Metagenome Family F064849

Overview

Basic Information

• Family ID: F064849
• Family Type: Metagenome
• Number of Sequences: 128
• Average Sequence Length: 42 residues
• Representative Sequence: MLSRADDLAKMTVLDAAGNTVVLGTLWRDKPAVLVFVRHFG
• Number of Associated Samples: 110
• Number of Associated Scaffolds: 128

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 47.66 %
• % of genes near scaffold ends (potentially truncated): 13.28 %
• % of genes from short scaffolds (< 2000 bps): 81.25 %
• Associated GOLD sequencing projects: 98
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (90.625 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.938 % of family members)
• Environment Ontology (ENVO): Unclassified (28.906 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (28.906 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 13.04%
  β-sheet: 8.70%
  Coil/Unstructured: 78.26%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF13911	AhpC-TSA_2	52.34
PF00365	PFK	3.91
PF10041	DUF2277	3.91
PF00645	zf-PARP	2.34
PF00069	Pkinase	2.34
PF02812	ELFV_dehydrog_N	1.56
PF02954	HTH_8	1.56
PF13187	Fer4_9	1.56
PF05099	TerB	1.56
PF08534	Redoxin	0.78
PF13540	RCC1_2	0.78
PF00576	Transthyretin	0.78
PF00037	Fer4	0.78
PF12531	DUF3731	0.78
PF12838	Fer4_7	0.78
PF12974	Phosphonate-bd	0.78
PF10009	DUF2252	0.78
PF00724	Oxidored_FMN	0.78
PF08530	PepX_C	0.78
PF13237	Fer4_10	0.78
PF13640	2OG-FeII_Oxy_3	0.78
PF05726	Pirin_C	0.78
PF12073	DUF3553	0.78
PF00248	Aldo_ket_red	0.78
PF00005	ABC_tran	0.78
PF08308	PEGA	0.78
PF01656	CbiA	0.78
PF00092	VWA	0.78
PF13519	VWA_2	0.78
PF03976	PPK2	0.78
PF00773	RNB	0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	9.38
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	3.91
COG0334	Glutamate dehydrogenase/leucine dehydrogenase	Amino acid transport and metabolism [E]	1.56
COG3793	Tellurite resistance protein TerB	Inorganic ion transport and metabolism [P]	1.56
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.78
COG0557	Exoribonuclease R	Transcription [K]	0.78
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.78
COG1902	2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family	Energy production and conversion [C]	0.78
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	0.78
COG2351	5-hydroxyisourate hydrolase (purine catabolism), transthyretin-related family	Nucleotide transport and metabolism [F]	0.78
COG2936	Predicted acyl esterase	General function prediction only [R]	0.78
COG4776	Exoribonuclease II	Transcription [K]	0.78

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.62 %
Unclassified	root	N/A	9.38 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.62 %
Unclassified	root	N/A	9.38 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.62 %
Unclassified	root	N/A	9.38 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.91 %
Unclassified	root	N/A	9.38 %

Level 5

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	43.75 %
Unclassified	root	N/A	9.38 %

Level 6

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	43.75 %
Unclassified	root	N/A	9.38 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.38 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	8.59 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	8.59 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.78 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	9.38 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	8.59 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	8.59 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.78 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459020|G1P06HT01EOTQN	All Organisms → cellular organisms → Bacteria	584
3300000956|JGI10216J12902_104525511	All Organisms → cellular organisms → Bacteria → Proteobacteria	629
3300000956|JGI10216J12902_107772892	All Organisms → cellular organisms → Bacteria	2716
3300000956|JGI10216J12902_110875296	All Organisms → cellular organisms → Bacteria → Proteobacteria	1896
3300003321|soilH1_10129447	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1959
3300003465|P52013CM_1023904	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1917
3300004000|Ga0055458_10162488	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	658
3300004067|Ga0055485_10044730	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	981
3300004114|Ga0062593_100016865	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3700
3300004266|Ga0055457_10021129	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1401
3300005077|Ga0071116_1000047	All Organisms → cellular organisms → Bacteria → Proteobacteria	118848
3300005180|Ga0066685_10029925	All Organisms → cellular organisms → Bacteria	3364
3300005329|Ga0070683_100425932	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1266
3300005329|Ga0070683_100971702	All Organisms → cellular organisms → Bacteria	815
3300005329|Ga0070683_101587430	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	629
3300005329|Ga0070683_101656427	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	615
3300005332|Ga0066388_105918918	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	618
3300005343|Ga0070687_100327666	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	981
3300005356|Ga0070674_101305301	All Organisms → cellular organisms → Bacteria	647
3300005437|Ga0070710_11166846	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	568
3300005456|Ga0070678_100503628	All Organisms → cellular organisms → Bacteria	1069
3300005467|Ga0070706_100076956	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3088
3300005471|Ga0070698_100002958	All Organisms → cellular organisms → Bacteria → Proteobacteria	18692
3300005535|Ga0070684_100858500	All Organisms → cellular organisms → Bacteria → Proteobacteria	850
3300005535|Ga0070684_101523591	All Organisms → cellular organisms → Bacteria	630
3300005541|Ga0070733_10199491	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1308
3300005548|Ga0070665_101290925	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	740
3300005764|Ga0066903_101492843	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1276
3300005764|Ga0066903_104363204	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	756
3300005834|Ga0068851_11069137	All Organisms → cellular organisms → Bacteria	511
3300006047|Ga0075024_100273623	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	818
3300006224|Ga0079037_101106022	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	786
3300006237|Ga0097621_102439881	All Organisms → cellular organisms → Bacteria	500
3300006854|Ga0075425_103001867	All Organisms → cellular organisms → Bacteria	516
3300006876|Ga0079217_10680152	All Organisms → cellular organisms → Bacteria → Proteobacteria	687
3300006880|Ga0075429_101296918	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	635
3300006954|Ga0079219_11204006	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	656
3300007004|Ga0079218_11333084	All Organisms → cellular organisms → Bacteria	759
3300009012|Ga0066710_100263865	All Organisms → cellular organisms → Bacteria	2500
3300009087|Ga0105107_10056015	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2785
3300009100|Ga0075418_11698445	All Organisms → cellular organisms → Bacteria	686
3300009111|Ga0115026_10021275	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3168
3300009111|Ga0115026_10089103	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1848
3300009120|Ga0117941_1000728	All Organisms → cellular organisms → Bacteria	13435
3300009176|Ga0105242_10543903	All Organisms → cellular organisms → Bacteria	1112
3300009540|Ga0073899_10245771	All Organisms → cellular organisms → Bacteria	1351
3300009792|Ga0126374_10772794	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	731
3300009870|Ga0131092_10401703	All Organisms → cellular organisms → Bacteria	1276
3300009873|Ga0131077_10000807	All Organisms → cellular organisms → Bacteria	84888
3300010166|Ga0126306_11736300	All Organisms → cellular organisms → Bacteria	522
3300010359|Ga0126376_12148520	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	602
3300010364|Ga0134066_10427748	Not Available	512
3300010371|Ga0134125_10693287	Not Available	1123
3300010371|Ga0134125_10886392	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	980
3300010397|Ga0134124_13192842	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	502
3300010399|Ga0134127_11019077	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	889
3300010399|Ga0134127_13720304	Not Available	501
3300012363|Ga0137390_10521393	All Organisms → cellular organisms → Bacteria	1161
3300012469|Ga0150984_120340609	Not Available	512
3300012922|Ga0137394_10597756	Not Available	933
3300012931|Ga0153915_10014974	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	7506
3300012964|Ga0153916_11136835	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	860
(restricted) 3300013132|Ga0172372_10199400	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1517
3300014169|Ga0181531_10101925	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1715
3300014317|Ga0075343_1084422	All Organisms → cellular organisms → Bacteria	700
3300014323|Ga0075356_1022155	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1225
3300014969|Ga0157376_11950837	All Organisms → cellular organisms → Bacteria	624
3300015194|Ga0167666_1023121	All Organisms → cellular organisms → Bacteria	1700
3300015265|Ga0182005_1216089	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	582
3300015371|Ga0132258_13909180	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1013
3300015373|Ga0132257_101611366	All Organisms → cellular organisms → Bacteria	830
3300015373|Ga0132257_104364791	All Organisms → cellular organisms → Bacteria	515
3300017973|Ga0187780_10035960	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	3480
3300018431|Ga0066655_10704390	All Organisms → cellular organisms → Bacteria	684
3300018466|Ga0190268_12280481	All Organisms → cellular organisms → Bacteria	509
3300018469|Ga0190270_11372688	All Organisms → cellular organisms → Bacteria	752
3300018476|Ga0190274_10847064	All Organisms → cellular organisms → Bacteria	976
3300018476|Ga0190274_10997864	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	911
3300019487|Ga0187893_10621138	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	681
3300019886|Ga0193727_1102128	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	844
3300021377|Ga0213874_10333333	Not Available	578
3300021384|Ga0213876_10040022	All Organisms → cellular organisms → Bacteria	2476
(restricted) 3300023208|Ga0233424_10408142	Not Available	509
3300025155|Ga0209320_10410129	All Organisms → cellular organisms → Bacteria	542
3300025550|Ga0210098_1033448	All Organisms → cellular organisms → Bacteria	807
3300025910|Ga0207684_10064823	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3102
3300025918|Ga0207662_10384782	All Organisms → cellular organisms → Bacteria	948
3300025921|Ga0207652_10534115	All Organisms → cellular organisms → Bacteria	1055
3300025934|Ga0207686_11429913	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	569
3300025937|Ga0207669_11632840	All Organisms → cellular organisms → Bacteria	550
3300026070|Ga0208423_1005214	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1219
3300027811|Ga0256868_10113603	All Organisms → cellular organisms → Bacteria → Proteobacteria	1198
3300027818|Ga0209706_10110578	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1364
3300027867|Ga0209167_10678979	Not Available	563
3300027877|Ga0209293_10001933	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5148
3300027877|Ga0209293_10330502	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	779
3300027886|Ga0209486_10625780	All Organisms → cellular organisms → Bacteria → Proteobacteria	685
3300027900|Ga0209253_10315892	All Organisms → cellular organisms → Bacteria	1209
3300027915|Ga0209069_10330028	All Organisms → cellular organisms → Bacteria	818
3300028379|Ga0268266_12030173	All Organisms → cellular organisms → Bacteria	548
3300030002|Ga0311350_11609884	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	575
3300031538|Ga0310888_10534554	All Organisms → cellular organisms → Bacteria → Proteobacteria	705
3300031576|Ga0247727_10049031	All Organisms → cellular organisms → Bacteria → Proteobacteria	5206
3300031716|Ga0310813_11311326	All Organisms → cellular organisms → Bacteria	669
3300031720|Ga0307469_12203962	Not Available	537
3300031740|Ga0307468_100756631	All Organisms → cellular organisms → Bacteria	822
3300032017|Ga0310899_10516210	All Organisms → cellular organisms → Bacteria	589
3300032144|Ga0315910_11220075	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	587
3300032157|Ga0315912_10199818	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1569
3300032782|Ga0335082_10065604	All Organisms → cellular organisms → Bacteria → Proteobacteria	3694
3300032782|Ga0335082_10703951	All Organisms → cellular organisms → Bacteria	872
3300032783|Ga0335079_11834941	Not Available	589
3300032893|Ga0335069_10179834	All Organisms → cellular organisms → Bacteria	2595
3300032954|Ga0335083_10000598	All Organisms → cellular organisms → Bacteria → Proteobacteria	53565
3300033408|Ga0316605_10169377	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1800
3300033408|Ga0316605_10402239	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1236
3300033412|Ga0310810_10158310	All Organisms → cellular organisms → Bacteria → Proteobacteria	2620
3300033413|Ga0316603_10202332	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1691
3300033433|Ga0326726_10015352	All Organisms → cellular organisms → Bacteria	6681
3300033433|Ga0326726_12506157	Not Available	500
3300033480|Ga0316620_10174848	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1758
3300033480|Ga0316620_10188419	All Organisms → cellular organisms → Bacteria	1705
3300033480|Ga0316620_11111581	All Organisms → cellular organisms → Bacteria	772
3300033486|Ga0316624_11487814	All Organisms → cellular organisms → Bacteria	622
3300033487|Ga0316630_10697214	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	860
3300033513|Ga0316628_100070926	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3751
3300034194|Ga0370499_0003583	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3234
3300034268|Ga0372943_1153996	Not Available	518

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.25%
Host-Associated	Host-Associated	15.62%
Engineered	Engineered	3.12%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.84%
Aquatic	Environmental → Aquatic	16.41%
Plants	Host-Associated → Plants	15.62%
Wastewater	Engineered → Wastewater	2.34%
Solid Waste	Engineered → Solid Waste	0.78%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.94%
Freshwater	Environmental → Aquatic → Freshwater	10.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.91%
Marine	Environmental → Aquatic → Marine	3.12%
Sediment	Environmental → Aquatic → Sediment	2.34%
Peat	Environmental → Terrestrial → Peat	2.34%
Roots	Host-Associated → Plants → Roots	2.34%
Activated Sludge	Engineered → Wastewater → Activated Sludge	2.34%
Cave	Environmental → Terrestrial → Cave	1.56%
Grass	Engineered → Solid Waste → Grass	0.78%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	33.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	14.84%
Loam	Environmental → Terrestrial → Soil → Loam	12.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.47%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.69%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.91%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.12%
Wetlands	Environmental → Aquatic → Marine → Wetlands	3.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.34%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.34%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	2.34%
Lake	Environmental → Aquatic → Freshwater → Lake	1.56%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.56%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.56%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.78%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.78%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.78%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Composting	Engineered → Solid Waste → Grass → Composting	0.78%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.53%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	14.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.16%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.47%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.69%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.91%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.12%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.34%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.34%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.34%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.34%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.34%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	2.34%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.56%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.56%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.56%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.56%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.78%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.78%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.78%
Mine Drainage	Environmental → Terrestrial → Soil → Unclassified → Mine Drainage	0.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.78%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	10.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.81%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	5.47%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.91%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	3.12%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.12%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.12%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.12%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.34%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.34%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.34%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.34%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.56%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.56%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.56%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.56%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.56%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.56%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.56%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.56%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.56%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.56%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.78%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.78%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.78%
Sinkhole	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole	0.78%
Lake Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.78%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.78%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.78%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.78%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.78%
Ore Pile And Mine Drainage Contaminated Soil	Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil	0.78%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.78%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.78%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.78%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.78%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.78%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.78%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.78%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.78%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
2170459020	Litter degradation NP2	Engineered
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300003321	Sugarcane bulk soil Sample H1	Environmental
3300003465	Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample	Environmental
3300004000	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2	Environmental
3300004067	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004266	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1	Environmental
3300005077	Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014	Environmental
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental
3300009120	Lake sediment microbial communities from Tanners Lake, St. Paul, MN	Environmental
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009540	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph	Engineered
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental
3300014317	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1	Environmental
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015194	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout)	Environmental
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated
3300023208 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG	Environmental
3300025155	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4	Environmental
3300025550	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes)	Environmental
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300026070	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes)	Environmental
3300027811	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq	Environmental
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300030002	II_Fen_N1 coassembly	Environmental
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2NP_04134720	2170459020	Switchgrass, Maize And Mischanthus Litter	MSQRAADLASMTVLDADRNAIVLGTLWKDRTAVVVFVRHFG
JGI10216J12902_1045255112	3300000956	Soil	MLNRADDLAKLTVLDERGQTVELGTLWRDRPAVLVFIRHFG*
JGI10216J12902_1077728922	3300000956	Soil	MLTRADDLAKLTVQDDKGGTVKLGSLWADKTAVLVFVRHFG*
JGI10216J12902_1108752963	3300000956	Soil	MLTRADDLAKMTVLDETGGTVELGTLWRDKTAVLVFIRHFG*
soilH1_101294474	3300003321	Sugarcane Root And Bulk Soil	MLDRADDLAKLTVQDEHGRSLELGSLWKDHPIVLAFVRHFG*
P52013CM_10239044	3300003465	Ore Pile And Mine Drainage Contaminated Soil	MLNRADDLATLTVLDEQGTPVALGTFWKDKPAVLVFTRHFG*
Ga0055458_101624881	3300004000	Natural And Restored Wetlands	SPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG*
Ga0055485_100447302	3300004067	Natural And Restored Wetlands	MSVHADDLAKLPVLDSAGTKIELGTLWRDRVAVLVFIRHFG*
Ga0062593_1000168654	3300004114	Soil	MLNRADDLANMTVLDEQGTPVALGTFWKDKPAVLVFTRHFG*
Ga0055457_100211292	3300004266	Natural And Restored Wetlands	VGSPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG*
Ga0071116_10000479	3300005077	Sinkhole	MNLAGKLAGMDVLDPAGQSVRLGTYWQDRPAVLVFVRHFG*
Ga0066685_100299253	3300005180	Soil	MLTRADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG*
Ga0070683_1004259322	3300005329	Corn Rhizosphere	MALARADALAEMSVLDAHGDKVTLGTLWKDKPAVLAFVRHFG*
Ga0070683_1009717021	3300005329	Corn Rhizosphere	MLDRADDLAKLTVQDEQGRSLELGSLWKDHAIVLAFVRHFG*
Ga0070683_1015874302	3300005329	Corn Rhizosphere	MSTRADDLATMTVLDERGQSVALGTFWRDRPAVLAFVRHFG*
Ga0070683_1016564272	3300005329	Corn Rhizosphere	MLDRADDLATLTVLDEHGTPVELGTFWKGRTAALVFTRHFG*
Ga0066388_1059189182	3300005332	Tropical Forest Soil	MSRADDLATMTVLDETKAVVTLGTLWRDQPAILVFVRHFG*
Ga0070687_1003276662	3300005343	Switchgrass Rhizosphere	MLSRADDLATMTVLDETGATVELGRLWRDKAAVLVFVRHFG*
Ga0070674_1013053012	3300005356	Miscanthus Rhizosphere	MLSRADDLATMTVLDAAGANVQLGTLWRDQPAVLVFVRHFG*
Ga0070710_111668462	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	GPRSDMKRGVLTRADDLARMNVLDDHGAPVAVGSMWRERTAVLVFVRHFG*
Ga0070678_1005036282	3300005456	Miscanthus Rhizosphere	MLTRADDLAKLIVQDEHGRSVELGTLWREHPIALAFVRHFG*
Ga0070706_1000769561	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MLERADDLAKLTVLDEHGKTLELGTLWAARPAVLVFVRHFG*
Ga0070698_1000029588	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MLSRADDLAKMTVLDEQGQAVEVGTFWRDHTAVLVFVRHFG*
Ga0070684_1008585001	3300005535	Corn Rhizosphere	MLDRADDLAKLTVLDEHGTPVELGTFWKGRTAALVFTRHFG*
Ga0070684_1015235911	3300005535	Corn Rhizosphere	MNSRADDLASMTVLDDTGKPVVLGTFWKDRPAVLAFVRHFG*
Ga0070733_101994913	3300005541	Surface Soil	MQRADDLAAMTVLDEHGERVVLGTLWRDHSAVLAFVRHFG*
Ga0070665_1012909252	3300005548	Switchgrass Rhizosphere	MLTQADDLAKLTVQDEHGRSIELGSLWREHPVTLAFVRHFG*
Ga0066903_1014928432	3300005764	Tropical Forest Soil	VLERADALAEMPVQDARGEPVVLGTLWREKPAVLAFVRHFG*
Ga0066903_1043632043	3300005764	Tropical Forest Soil	LATMTVLDETKTAVTLGTLWRDQPAILVFVRHFG*
Ga0068851_110691372	3300005834	Corn Rhizosphere	MDARDLAEMTVLDAARQPIVLGTLWKDKPAVLSFVRHFG*
Ga0075024_1002736231	3300006047	Watersheds	MLDRANDLARMTVLDESGATILLGTLWHERPAVLVFVRHFG*
Ga0079037_1011060221	3300006224	Freshwater Wetlands	MLTRADDLASLSVLSEDGGQVALGMLWRERPAILVFVRHFG*
Ga0097621_1024398812	3300006237	Miscanthus Rhizosphere	MLSRADDLATMTVLDAAGANVQLGTLWRDKPAVLVFVRHFG*
Ga0075425_1030018672	3300006854	Populus Rhizosphere	MLTRADDLARMTVLDADGQAVELGTLWRDRPAVLVFIRHFG*
Ga0079217_106801522	3300006876	Agricultural Soil	MLHRADDLAKLTVLDERGNPVELGTFWRERTAALVFVRHFG*
Ga0075429_1012969182	3300006880	Populus Rhizosphere	DLATMTVLDADRNKVVLGTLWKDRTAVLVFVRHFG*
Ga0079219_112040062	3300006954	Agricultural Soil	MLSRADDLATMTVLDEAGTAIELGTLWRDKPAVLVFVRHFG*
Ga0079218_113330842	3300007004	Agricultural Soil	VGSYDAGMLSRADDLATMTVLDDKGGKIELGTLWRDKPAVLVFLRHFG*
Ga0066710_1002638652	3300009012	Grasslands Soil	MLTRADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG
Ga0105107_100560154	3300009087	Freshwater Sediment	MSSRADDLARMTVLDADGRAVVLGDFWKDRTAVLVFLRHFG*
Ga0075418_116984452	3300009100	Populus Rhizosphere	MPELVSTRADDLATMTVLDADRNKVVLGTLWKDRTAVLVFVRHFG*
Ga0115026_100212753	3300009111	Wetland	MLTRADDLAKMTVLDEHKTKVELGTLWRDKPAVLVFVRHFG*
Ga0115026_100891033	3300009111	Wetland	MLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG*
Ga0117941_100072810	3300009120	Lake Sediment	MSLERADDLAKLTVLDEQRHALELGTLWRDRPAVLVFVRHFG*
Ga0105242_105439032	3300009176	Miscanthus Rhizosphere	MSSIANDLGKLTVQDEAGKTIVVGTLWRDKTAVLVFVRHFG*
Ga0073899_102457713	3300009540	Activated Sludge	MAPDVGYNDWMLTRADDLATMSVLDENGNPITLGTLWHDKTAVLVFTRHFG*
Ga0126374_107727942	3300009792	Tropical Forest Soil	MHGRADDLAAMTVLDEQGTKVPLGPLWKDRTAILVFVRHFG*
Ga0131092_104017032	3300009870	Activated Sludge	MLTRADDLATMTVLDAAKHPVTLGSLWQDKPAVLVFVRHFG*
Ga0131077_1000080728	3300009873	Wastewater	MLTRADDLAKMTVLDAAKQVVTLGTLWRDKPAVLVFVRHFG*
Ga0126306_117363002	3300010166	Serpentine Soil	MLTRADDLAKMTVLDEHGGTVELASLWKDKPAVLVFIRHFG*
Ga0126376_121485202	3300010359	Tropical Forest Soil	VLARADDLATMTVLDARGEPVVLGTLWRDRPAVLAFVRHFG*
Ga0134066_104277481	3300010364	Grasslands Soil	MLTRADDLAKMTVLDDKGAKVELGTLWRDKPVVLVFVRHFG*
Ga0134125_106932872	3300010371	Terrestrial Soil	MLTRADDLAKLTVQDEHGRSVELGTLWREHPIALAFVRHFG*
Ga0134125_108863923	3300010371	Terrestrial Soil	WQDSAMLDRADDLAKLTVQDEHGRSLELGSLWKDHPIVLAFVRHFG*
Ga0134124_131928421	3300010397	Terrestrial Soil	MLNRADDLASMTVLDEKGTPVALGTFWKTKPAVLVFVRHFG*
Ga0134127_110190771	3300010399	Terrestrial Soil	METRADDLGKLTVLDEQGEKVQVSTLWRDQTAVLV
Ga0134127_137203041	3300010399	Terrestrial Soil	MLSRADDLATMTVLDETGAAVELGRLWRDKAAVLVFVRHFG*
Ga0137390_105213932	3300012363	Vadose Zone Soil	MLSRADDLARMAVFDADGRAVELGTLWRDRPAVLVFIRHFG*
Ga0150984_1203406092	3300012469	Avena Fatua Rhizosphere	MLTSADDLAKLTVQDEHGRSIELGTLWRDHPVALAFVR
Ga0137394_105977562	3300012922	Vadose Zone Soil	MTMLDRADDLAAMTVLDPEGKSVVLGTLWRERPAVLAF
Ga0153915_100149749	3300012931	Freshwater Wetlands	MLHRADDLAKMTVLDATGATVEVGSFWRDHTAVLVFLRHFG*
Ga0153916_111368353	3300012964	Freshwater Wetlands	MLTRADDLANLTVLDDHGGSVRLGTLWRDKPAVLVFVRHFG*
(restricted) Ga0172372_101994003	3300013132	Freshwater	MMRSSDRMTMLTRADDLAAMTVLDEAGATVTLGTLWRDRPVVLVFLRHFG*
Ga0181531_101019253	3300014169	Bog	MTRTPQLARADDLTNLTVLDEHGEPVVLGTLWRERPAVLAFVRHFG*
Ga0075343_10844221	3300014317	Natural And Restored Wetlands	LAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG*
Ga0075356_10221551	3300014323	Natural And Restored Wetlands	MILSMLDRADDLAKMTVLDPSGSPVVLGTLWRDKVAVLVFLRHFG*
Ga0157376_119508372	3300014969	Miscanthus Rhizosphere	VLDRADDLAPMTVLDGRGDRIELGTLWRDHTAVLAFVRHFG*
Ga0167666_10231212	3300015194	Glacier Forefield Soil	MLDRADDLAKLTVLDADGRTVVLGTLWKTQTAILVFLRHFG*
Ga0182005_12160892	3300015265	Rhizosphere	CSAASSCYDAAMLSRADDLAPMTVLDEQGGKVPLGTLWRDKTAVLAFVRHFG*
Ga0132258_139091802	3300015371	Arabidopsis Rhizosphere	MLGRADDLAKLTVLDENSATIELGTLWRDKPAGLAFVRHFG*
Ga0132257_1016113662	3300015373	Arabidopsis Rhizosphere	MLGRADDLAKLTVLDENSATIELGTLWRDKPAVLAFVRHFG*
Ga0132257_1043647912	3300015373	Arabidopsis Rhizosphere	CPTMNSRADDLASMTVLDDAGKPVILGTLWKDRPAVLAFVRHFG*
Ga0187780_100359602	3300017973	Tropical Peatland	VSLERADDLATMTVLDEQGQPVVLGTLWRERPAVLAFVRHFG
Ga0066655_107043901	3300018431	Grasslands Soil	ADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG
Ga0190268_122804812	3300018466	Soil	MLSRADDLAKMTVLDARGSTVVLGTLWRDKPAVLVFVRHFG
Ga0190270_113726882	3300018469	Soil	MLSRADDLAKMTVLDAAGNTVVLGTLWRDKPAVLVFVRHFG
Ga0190274_108470643	3300018476	Soil	MLSRADDLAKMTVLDATGGSVVLGTLWRDKPAVLVFVRHFG
Ga0190274_109978642	3300018476	Soil	MIAGMRADDLATMTVLDERGDKVVLGTLWATKPAVLVFIRHFG
Ga0187893_106211382	3300019487	Microbial Mat On Rocks	MLTRADDLATMTVLDEAGHAVELGTLWRDRAVVLVFLRHFG
Ga0193727_11021283	3300019886	Soil	METRADDLAKLTVLDAAGASVELGTLWRDRVAVLVFVRHFG
Ga0213874_103333332	3300021377	Plant Roots	MLQNCYVLTRADDLATMTVLDEASREVVLGTLWAERTAVLAFVRHFG
Ga0213876_100400223	3300021384	Plant Roots	MLDRADDLAKLTVQDEHGRSVELGSLWADHAIVLAFVRHFG
(restricted) Ga0233424_104081422	3300023208	Freshwater	MVRADDLAKLRIQDEKGGEIELGALWRDKTAVLVWIRHFG
Ga0209320_104101292	3300025155	Soil	MQRETSTAADDLAGLPVQDEHGATHTLGEAWRERTAVLAFVRHFG
Ga0210098_10334482	3300025550	Natural And Restored Wetlands	VGSPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG
Ga0207684_100648234	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MLERADDLAKLTVLDEHGKTLELGTLWAARPAVLVFVRHFG
Ga0207662_103847822	3300025918	Switchgrass Rhizosphere	MLSRADDLATMTVLDETGATVELGRLWRDKAAVLVFVRHFG
Ga0207652_105341152	3300025921	Corn Rhizosphere	MLDRADDLAKLTVLDEHGRSLELGTLWKDHAIVLAFVRHFG
Ga0207686_114299132	3300025934	Miscanthus Rhizosphere	MSSIANDLGKLTVQDEAGKTIVVGTLWRDKTAVLVFVRHFG
Ga0207669_116328401	3300025937	Miscanthus Rhizosphere	MLSRADDLATMTVLDAAGANVQLGTLWRDQPAVLVFVRHFG
Ga0208423_10052141	3300026070	Natural And Restored Wetlands	SPARPHPSMILSMLDRADDLAKMTVLDPSGSPVVLGTLWRDKVAVLVFLRHFG
Ga0256868_101136032	3300027811	Soil	MSSQTDDLAKLTVLDDDGKSIELGTLWHDRTAVLVFVRHFG
Ga0209706_101105782	3300027818	Freshwater Sediment	MSSRADDLARMTVLDADGRAVVLGDFWKDRTAVLVFLRHFG
Ga0209167_106789792	3300027867	Surface Soil	MQRADDLAAMTVLDEHGERVVLGTLWRDHSAVLAFVRHFG
Ga0209293_100019333	3300027877	Wetland	MLTRADDLAKMTVLDEHKTKVELGTLWRDKPAVLVFVRHFG
Ga0209293_103305022	3300027877	Wetland	MLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG
Ga0209486_106257802	3300027886	Agricultural Soil	MLTRADDLAKMTVLDENKQAVELGTLWRDKPAVLVFLRHFG
Ga0209253_103158923	3300027900	Freshwater Lake Sediment	MIFSMLTRADDLATMTVLDPAGSPVVLGTLWRDKVAVLV
Ga0209069_103300283	3300027915	Watersheds	MLDRANDLARMTVLDESGATILLGTLWHERPAVLVFVRHFG
Ga0268266_120301732	3300028379	Switchgrass Rhizosphere	MRTHADDLARLTVQDENGRSIELGSLWREHPVTLAFVRHFG
Ga0311350_116098842	3300030002	Fen	MKRADDLARLAVLDERGAEVVLGTLWRDRPAVLAFVRHFG
Ga0310888_105345542	3300031538	Soil	LLGTRVRYDIRMRARADDLARLTVLDEHGRAIALGTLWQDRPSVLVFTRHFG
Ga0247727_100490313	3300031576	Biofilm	MDLASLSVLDAAGAPVPLGTAWRDRPAVLVFLRHFG
Ga0310813_113113261	3300031716	Soil	MLSRADDLAKLTVLDENSAAVELGTLWRDKPAVLAFVRHFG
Ga0307469_122039622	3300031720	Hardwood Forest Soil	VTMLHRADDLAAMTVLDSNGKPVVLATLWRERPAVLAFVRHFG
Ga0307468_1007566313	3300031740	Hardwood Forest Soil	MLSRADDLATMTVLDEGGTAVTLGTLWRDRPAVLVFVRHFG
Ga0310899_105162102	3300032017	Soil	MRADDLAHLTVLDAAGKPVELRTFWRERTAALVFVRHFG
Ga0315910_112200751	3300032144	Soil	MRVGYDSRMLHRADDMAKLTVLDERGNAVELGTFWRDRPAALVFTRHFG
Ga0315912_101998183	3300032157	Soil	MLSRADDLAKLTVLDESGKTIEVGTLWRDQIAVLVFVRHFG
Ga0335082_100656042	3300032782	Soil	MSLARADDLAAMTVLDDHGEPVVVGTLWAEHPAVLAFVRHFG
Ga0335082_107039512	3300032782	Soil	MVHSPAMLHRADDLANMTVLDEAGGKVVLGTLWRERTAVLVFVRHFG
Ga0335079_118349412	3300032783	Soil	MSSATLRRADDLAGMTVLDEHGQPVVLGTLWHDRAAV
Ga0335069_101798344	3300032893	Soil	MSGATLRRADDLAALTVLDEHGQPVVLGTLWRDRAAVLAFVRHFG
Ga0335083_1000059819	3300032954	Soil	MSSATLRRADDLAGMTVLDEHGQPVVLGTLWHDRAAVLAFVRHFG
Ga0316605_101693772	3300033408	Soil	MLTRADDLASLSVLSEDGGQVALGMLWRERPAILVFVRHFG
Ga0316605_104022391	3300033408	Soil	MLTRADDLSKMTVLDEHKSKVELGTLWRDKPAVLVFVRHFG
Ga0310810_101583104	3300033412	Soil	MLDRADDLATLTVLDEHGTPVELGTFWKGRTAALVFTRHFG
Ga0316603_102023323	3300033413	Soil	MLTRADDLAKMTVLDEHKSKVELGTLWRDKPAVLVFVRHFG
Ga0326726_100153525	3300033433	Peat Soil	MLHRADDLAKMTVLDATGATVVVGSFWRDHAAVLVFLRHFG
Ga0326726_125061571	3300033433	Peat Soil	MSTATALAPISVLDVNGDEVRLGDLWRDRSAVLVFVRHFG
Ga0316620_101748484	3300033480	Soil	GTCLIVRYDGAMLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG
Ga0316620_101884193	3300033480	Soil	MLERADDLATMTVQDEHGQPVELATLWRDRPVALAFVRHFG
Ga0316620_111115812	3300033480	Soil	MLHRADDLAKMTVLDEAGEPVVLGTLWRDRPAVLVFLRHFG
Ga0316624_114878142	3300033486	Soil	RRMLERADDLANMTVQDEHGQPVELGTLWRDRPVALAFVRHFG
Ga0316630_106972142	3300033487	Soil	MLTRADDLAKLTVLDEAGARVELGTLWRDKPAVLVFIRHFG
Ga0316628_1000709265	3300033513	Soil	MLERADDLATMTVQDEHGQPVELGALWRDRPVALAFVRHFG
Ga0370499_0003583_2135_2260	3300034194	Untreated Peat Soil	MLTRADDLATMTVLDDRSTKVVLGTLWRDKPAVLVFLRHFG
Ga0372943_1153996_365_490	3300034268	Soil	MLNRADDLAQMTVQDEHGRSVVLGSLWADHPIVLAFVRHFG