| Basic Information | |
|---|---|
| Family ID | F064834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.25 % |
| % of genes near scaffold ends (potentially truncated) | 14.06 % |
| % of genes from short scaffolds (< 2000 bps) | 80.47 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.312 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (6.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.312 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 27.69% β-sheet: 0.00% Coil/Unstructured: 72.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01593 | Amino_oxidase | 27.34 |
| PF00117 | GATase | 24.22 |
| PF13450 | NAD_binding_8 | 24.22 |
| PF00425 | Chorismate_bind | 7.03 |
| PF04715 | Anth_synt_I_N | 3.91 |
| PF06969 | HemN_C | 3.12 |
| PF03972 | MmgE_PrpD | 0.78 |
| PF03328 | HpcH_HpaI | 0.78 |
| PF00206 | Lyase_1 | 0.78 |
| PF00133 | tRNA-synt_1 | 0.78 |
| PF13620 | CarboxypepD_reg | 0.78 |
| PF04945 | YHS | 0.78 |
| PF01491 | Frataxin_Cyay | 0.78 |
| PF01180 | DHO_dh | 0.78 |
| PF01252 | Peptidase_A8 | 0.78 |
| PF07609 | DUF1572 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 7.81 |
| COG0635 | Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase | Coenzyme transport and metabolism [H] | 3.12 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.56 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.78 |
| COG1965 | Fe-S cluster assembly protein CyaY, frataxin homolog | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.78 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.78 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.78 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.31 % |
| Unclassified | root | N/A | 4.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402H8S8H | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300004024|Ga0055436_10117078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300004782|Ga0062382_10362762 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005327|Ga0070658_10030389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4340 | Open in IMG/M |
| 3300005327|Ga0070658_10501179 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005344|Ga0070661_100161715 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300005439|Ga0070711_101859733 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005458|Ga0070681_10046970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4316 | Open in IMG/M |
| 3300005533|Ga0070734_10511196 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005539|Ga0068853_100058489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3328 | Open in IMG/M |
| 3300005547|Ga0070693_101085338 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005548|Ga0070665_101052716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300005548|Ga0070665_101132913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300005563|Ga0068855_100015537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 9165 | Open in IMG/M |
| 3300005563|Ga0068855_100192172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2302 | Open in IMG/M |
| 3300005563|Ga0068855_100213987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2164 | Open in IMG/M |
| 3300005563|Ga0068855_100669092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1113 | Open in IMG/M |
| 3300005618|Ga0068864_100018236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5859 | Open in IMG/M |
| 3300005618|Ga0068864_100724544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300005836|Ga0074470_10359660 | All Organisms → cellular organisms → Bacteria | 97103 | Open in IMG/M |
| 3300005836|Ga0074470_10564789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1801 | Open in IMG/M |
| 3300005836|Ga0074470_10842032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11104 | Open in IMG/M |
| 3300005836|Ga0074470_10933002 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300005842|Ga0068858_100014094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7539 | Open in IMG/M |
| 3300005843|Ga0068860_101086086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300005843|Ga0068860_101120058 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005994|Ga0066789_10127148 | Not Available | 1087 | Open in IMG/M |
| 3300006050|Ga0075028_100161002 | Not Available | 1191 | Open in IMG/M |
| 3300006050|Ga0075028_100613474 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006052|Ga0075029_101116032 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006055|Ga0097691_1070726 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300006059|Ga0075017_100669900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 797 | Open in IMG/M |
| 3300006162|Ga0075030_100163827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1796 | Open in IMG/M |
| 3300006237|Ga0097621_100453619 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300006358|Ga0068871_100053604 | Not Available | 3270 | Open in IMG/M |
| 3300006358|Ga0068871_100251007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1541 | Open in IMG/M |
| 3300006638|Ga0075522_10077801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1840 | Open in IMG/M |
| 3300006638|Ga0075522_10366234 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006638|Ga0075522_10462619 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006638|Ga0075522_10536550 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006804|Ga0079221_10013805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3155 | Open in IMG/M |
| 3300006881|Ga0068865_100359293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1182 | Open in IMG/M |
| 3300009093|Ga0105240_10003269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 25338 | Open in IMG/M |
| 3300009143|Ga0099792_10217291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300009177|Ga0105248_11307705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300010341|Ga0074045_10793466 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010373|Ga0134128_10534075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1307 | Open in IMG/M |
| 3300010373|Ga0134128_11644982 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300010373|Ga0134128_12078264 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010397|Ga0134124_10994820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 850 | Open in IMG/M |
| 3300010401|Ga0134121_11258059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300010403|Ga0134123_11949481 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010880|Ga0126350_12228747 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010880|Ga0126350_12287236 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012202|Ga0137363_11509520 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012362|Ga0137361_10460728 | Not Available | 1168 | Open in IMG/M |
| 3300012917|Ga0137395_10138381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1657 | Open in IMG/M |
| 3300012925|Ga0137419_11945738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 505 | Open in IMG/M |
| 3300012929|Ga0137404_10306911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1378 | Open in IMG/M |
| 3300012931|Ga0153915_10711726 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300013296|Ga0157374_10247245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1755 | Open in IMG/M |
| 3300013297|Ga0157378_10674670 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300013308|Ga0157375_11757662 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014159|Ga0181530_10362182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300014162|Ga0181538_10656294 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300014200|Ga0181526_10550668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300014325|Ga0163163_10014959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7151 | Open in IMG/M |
| 3300014493|Ga0182016_10009054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9937 | Open in IMG/M |
| 3300014495|Ga0182015_10231290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300014501|Ga0182024_10145999 | Not Available | 3334 | Open in IMG/M |
| 3300014838|Ga0182030_10288712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1823 | Open in IMG/M |
| 3300014968|Ga0157379_11686350 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300014969|Ga0157376_11631762 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300015063|Ga0167649_100334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 7243 | Open in IMG/M |
| 3300015195|Ga0167658_1040543 | Not Available | 1182 | Open in IMG/M |
| 3300018033|Ga0187867_10621149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300018034|Ga0187863_10819954 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018062|Ga0187784_10054859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3228 | Open in IMG/M |
| 3300018086|Ga0187769_10397899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1036 | Open in IMG/M |
| 3300018088|Ga0187771_10008246 | All Organisms → cellular organisms → Bacteria | 7468 | Open in IMG/M |
| 3300020214|Ga0194132_10403287 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300020580|Ga0210403_11190115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021420|Ga0210394_11156426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300025862|Ga0209483_1137073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1031 | Open in IMG/M |
| 3300025862|Ga0209483_1203345 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025909|Ga0207705_10172149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1631 | Open in IMG/M |
| 3300025911|Ga0207654_10450147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 903 | Open in IMG/M |
| 3300025911|Ga0207654_10492513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300025911|Ga0207654_10518615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300025913|Ga0207695_10005188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17438 | Open in IMG/M |
| 3300025913|Ga0207695_10175644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2065 | Open in IMG/M |
| 3300025914|Ga0207671_10776585 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025919|Ga0207657_11269673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025921|Ga0207652_10982717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 743 | Open in IMG/M |
| 3300025924|Ga0207694_11563530 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025927|Ga0207687_10238093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1441 | Open in IMG/M |
| 3300025929|Ga0207664_11232987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300025934|Ga0207686_10090486 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300025934|Ga0207686_10446711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 994 | Open in IMG/M |
| 3300025935|Ga0207709_10238163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300025937|Ga0207669_10629393 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300025949|Ga0207667_10005423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15550 | Open in IMG/M |
| 3300026041|Ga0207639_10528403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1081 | Open in IMG/M |
| 3300026078|Ga0207702_12336960 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026088|Ga0207641_10024277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4997 | Open in IMG/M |
| 3300027879|Ga0209169_10428609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300027894|Ga0209068_10070890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1799 | Open in IMG/M |
| 3300027911|Ga0209698_10160376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1839 | Open in IMG/M |
| 3300027911|Ga0209698_10700854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 771 | Open in IMG/M |
| 3300028379|Ga0268266_10018740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5896 | Open in IMG/M |
| 3300029987|Ga0311334_10320653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300031234|Ga0302325_11323059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300031250|Ga0265331_10142256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1091 | Open in IMG/M |
| 3300031474|Ga0170818_112326577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300031708|Ga0310686_107713233 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300031708|Ga0310686_114626857 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031708|Ga0310686_114627619 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031711|Ga0265314_10454655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300031715|Ga0307476_10321500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1137 | Open in IMG/M |
| 3300031718|Ga0307474_10594446 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031718|Ga0307474_11354818 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031720|Ga0307469_10539510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1031 | Open in IMG/M |
| 3300031962|Ga0307479_10814756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300033433|Ga0326726_11837580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 590 | Open in IMG/M |
| 3300033480|Ga0316620_10383026 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300033480|Ga0316620_11396664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300033486|Ga0316624_10807781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300033513|Ga0316628_104006748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.25% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.91% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.56% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_07925030 | 2189573004 | Grass Soil | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVPS |
| Ga0055436_101170781 | 3300004024 | Natural And Restored Wetlands | MLMDFQPSDIVFFAIVIWLAIHLSDGGSGGRRSRVPAAL* |
| Ga0062382_103627621 | 3300004782 | Wetland Sediment | MKALMDVQPSDIVFLAIVIWLAIDLTGGGGGGRRKRIPVLA* |
| Ga0070658_100303893 | 3300005327 | Corn Rhizosphere | MGPRMDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS* |
| Ga0070658_105011791 | 3300005327 | Corn Rhizosphere | MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI* |
| Ga0070661_1001617152 | 3300005344 | Corn Rhizosphere | MDVQPSDLVFLAIVIWLVIELTGGGGGGLRDRTPALSRAA* |
| Ga0070711_1018597331 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IMEPRMDFQPSDIVFLAVVIWLAIELTSGGGGGRRKRVPVAS* |
| Ga0070681_100469702 | 3300005458 | Corn Rhizosphere | MEPRMDFQPSDFVFLALVIWLAIELTSGGGGGRRQRVPAAS* |
| Ga0070734_105111962 | 3300005533 | Surface Soil | KPRMDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAI* |
| Ga0068853_1000584891 | 3300005539 | Corn Rhizosphere | MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS* |
| Ga0070693_1010853381 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS* |
| Ga0070665_1010527161 | 3300005548 | Switchgrass Rhizosphere | MDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL* |
| Ga0070665_1011329132 | 3300005548 | Switchgrass Rhizosphere | MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS* |
| Ga0068855_1000155377 | 3300005563 | Corn Rhizosphere | MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPVAS* |
| Ga0068855_1001921722 | 3300005563 | Corn Rhizosphere | MDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS* |
| Ga0068855_1002139872 | 3300005563 | Corn Rhizosphere | MDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI* |
| Ga0068855_1006690922 | 3300005563 | Corn Rhizosphere | MDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS* |
| Ga0068864_1000182365 | 3300005618 | Switchgrass Rhizosphere | MDFQPSDFIFLAMVIWLAIELTSGGGGGRRKRVPVVS* |
| Ga0068864_1007245442 | 3300005618 | Switchgrass Rhizosphere | MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKP |
| Ga0074470_103596603 | 3300005836 | Sediment (Intertidal) | MDFQPSDIVFFAIVIWLAIHLSDGGSGGRRSRVPAAL* |
| Ga0074470_105647892 | 3300005836 | Sediment (Intertidal) | MKTLMDVQPSDIVFLAIVIWLAIELTGGGGGGRRKRVPVAG* |
| Ga0074470_1084203211 | 3300005836 | Sediment (Intertidal) | MDFQPSDAIFWALVLWIAIDLTGGGGGGRRRKRAPATQ* |
| Ga0074470_109330022 | 3300005836 | Sediment (Intertidal) | MDFQPSDIVFLAMVIWLAIEITSGGGGGRRSRVPAAS* |
| Ga0068858_1000140946 | 3300005842 | Switchgrass Rhizosphere | MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS* |
| Ga0068860_1010860862 | 3300005843 | Switchgrass Rhizosphere | MDVQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPLQT* |
| Ga0068860_1011200581 | 3300005843 | Switchgrass Rhizosphere | LSTVRHNETSMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVLVAS* |
| Ga0066789_101271481 | 3300005994 | Soil | MEARMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKRVPVAA* |
| Ga0075028_1001610021 | 3300006050 | Watersheds | MDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPVAI* |
| Ga0075028_1006134742 | 3300006050 | Watersheds | MPMDFQPSDVIFFAIVIWLAIHLSDGGGGGRRSRVSAAL* |
| Ga0075029_1011160321 | 3300006052 | Watersheds | MKLRMDFQPSDIVFLAMVLWLAIELTSGGGGGRRKRVPVLS* |
| Ga0097691_10707261 | 3300006055 | Arctic Peat Soil | MDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAF* |
| Ga0075017_1006699002 | 3300006059 | Watersheds | MKQHMDLDPSDIVFLAMVIWLAIELTSGGGGGRRQRVPAAA* |
| Ga0075030_1001638272 | 3300006162 | Watersheds | MDFQPSDFVFLAIVIWLAVELSGGGGGGRRKRVPVPI* |
| Ga0097621_1004536192 | 3300006237 | Miscanthus Rhizosphere | MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPAAS* |
| Ga0068871_1000536043 | 3300006358 | Miscanthus Rhizosphere | MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPV |
| Ga0068871_1002510072 | 3300006358 | Miscanthus Rhizosphere | VCGIIKPRMDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL* |
| Ga0075522_100778012 | 3300006638 | Arctic Peat Soil | MDLQPSDLVFLAVVLWLVIELTSGGGGGRRKPVPVAI* |
| Ga0075522_103662342 | 3300006638 | Arctic Peat Soil | MDFQPSDLLFIAIVLWIAIELTNGGGGGRRSRVPVRA* |
| Ga0075522_104626192 | 3300006638 | Arctic Peat Soil | MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVAS* |
| Ga0075522_105365502 | 3300006638 | Arctic Peat Soil | MDLQPSDIVFLAVVIWLAIELTSGGGGGRRARVPVA |
| Ga0079221_100138052 | 3300006804 | Agricultural Soil | MDLQPSDIVFLAVVLWLAIELSSGGGGGRRKRVPAAS* |
| Ga0068865_1003592932 | 3300006881 | Miscanthus Rhizosphere | MEPRMDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS* |
| Ga0105240_100032696 | 3300009093 | Corn Rhizosphere | MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPAAS* |
| Ga0099792_102172912 | 3300009143 | Vadose Zone Soil | MDFQPSDIVFLAVVLWLAIELTNGGGGGRRRRVPVAI* |
| Ga0105248_113077052 | 3300009177 | Switchgrass Rhizosphere | MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS* |
| Ga0074045_107934662 | 3300010341 | Bog Forest Soil | MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRVPVRS* |
| Ga0134128_105340752 | 3300010373 | Terrestrial Soil | MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAF* |
| Ga0134128_116449822 | 3300010373 | Terrestrial Soil | MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPAPVAS* |
| Ga0134128_120782642 | 3300010373 | Terrestrial Soil | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRQRVPAAS* |
| Ga0134124_109948202 | 3300010397 | Terrestrial Soil | MDFQPSDFVFLAMVIWLAIELSSGGGGGGRKRVPAAS* |
| Ga0134121_112580592 | 3300010401 | Terrestrial Soil | MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRFPAAS* |
| Ga0134123_119494812 | 3300010403 | Terrestrial Soil | MDVQPSDIVFLAIIIWLAIDLTGGGGGGRRKRIPVLG* |
| Ga0126350_122287472 | 3300010880 | Boreal Forest Soil | SSPSDIVFLAMVIWLAIELTNGGGGGRRKRVPVAS* |
| Ga0126350_122872362 | 3300010880 | Boreal Forest Soil | MDFQPSDIVFLAMVIWLAIELTNGGGGGRRKRVPVAS* |
| Ga0137363_115095202 | 3300012202 | Vadose Zone Soil | MDLQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPAAS* |
| Ga0137361_104607282 | 3300012362 | Vadose Zone Soil | MDFQPSDVVFLAIVIWLAIELTGGGGGGRRARVPVRA* |
| Ga0137395_101383812 | 3300012917 | Vadose Zone Soil | MDFQPSDVVFLAIVIWLAIELTGGGGGGRRARVPVRT* |
| Ga0137419_119457382 | 3300012925 | Vadose Zone Soil | MKPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS* |
| Ga0137404_103069112 | 3300012929 | Vadose Zone Soil | MEPRMDFQPSDFVFLAMVIWLAIEFTSGGGGGRRKRVPVAS* |
| Ga0153915_107117262 | 3300012931 | Freshwater Wetlands | MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRVPV* |
| Ga0157374_102472452 | 3300013296 | Miscanthus Rhizosphere | MDFQPSDIIFLAVVLWLAIELTSGGGGGRRRPVPVAI* |
| Ga0157378_106746702 | 3300013297 | Miscanthus Rhizosphere | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPIAS* |
| Ga0157375_117576622 | 3300013308 | Miscanthus Rhizosphere | MKPRMDLKPSDLVFLAVVLWLAIELTSGGGGGRRKPVLVAF* |
| Ga0181530_103621822 | 3300014159 | Bog | MDFQPSDIVFLAIVIWLAVELSGGGGGGRRKRVPVPV* |
| Ga0181538_106562941 | 3300014162 | Bog | LLCAIIKPRMDFQPSDIVFLAMVLWLAIELTNGGGGGRRKRVPVAS* |
| Ga0181526_105506681 | 3300014200 | Bog | MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRAPVRF* |
| Ga0163163_100149596 | 3300014325 | Switchgrass Rhizosphere | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVVS* |
| Ga0182016_100090542 | 3300014493 | Bog | MDFQPSDFLFIAIVLWIALDLTNGGGGGRRSRSPVRVR* |
| Ga0182015_102312902 | 3300014495 | Palsa | MDFQPSDLVFLAIVIWLAVELSGGGGGGRRKRVPVPI* |
| Ga0182024_101459993 | 3300014501 | Permafrost | MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVVS* |
| Ga0182030_102887122 | 3300014838 | Bog | MDFQPSDIVFLAMVLWLAIELTNGGGGGRRKRVPVAS* |
| Ga0157379_116863502 | 3300014968 | Switchgrass Rhizosphere | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRIPVVS* |
| Ga0157376_116317622 | 3300014969 | Miscanthus Rhizosphere | FQPSDFVFLAMVIWLAIEITSSGGGGRRKRVPVAS* |
| Ga0167649_1003346 | 3300015063 | Glacier Forefield Soil | MDFQPSDIVFLAMVIWLAIELTSGGGGGRRQRVPVAA* |
| Ga0167658_10405432 | 3300015195 | Glacier Forefield Soil | MDFQPSDIVFLAVVLWLAIELTSGGGGGRRTRVPAAL* |
| Ga0187867_106211491 | 3300018033 | Peatland | MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRAPVRF |
| Ga0187863_108199542 | 3300018034 | Peatland | MDFQPSDLGFLAIVIWLAVELSGGGGGGRRKRVPVPI |
| Ga0187784_100548592 | 3300018062 | Tropical Peatland | MDFQPTDFLFIAIVLWIAVELTNGGGGGRWSRLPVRL |
| Ga0187769_103978992 | 3300018086 | Tropical Peatland | MDLQPSDIIFLAIIIWLAIELTGGGGGGRRRKRVPVAAL |
| Ga0187771_100082463 | 3300018088 | Tropical Peatland | MDFQPSDFLFIAIVLWIAIELTNGGGGGRRLRMPVQP |
| Ga0194132_104032872 | 3300020214 | Freshwater Lake | MDFQPSDALFIVVVIAIALVLTGGGSGGRCSRVPSVS |
| Ga0210403_111901152 | 3300020580 | Soil | MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS |
| Ga0210394_111564262 | 3300021420 | Soil | MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVA |
| Ga0209483_11370732 | 3300025862 | Arctic Peat Soil | MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRKPVPVAI |
| Ga0209483_12033452 | 3300025862 | Arctic Peat Soil | MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVAS |
| Ga0207705_101721492 | 3300025909 | Corn Rhizosphere | MGPRMDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS |
| Ga0207654_104501472 | 3300025911 | Corn Rhizosphere | MDLQPSDIVFLAVVLWLAIELSSGGGGGRRKRVPAAS |
| Ga0207654_104925132 | 3300025911 | Corn Rhizosphere | MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVL |
| Ga0207654_105186152 | 3300025911 | Corn Rhizosphere | MDVQPSDLVFLAIVIWLVIELTGGGGGGLRDRTPALSRA |
| Ga0207695_1000518810 | 3300025913 | Corn Rhizosphere | MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPAAS |
| Ga0207695_101756442 | 3300025913 | Corn Rhizosphere | MDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI |
| Ga0207671_107765852 | 3300025914 | Corn Rhizosphere | RPRMDFQPSDIIFLAVVLWLAIELTSGGGGGRRRPVPVAI |
| Ga0207657_112696732 | 3300025919 | Corn Rhizosphere | MDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS |
| Ga0207652_109827172 | 3300025921 | Corn Rhizosphere | MDFQPSDIVFLAVVIWLAIELTSGGGGGRRSQVPAAS |
| Ga0207694_115635302 | 3300025924 | Corn Rhizosphere | MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI |
| Ga0207687_102380932 | 3300025927 | Miscanthus Rhizosphere | MEPRMDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS |
| Ga0207664_112329872 | 3300025929 | Agricultural Soil | MDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS |
| Ga0207686_100904862 | 3300025934 | Miscanthus Rhizosphere | MDVQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPLQT |
| Ga0207686_104467112 | 3300025934 | Miscanthus Rhizosphere | MEPRMDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS |
| Ga0207709_102381632 | 3300025935 | Miscanthus Rhizosphere | MEPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS |
| Ga0207669_106293931 | 3300025937 | Miscanthus Rhizosphere | VRSAIMKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS |
| Ga0207667_100054239 | 3300025949 | Corn Rhizosphere | MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPVAS |
| Ga0207639_105284032 | 3300026041 | Corn Rhizosphere | MDLQPSDIVFLAVVLWLAIELSSGGGGGGRKRVPAAS |
| Ga0207702_123369601 | 3300026078 | Corn Rhizosphere | EPRMDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS |
| Ga0207641_100242776 | 3300026088 | Switchgrass Rhizosphere | MDFQPSDFIFLAMVIWLAIELTSGGGGGRRKRVPVVS |
| Ga0209169_104286092 | 3300027879 | Soil | MKPRMDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAF |
| Ga0209068_100708902 | 3300027894 | Watersheds | MDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPVAI |
| Ga0209698_101603762 | 3300027911 | Watersheds | MDFQPSDFVFLAIVIWLAVELSGGGGGGRRKRVPVPI |
| Ga0209698_107008542 | 3300027911 | Watersheds | MKQHMDLDPSDIVFLAMVIWLAIELTSGGGGGRRQRVPAAA |
| Ga0268266_100187402 | 3300028379 | Switchgrass Rhizosphere | MDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL |
| Ga0311334_103206532 | 3300029987 | Fen | MDFQPSDFLFIALVLLIAFDLTNGGGGGRRSRLPVPR |
| Ga0302325_113230592 | 3300031234 | Palsa | MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKRVPVPA |
| Ga0265331_101422562 | 3300031250 | Rhizosphere | MKSRMDLQPSDLVFLAVVFWLVIELTNGGGGGRRKPVPVAF |
| Ga0170818_1123265771 | 3300031474 | Forest Soil | MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS |
| Ga0310686_1077132332 | 3300031708 | Soil | MDFQPSDLVFLAIVIWLAVELTGGGGGRRKRVPVPI |
| Ga0310686_1146268572 | 3300031708 | Soil | MKPRMDFQPSDIVFLAMVIWLAIEITSGGGCGRRKPVPVAS |
| Ga0310686_1146276192 | 3300031708 | Soil | MTLEPTDFLFIAMVIWLAIQFTSGGGGGHRSRVPVPVSRS |
| Ga0265314_104546552 | 3300031711 | Rhizosphere | MKSRMDLQPSDLVFLAVVFWLVIELTNGGGGGRRK |
| Ga0307476_103215002 | 3300031715 | Hardwood Forest Soil | MESRMDFQPSDIVFLAVVIWLAIELTSGGGGGRRKRVSAAS |
| Ga0307474_105944461 | 3300031718 | Hardwood Forest Soil | MDFQPSDFVFLAVVIWLAIELTSGGGGGRRKRVPVAS |
| Ga0307474_113548182 | 3300031718 | Hardwood Forest Soil | MEPRMDLQPSDIVFLAMVIWLAIELTSGGGGGRRKRIPVAS |
| Ga0307469_105395102 | 3300031720 | Hardwood Forest Soil | MKPSMDFQPSDIVFLAVVLWLAIELTSGGGGGRRRRVPVPA |
| Ga0307479_108147562 | 3300031962 | Hardwood Forest Soil | MKRSMDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPAA |
| Ga0326726_118375802 | 3300033433 | Peat Soil | MDFEPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVVT |
| Ga0316620_103830262 | 3300033480 | Soil | MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRIPV |
| Ga0316620_113966641 | 3300033480 | Soil | MDFQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPVPV |
| Ga0316624_108077812 | 3300033486 | Soil | MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVHIPV |
| Ga0316628_1040067481 | 3300033513 | Soil | MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRVPV |
| ⦗Top⦘ |