	Open in IMG/M
(restricted) 3300027799\|Ga0233416_10027022	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1910	Open in IMG/M
3300028379\|Ga0268266_12301168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	510	Open in IMG/M
3300028592\|Ga0247822_10471756	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	989	Open in IMG/M
3300028592\|Ga0247822_11022219	Not Available	683	Open in IMG/M
3300028654\|Ga0265322_10085458	All Organisms → cellular organisms → Bacteria → Terrabacteria group	896	Open in IMG/M
3300028715\|Ga0307313_10070245	Not Available	1045	Open in IMG/M
3300031170\|Ga0307498_10048182	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1140	Open in IMG/M
3300031242\|Ga0265329_10239473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	603	Open in IMG/M
3300031834\|Ga0315290_10828492	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	790	Open in IMG/M
3300031847\|Ga0310907_10169953	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1018	Open in IMG/M
3300031908\|Ga0310900_11375598	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	592	Open in IMG/M
3300032013\|Ga0310906_10544740	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300032018\|Ga0315272_10482516	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300032052\|Ga0318506_10294309	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	720	Open in IMG/M
3300032075\|Ga0310890_10266188	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1215	Open in IMG/M
3300032143\|Ga0315292_11114720	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	652	Open in IMG/M
3300032954\|Ga0335083_10091582	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3027	Open in IMG/M
3300033551\|Ga0247830_10814945	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	743	Open in IMG/M
3300034143\|Ga0334961_048350	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	736	Open in IMG/M
3300034149\|Ga0364929_0153509	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300034417\|Ga0364941_151302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	584	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.31%
Host-Associated	Host-Associated	28.91%
Engineered	Engineered	0.78%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	60.94%
Plants	Host-Associated → Plants	28.91%
Aquatic	Environmental → Aquatic	9.38%
Wastewater	Engineered → Wastewater	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.38%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.41%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.72%
Freshwater	Environmental → Aquatic → Freshwater	6.25%
Sediment	Environmental → Aquatic → Sediment	2.34%
Floodplain	Environmental → Terrestrial → Floodplain	1.56%
Marine	Environmental → Aquatic → Marine	0.78%
Roots	Host-Associated → Plants → Roots	0.78%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	49.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.16%
Loam	Environmental → Terrestrial → Soil → Loam	8.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.81%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.91%
Lake	Environmental → Aquatic → Freshwater → Lake	3.12%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.34%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.34%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.56%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.78%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.78%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.78%
Sand	Environmental → Terrestrial → Soil → Sand	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.16%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.81%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.25%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.47%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.47%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.34%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.34%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.56%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.56%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.78%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.78%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.78%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.78%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.78%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.06%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.69%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.12%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.12%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.34%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.34%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.34%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.34%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.56%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.56%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.56%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.78%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.78%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.78%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.78%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.78%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.78%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.78%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.78%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.78%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.78%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.78%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.78%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.78%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000881	Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009836	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20	Environmental	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011403	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015086	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4	Environmental	Open in IMG/M
3300022901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300027799 (restricted)	Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Host-Associated	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Host-Associated	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034143	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F064865

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_06304151	3300000033	Soil	GGIFDVHVDGSLVFTKSMLGRYPXPDDVIPLVRAKLTG*
F14TC_1009336252	3300000559	Soil	VTGANGIFDVHLDGELVFEKSMLGRYPDPDDVLPLLRERLD*
JGI10215J12807_11417751	3300000881	Soil	VTGDGGIFDVHVDGDLVFEKKMLGRYPDPDDVVPLLREKLGA*
JGI10215J12807_11700974	3300000881	Soil	VTGDGGIFDVHVDGDLVFEKAMLGRYPDPDDVLPLLREKLSA*
JGI11643J12802_122552901	3300000890	Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPDPDDVLPLLRR
JGIcombinedJ13530_1098507312	3300001213	Wetland	VHLDGELVFEKRMLGRYPDPEDVLPLLRERIAAG*
C688J35102_1197729792	3300002568	Soil	VVPGADGIFDVHVGSELVFTKSMLGRYPDPDDVMPLLRPHVVG*
C688J35102_1207017594	3300002568	Soil	DVHLDGELVFEKSMLGRYPDPEDVIPLLGERFGGNSSPS*
Ga0062593_1004522491	3300004114	Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVLPLLRPHLASA*
Ga0062589_1003624352	3300004156	Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPKPDDVLPLLRPHLASA*
Ga0062589_1012075452	3300004156	Soil	VTGVGGIFDVHVDGERVFTKSMLGRYPEPDDVLPLLRPHLAA*
Ga0062595_1015163042	3300004479	Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPDPDDVLPLLRRYLAD*
Ga0062592_1017107252	3300004480	Soil	VTGVGGIFDVHVDGERVFTKSMLGRYPEPEDVLPLLRPHLAA*
Ga0062591_1006545541	3300004643	Soil	VEVVTGRDGIFDVHLGDSLVFTKAMLGRYPEPEDVMPLLRSHLAG*
Ga0062591_1015391972	3300004643	Soil	VTGVGGIFDVHVDGERVFTKSMLGRYPEPDDVLPLLRPRL
Ga0062383_101913961	3300004778	Wetland Sediment	GIFDVHVDGELVFWKKMLGRYPDPDDVLPLIRERIGAEVMRSSGP*
Ga0070677_106995441	3300005333	Miscanthus Rhizosphere	VTGDGCIFDVHVDGDLVFEKKMLGRYPDPDDVVPLLREKLGP*
Ga0070710_100239695	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	IFDVHVDDELLFTKSMIGHYPEPDEVLPLLRERIGAELDS*
Ga0070694_1011768372	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VFDVHVGDKLVFEKSMLGRYPDPEDVMPLLRPRLVLTAGPEA*
Ga0066682_104864781	3300005450	Soil	VVPGADGIFDVHVAGDLVFTKAMLGRYPEPDDVMPLLHSQLH*
Ga0070663_1021787081	3300005455	Corn Rhizosphere	VVTGADGIFDVHVRGELVFTKAMLGRYPEPDDVLPLLQPHLR*
Ga0070706_1018811741	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	IPGGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAA*
Ga0070707_1012843961	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	TGVGGIFDVHVGDELVFTKSMLGRYPEPEDVLPLLRPRLAA*
Ga0070699_1014150591	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	VVPGADGIFDVHVDGDLVFTKAMLGRYPEPDDVMPLLQSRLRT*
Ga0073909_104905292	3300005526	Surface Soil	LVTGVGGVFDVHVGDELVFEKSMLGRYPDPEDVMPLLRPLLAA*
Ga0070741_100110045	3300005529	Surface Soil	VELVPGVDGVFDVHVGENLVFTKSMLGRYPQPGDVMPLLRPHIGS*
Ga0070679_1006995422	3300005530	Corn Rhizosphere	VELVTGVGGIFDVHVGDDIVFTKSMLGRYPEPEDVMPLLRPRLAP*
Ga0070697_1005513541	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	VVPGANGIFDVHVDGDLVFTKAMLGRYPKPDDVMPLLQSRLQT*
Ga0068861_1009518121	3300005719	Switchgrass Rhizosphere	IFDVHLDGELVFTKSMLGRYPDPEDVTPLLRAKLDT*
Ga0068861_1014231912	3300005719	Switchgrass Rhizosphere	VTGDGGIFDVHVDGDLLFAKRMLGRYPDPGDVEPLLRERLGAPVL*
Ga0066903_1007755463	3300005764	Tropical Forest Soil	VHVDGDLVFEKKMLGRYPDPEDVMPLLRERIAGG*
Ga0081455_109473411	3300005937	Tabebuia Heterophylla Rhizosphere	FDVHVDGDLVFEKKMIGRYPEPDDVVPLVKAKFES*
Ga0075422_100130643	3300006196	Populus Rhizosphere	VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLDA*
Ga0075425_1017679722	3300006854	Populus Rhizosphere	VVPGADGIFDVHVAGDRVFTKAMLGRYPQPEDVMPLLRSRLDL*
Ga0068865_1012281242	3300006881	Miscanthus Rhizosphere	GGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRERLG*
Ga0097620_1004497421	3300006931	Switchgrass Rhizosphere	GDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE*
Ga0074063_121539852	3300006953	Soil	HVHVDGDLVFTKSMLGRYPGPDDVLPLIRSRLSQGRA*
Ga0099830_108629541	3300009088	Vadose Zone Soil	VPGADGIFDVHLGGERVFTKSMLGRYPEPDDVMPLLR
Ga0111539_121967272	3300009094	Populus Rhizosphere	VFDVHVDGDLVFEKSMLGHYPDPDDVLPLVRDKLS*
Ga0105245_120348752	3300009098	Miscanthus Rhizosphere	VTGVGGVFDVHVGDELVFEKSMLGRYPDPEDVMPLLRPHLGT*
Ga0114129_111341174	3300009147	Populus Rhizosphere	GIFDVHVDGDLVFEKAMLGRYPDPDDVLPLLREKLSA*
Ga0105243_111600512	3300009148	Miscanthus Rhizosphere	VTGVGGVFDVHVGDELVFEKSMLGRYPDPDDVMPLLRPRLAA*
Ga0075423_102080421	3300009162	Populus Rhizosphere	IFDVHVDGELVFTKSMLGRYPDPDDVVPLLREKLGG*
Ga0105248_105374013	3300009177	Switchgrass Rhizosphere	DVDVDGERIFFKKMIGRYPQPDDVVPLLRERIGPEVM*
Ga0105237_119598092	3300009545	Corn Rhizosphere	LTGLDDTIVFTKSMIGRYPNPDDVLPLVHARLAE*
Ga0105259_11360481	3300009597	Soil	VTGANGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA*
Ga0126374_107498112	3300009792	Tropical Forest Soil	VHVDETLVFTKSMLGRYPQPDEVTPLLNDQLTAD*
Ga0105068_11066451	3300009836	Groundwater Sand	VTGANGIFDVHLDGDLVFTKSMLGRYPDPDDVIPLLRDQLGAS*
Ga0131077_109419741	3300009873	Wastewater	YDVDLDGERVFTKSMLGRYPEPEEVIPLLQERMGPPVL*
Ga0134066_103582632	3300010364	Grasslands Soil	EVVPGADGIFDVHVGSELVFTKSMLGRYPDPDDVMPLLRPHVVG*
Ga0134124_120216803	3300010397	Terrestrial Soil	GIFDVHLDGDLVFEKSMLGRYPDPEDVLPLLRERM*
Ga0134122_124069311	3300010400	Terrestrial Soil	GGVFDVDVDGERIFFKKMIGRYPQPDDVVPLLRERIGPEVM*
Ga0134122_130425151	3300010400	Terrestrial Soil	GGIFDVHLDGELVFTKSMIRRYPDPDDVMPLLRAALG*
Ga0137313_10542791	3300011403	Soil	VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLSGA*
Ga0120191_101142972	3300012022	Terrestrial	GIFDVHLDGELVFTKSMLGRYPDPDDVTPLVRDQLGG*
Ga0137374_101114283	3300012204	Vadose Zone Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVMPLLRPSLSA*
Ga0137380_107193762	3300012206	Vadose Zone Soil	VVPGADGIFDVHVAGDLVFTKAMLGRYPEPDDVMPLLRSHLH*
Ga0137377_113943452	3300012211	Vadose Zone Soil	VVPGADGIFDVHVAGDLVCTKAMLGRYPEPDDVMPLLRSHLH*
Ga0150985_1008257881	3300012212	Avena Fatua Rhizosphere	VVPGADGIFDVHVGSELVFTKSMLGRYPVPDDVMPLLRPHVVG*
Ga0137372_100203142	3300012350	Vadose Zone Soil	VHVNGELVFTKSMLGRYPQPDEVVPLVRKRLPAA*
Ga0137366_101000592	3300012354	Vadose Zone Soil	VHLNGELVFTKSMLGRYPRPDEVVPLVRKRLAAA*
Ga0137369_104742542	3300012355	Vadose Zone Soil	VHVNGELVFTKSMLGRYPQPDEVVPLVRKRLAAA*
Ga0157288_100590441	3300012901	Soil	GGVFDVHVDDQLVFEKKMIRRYPNPDDVLPRLRAVLGDEVL*
Ga0157289_101842971	3300012903	Soil	VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVMPLLRPRLVL*
Ga0157297_104245741	3300012914	Soil	NVHMDGELVFTKSMIGRYPQPDDVVPLLRERFGGG*
Ga0153915_120458852	3300012931	Freshwater Wetlands	VFDVHVDGELVFEKRMLGRYPDPDDVLPLIRDRIGPEVMRR*
Ga0164299_101478154	3300012958	Soil	GGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE*
Ga0164301_110428182	3300012960	Soil	VFDVHVDGELVFEKKMIGRYPQPDDVLPLIRERL*
Ga0164309_106873092	3300012984	Soil	VVPGADGIFDVHVGTELVFTKSMLGRYPEPEDVMPLLRPHV
Ga0164306_105167653	3300012988	Soil	VFDVHVDGDLVFEKKMLGRYPDPEDVMPLLRLRLG*
Ga0164305_101207362	3300012989	Soil	VPGVDGIFDVHVAGDLVFTKAMLGRYPGPDDVMPLLRSHLHS*
Ga0157369_117464632	3300013105	Corn Rhizosphere	HGVFDVHVDGELVFTKSMLGRYPDPDDVLPLLRPFLG*
Ga0163162_104932373	3300013306	Switchgrass Rhizosphere	FDVHVDGELVFTKSMLGRYPQPDDVVPLMRELLEG*
Ga0157375_112995742	3300013308	Miscanthus Rhizosphere	KGGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLHERFGTG*
Ga0134081_103719581	3300014150	Grasslands Soil	VHVNGDLVFTKSMLGRYPQPDDVVPLLRERLEST*
Ga0163163_100972061	3300014325	Switchgrass Rhizosphere	GDGIFDVHVNDTLVFTKSMIGRYPNTDDVLPLVHARLAA*
Ga0157380_124026171	3300014326	Switchgrass Rhizosphere	VFDVDVDGERIFFKKMIGRYPQPDDVLPLLRERIGPEVL*
Ga0157377_109545392	3300014745	Miscanthus Rhizosphere	DVHVDDQLVFAKQMIRRYPQPDDVLPLLRAVLGDEVL*
Ga0167655_10332062	3300015086	Glacier Forefield Soil	VFDVDLDGERIFFKKMIGRYPQPEDVLPLLRERIGPELL*
Ga0173480_100843106	3300015200	Soil	VTGDHGIFDVHVDGDLVFEKAMIGRYPDPDDVLPLLREKLSA*
Ga0134085_104470561	3300015359	Grasslands Soil	GIFDVHVAGDLVFTKAMIGRYPQPDDVMPLLNSHLHI*
Ga0132258_121140572	3300015371	Arabidopsis Rhizosphere	VAAVEVVPGADGIFDVHVAGDRVFTKAMIGRYPQPEDVMPLLRSRLHV*
Ga0132258_126065155	3300015371	Arabidopsis Rhizosphere	GVFDVHVDGDLVFTKSMLGRYPDPDDVLPLVRERLSS*
Ga0132258_132616332	3300015371	Arabidopsis Rhizosphere	FDVDLDGERIFYKKMIGRYPEPDDVLPLLRERIGPEVL*
Ga0132256_1019922611	3300015372	Arabidopsis Rhizosphere	FDVHVDGRLVFTKSMIGRYPDPDDVLPLVRAHLKN*
Ga0132255_1037838112	3300015374	Arabidopsis Rhizosphere	VFDVHVDGELVFEKKMLGRYPDPEDVMPLLRPRLAG*
Ga0190266_103584572	3300017965	Soil	VTGANGIFDVHVDGELVFTKSMLGRYPDPDDVTPLLGAKLDT
Ga0187822_103917532	3300017994	Freshwater Sediment	VELVPGVDGVFDVHVGENLVFTKSMLGRYPQPGDVMPLLRPHIGS
Ga0184638_12443422	3300018052	Groundwater Sediment	VTGANGIFDVHLDGELVFEKSMLGRYPEPDDVIPLFREKLGG
Ga0190265_119537813	3300018422	Soil	VVTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA
Ga0190270_100100184	3300018469	Soil	VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVLLLLGDKFRA
Ga0190274_105825302	3300018476	Soil	VFDVDVDGDRIFFKKMIGRYPQPDDVLPLLRERIGPEVL
Ga0190274_112185421	3300018476	Soil	VSAVEVVTGVDGIFDVHVGGELVFTKSMLGRYPEPDDVVPLLREKLGA
Ga0190274_139493441	3300018476	Soil	GVFDVDVDGERIFFKKMIGRYPQPDDVLPLLRERIGPEVL
Ga0193738_10793713	3300020020	Soil	VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA
Ga0210380_105072962	3300021082	Groundwater Sediment	VPGANGIFDVHVDGELVFTKSMLGRYPDPDDVTPLLGAKLDT
Ga0126371_102587832	3300021560	Tropical Forest Soil	VTGVGGVFDVHVDGDLVFEKAMLGRYPDLEDVMPLLRARLAAPRD
Ga0126371_138182041	3300021560	Tropical Forest Soil	DGIFDVHVDGELVFTKSMLGRYPQPDEVMPLLRERLVAG
Ga0247787_10019564	3300022893	Soil	VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRAKLG
Ga0247788_10150932	3300022901	Soil	VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLDA
Ga0207642_104854493	3300025899	Miscanthus Rhizosphere	VGGVFDVHVDDELVFTKSMLGRYPVPDDVLPLLRE
Ga0207650_106870641	3300025925	Switchgrass Rhizosphere	GGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE
Ga0207640_116914532	3300025981	Corn Rhizosphere	IPGGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE
Ga0207640_119068042	3300025981	Corn Rhizosphere	GVGGIFDVHVDGELVFTKSMLGRYPQPDDVMPLLRPAVGA
Ga0207658_117117851	3300025986	Switchgrass Rhizosphere	GDKGIFDVHVDDVLVFTKSMIGGYPEPDDVLPLVRAQLAS
Ga0207675_1003959912	3300026118	Switchgrass Rhizosphere	TGGVFDVHVDDQLVFAKQMIRRYPQPDDVLPLLRAVLGDEVL
Ga0209156_101707932	3300026547	Soil	VVPGADGIFDVHVAGELVFTKAMLGRYPEPDDVMPLLNSHLH
(restricted) Ga0233416_100270223	3300027799	Sediment	SIFAVTLDGELVFEKKMLGRYPDPDDVLPLLREQLG
Ga0268266_123011682	3300028379	Switchgrass Rhizosphere	GVFDVHVDRELVFTKSMLGRYPDPDDVLPLIDPHVD
Ga0247822_104717562	3300028592	Soil	VTGTGGIFDVHVDGERVFEKKLIGRYPQPDDVLPLLAEKLG
Ga0247822_110222191	3300028592	Soil	PEQRENPFDVHVDGALVFTKSMLGRYPDPDDVIPLVRAKLTG
Ga0265322_100854582	3300028654	Rhizosphere	VGGIFDVHVDGDLVFTKSMLGRYPDPDDVMPLLRSRIS
Ga0307313_100702451	3300028715	Soil	DVDGERIFFKKMIGRYPEPEDVLPLLRERIGPEVM
Ga0307498_100481822	3300031170	Soil	VFDVHVGGELVFEKSMLGRYPDPEDVMPLLRARLAA
Ga0265329_102394732	3300031242	Rhizosphere	GTGGIFDVHVGDDLVFTKSMIGRYPEPDDVMPLLRPRLGP
Ga0315290_108284921	3300031834	Sediment	GGIFDVHLDGELVFTKSMLGRYPQPEDVLPLLRERLDSG
Ga0310907_101699531	3300031847	Soil	DKGIFDVHVDDVLVFTKSMIGGYPEPDDVLPLVRAQLAS
Ga0310900_113755982	3300031908	Soil	IFDVHVDGELVFTKSMLGRYPEPDEVVPLVEARLT
Ga0310906_105447402	3300032013	Soil	VTGVGGIFDVNVDDELVFTKSMLGRYPDPDDVLPLLRAKLGP
Ga0315272_104825161	3300032018	Sediment	VDGELVFYKKMLGRYPDPDDVLPLIRERIGPEVMRER
Ga0318506_102943091	3300032052	Soil	GIFDVHVDGDLVFTKSMLGRYPEPDDVVPVLRTKLV
Ga0310890_102661882	3300032075	Soil	GGIFDVHVDGDLVFTKSMLGRYPQPDDVVPLLRAKLG
Ga0315292_111147201	3300032143	Sediment	KGGIFDVHLDGELVFTKSMIGRYPQPDDVVPLLRERLAAG
Ga0335083_100915822	3300032954	Soil	VFDVHVDGELVFTKSMLGRYPQPDDVLPLLQPYLT
Ga0247830_108149451	3300033551	Soil	FDVHVNDTLVFTKSMIGRYPNPDDVLPLVQARLAA
Ga0334961_048350_552_671	3300034143	Sub-Biocrust Soil	VFDVEVDGERLFTKSMLGRYPEPDDVLPRLRPALGDELA
Ga0364929_0153509_160_291	3300034149	Sediment	VTGADGIFDVHLDGELVFTKSMLGRYPQPDDVVPLLREKLGGA
Ga0364941_151302_465_584	3300034417	Sediment	VDGIFDVKVDDELVFTKSMLGRYPQPDDVVPLLREKLAP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign