Metagenome / Metatranscriptome Family F064834

Overview

Basic Information

• Family ID: F064834
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 128
• Average Sequence Length: 38 residues
• Representative Sequence: MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS
• Number of Associated Samples: 100
• Number of Associated Scaffolds: 128

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 56.25 %
• % of genes near scaffold ends (potentially truncated): 14.06 %
• % of genes from short scaffolds (< 2000 bps): 80.47 %
• Associated GOLD sequencing projects: 92
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (95.312 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (6.250 % of family members)
• Environment Ontology (ENVO): Unclassified (45.312 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (44.531 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 27.69%
  β-sheet: 0.00%
  Coil/Unstructured: 72.31%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF01593	Amino_oxidase	27.34
PF00117	GATase	24.22
PF13450	NAD_binding_8	24.22
PF00425	Chorismate_bind	7.03
PF04715	Anth_synt_I_N	3.91
PF06969	HemN_C	3.12
PF03972	MmgE_PrpD	0.78
PF03328	HpcH_HpaI	0.78
PF00206	Lyase_1	0.78
PF00133	tRNA-synt_1	0.78
PF13620	CarboxypepD_reg	0.78
PF04945	YHS	0.78
PF01491	Frataxin_Cyay	0.78
PF01180	DHO_dh	0.78
PF01252	Peptidase_A8	0.78
PF07609	DUF1572	0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	7.81
COG0635	Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase	Coenzyme transport and metabolism [H]	3.12
COG0597	Lipoprotein signal peptidase	Cell wall/membrane/envelope biogenesis [M]	1.56
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.78
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.78
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.78
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.78
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.78
COG1965	Fe-S cluster assembly protein CyaY, frataxin homolog	Inorganic ion transport and metabolism [P]	0.78
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	0.78
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.78
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.78
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.78
COG0167	Dihydroorotate dehydrogenase	Nucleotide transport and metabolism [F]	0.78
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.78
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	0.78
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.78

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.31 %
Unclassified	root	N/A	4.69 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.31 %
Unclassified	root	N/A	4.69 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.31 %
Unclassified	root	N/A	4.69 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	60.16 %
Unclassified	root	N/A	4.69 %

Level 5

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	34.38 %
Unclassified	root	N/A	4.69 %

Level 6

Name	Rank	Taxonomy	Distribution
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	21.88 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	7.81 %
Unclassified	root	N/A	4.69 %

Level 7

Name	Rank	Taxonomy	Distribution
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	10.16 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7.81 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	5.47 %
Unclassified	root	N/A	4.69 %

Level 8

Name	Rank	Taxonomy	Distribution
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	10.16 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	5.47 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	4.69 %
Unclassified	root	N/A	4.69 %

Level 9

Name	Rank	Taxonomy	Distribution
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	7.81 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	5.47 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	4.69 %
Unclassified	root	N/A	4.69 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2189573004|GZGWRS402H8S8H	All Organisms → cellular organisms → Bacteria	510
3300004024|Ga0055436_10117078	All Organisms → cellular organisms → Bacteria → Acidobacteria	792
3300004782|Ga0062382_10362762	All Organisms → cellular organisms → Bacteria	675
3300005327|Ga0070658_10030389	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	4340
3300005327|Ga0070658_10501179	All Organisms → cellular organisms → Bacteria	1049
3300005344|Ga0070661_100161715	All Organisms → cellular organisms → Bacteria	1696
3300005439|Ga0070711_101859733	All Organisms → cellular organisms → Bacteria	529
3300005458|Ga0070681_10046970	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	4316
3300005533|Ga0070734_10511196	All Organisms → cellular organisms → Bacteria	684
3300005539|Ga0068853_100058489	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3328
3300005547|Ga0070693_101085338	All Organisms → cellular organisms → Bacteria	610
3300005548|Ga0070665_101052716	All Organisms → cellular organisms → Bacteria → Acidobacteria	825
3300005548|Ga0070665_101132913	All Organisms → cellular organisms → Bacteria → Acidobacteria	794
3300005563|Ga0068855_100015537	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	9165
3300005563|Ga0068855_100192172	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2302
3300005563|Ga0068855_100213987	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	2164
3300005563|Ga0068855_100669092	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1113
3300005618|Ga0068864_100018236	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	5859
3300005618|Ga0068864_100724544	All Organisms → cellular organisms → Bacteria → Acidobacteria	973
3300005836|Ga0074470_10359660	All Organisms → cellular organisms → Bacteria	97103
3300005836|Ga0074470_10564789	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1801
3300005836|Ga0074470_10842032	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	11104
3300005836|Ga0074470_10933002	All Organisms → cellular organisms → Bacteria	823
3300005842|Ga0068858_100014094	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7539
3300005843|Ga0068860_101086086	All Organisms → cellular organisms → Bacteria → Acidobacteria	819
3300005843|Ga0068860_101120058	All Organisms → cellular organisms → Bacteria	807
3300005994|Ga0066789_10127148	Not Available	1087
3300006050|Ga0075028_100161002	Not Available	1191
3300006050|Ga0075028_100613474	All Organisms → cellular organisms → Bacteria	647
3300006052|Ga0075029_101116032	All Organisms → cellular organisms → Bacteria	548
3300006055|Ga0097691_1070726	All Organisms → cellular organisms → Bacteria	1113
3300006059|Ga0075017_100669900	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	797
3300006162|Ga0075030_100163827	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1796
3300006237|Ga0097621_100453619	All Organisms → cellular organisms → Bacteria	1155
3300006358|Ga0068871_100053604	Not Available	3270
3300006358|Ga0068871_100251007	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1541
3300006638|Ga0075522_10077801	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1840
3300006638|Ga0075522_10366234	All Organisms → cellular organisms → Bacteria	686
3300006638|Ga0075522_10462619	All Organisms → cellular organisms → Bacteria	592
3300006638|Ga0075522_10536550	All Organisms → cellular organisms → Bacteria	539
3300006804|Ga0079221_10013805	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3155
3300006881|Ga0068865_100359293	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1182
3300009093|Ga0105240_10003269	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	25338
3300009143|Ga0099792_10217291	All Organisms → cellular organisms → Bacteria → Acidobacteria	1096
3300009177|Ga0105248_11307705	All Organisms → cellular organisms → Bacteria → Acidobacteria	820
3300010341|Ga0074045_10793466	All Organisms → cellular organisms → Bacteria	599
3300010373|Ga0134128_10534075	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1307
3300010373|Ga0134128_11644982	All Organisms → cellular organisms → Bacteria	707
3300010373|Ga0134128_12078264	All Organisms → cellular organisms → Bacteria	625
3300010397|Ga0134124_10994820	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	850
3300010401|Ga0134121_11258059	All Organisms → cellular organisms → Bacteria → Acidobacteria	743
3300010403|Ga0134123_11949481	All Organisms → cellular organisms → Bacteria	644
3300010880|Ga0126350_12228747	All Organisms → cellular organisms → Bacteria	563
3300010880|Ga0126350_12287236	All Organisms → cellular organisms → Bacteria	539
3300012202|Ga0137363_11509520	All Organisms → cellular organisms → Bacteria	563
3300012362|Ga0137361_10460728	Not Available	1168
3300012917|Ga0137395_10138381	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	1657
3300012925|Ga0137419_11945738	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	505
3300012929|Ga0137404_10306911	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	1378
3300012931|Ga0153915_10711726	All Organisms → cellular organisms → Bacteria	1161
3300013296|Ga0157374_10247245	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1755
3300013297|Ga0157378_10674670	All Organisms → cellular organisms → Bacteria	1051
3300013308|Ga0157375_11757662	All Organisms → cellular organisms → Bacteria	735
3300014159|Ga0181530_10362182	All Organisms → cellular organisms → Bacteria → Acidobacteria	746
3300014162|Ga0181538_10656294	All Organisms → cellular organisms → Bacteria	545
3300014200|Ga0181526_10550668	All Organisms → cellular organisms → Bacteria → Acidobacteria	729
3300014325|Ga0163163_10014959	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7151
3300014493|Ga0182016_10009054	All Organisms → cellular organisms → Bacteria → Acidobacteria	9937
3300014495|Ga0182015_10231290	All Organisms → cellular organisms → Bacteria → Acidobacteria	1226
3300014501|Ga0182024_10145999	Not Available	3334
3300014838|Ga0182030_10288712	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1823
3300014968|Ga0157379_11686350	All Organisms → cellular organisms → Bacteria	620
3300014969|Ga0157376_11631762	All Organisms → cellular organisms → Bacteria	679
3300015063|Ga0167649_100334	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	7243
3300015195|Ga0167658_1040543	Not Available	1182
3300018033|Ga0187867_10621149	All Organisms → cellular organisms → Bacteria → Acidobacteria	591
3300018034|Ga0187863_10819954	All Organisms → cellular organisms → Bacteria	528
3300018062|Ga0187784_10054859	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	3228
3300018086|Ga0187769_10397899	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1036
3300018088|Ga0187771_10008246	All Organisms → cellular organisms → Bacteria	7468
3300020214|Ga0194132_10403287	All Organisms → cellular organisms → Bacteria	697
3300020580|Ga0210403_11190115	All Organisms → cellular organisms → Bacteria → Acidobacteria	588
3300021420|Ga0210394_11156426	All Organisms → cellular organisms → Bacteria → Acidobacteria	666
3300025862|Ga0209483_1137073	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	1031
3300025862|Ga0209483_1203345	All Organisms → cellular organisms → Bacteria	788
3300025909|Ga0207705_10172149	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1631
3300025911|Ga0207654_10450147	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	903
3300025911|Ga0207654_10492513	All Organisms → cellular organisms → Bacteria → Acidobacteria	865
3300025911|Ga0207654_10518615	All Organisms → cellular organisms → Bacteria → Acidobacteria	843
3300025913|Ga0207695_10005188	All Organisms → cellular organisms → Bacteria → Acidobacteria	17438
3300025913|Ga0207695_10175644	All Organisms → cellular organisms → Bacteria → Acidobacteria	2065
3300025914|Ga0207671_10776585	All Organisms → cellular organisms → Bacteria	760
3300025919|Ga0207657_11269673	All Organisms → cellular organisms → Bacteria → Acidobacteria	557
3300025921|Ga0207652_10982717	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	743
3300025924|Ga0207694_11563530	All Organisms → cellular organisms → Bacteria	556
3300025927|Ga0207687_10238093	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1441
3300025929|Ga0207664_11232987	All Organisms → cellular organisms → Bacteria → Acidobacteria	666
3300025934|Ga0207686_10090486	All Organisms → cellular organisms → Bacteria	2019
3300025934|Ga0207686_10446711	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	994
3300025935|Ga0207709_10238163	All Organisms → cellular organisms → Bacteria → Acidobacteria	1322
3300025937|Ga0207669_10629393	All Organisms → cellular organisms → Bacteria	875
3300025949|Ga0207667_10005423	All Organisms → cellular organisms → Bacteria → Acidobacteria	15550
3300026041|Ga0207639_10528403	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1081
3300026078|Ga0207702_12336960	All Organisms → cellular organisms → Bacteria	522
3300026088|Ga0207641_10024277	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	4997
3300027879|Ga0209169_10428609	All Organisms → cellular organisms → Bacteria → Acidobacteria	695
3300027894|Ga0209068_10070890	All Organisms → cellular organisms → Bacteria → Acidobacteria	1799
3300027911|Ga0209698_10160376	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1839
3300027911|Ga0209698_10700854	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	771
3300028379|Ga0268266_10018740	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5896
3300029987|Ga0311334_10320653	All Organisms → cellular organisms → Bacteria → Acidobacteria	1215
3300031234|Ga0302325_11323059	All Organisms → cellular organisms → Bacteria → Acidobacteria	945
3300031250|Ga0265331_10142256	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1091
3300031474|Ga0170818_112326577	All Organisms → cellular organisms → Bacteria → Acidobacteria	524
3300031708|Ga0310686_107713233	All Organisms → cellular organisms → Bacteria	1689
3300031708|Ga0310686_114626857	All Organisms → cellular organisms → Bacteria	801
3300031708|Ga0310686_114627619	All Organisms → cellular organisms → Bacteria	762
3300031711|Ga0265314_10454655	All Organisms → cellular organisms → Bacteria → Acidobacteria	681
3300031715|Ga0307476_10321500	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1137
3300031718|Ga0307474_10594446	All Organisms → cellular organisms → Bacteria	872
3300031718|Ga0307474_11354818	All Organisms → cellular organisms → Bacteria	561
3300031720|Ga0307469_10539510	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1031
3300031962|Ga0307479_10814756	All Organisms → cellular organisms → Bacteria → Acidobacteria	909
3300033433|Ga0326726_11837580	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	590
3300033480|Ga0316620_10383026	All Organisms → cellular organisms → Bacteria	1265
3300033480|Ga0316620_11396664	All Organisms → cellular organisms → Bacteria → Acidobacteria	690
3300033486|Ga0316624_10807781	All Organisms → cellular organisms → Bacteria → Acidobacteria	834
3300033513|Ga0316628_104006748	All Organisms → cellular organisms → Bacteria → Acidobacteria	526

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.50%
Host-Associated	Host-Associated	37.50%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	46.09%
Plants	Host-Associated → Plants	37.50%
Aquatic	Environmental → Aquatic	16.41%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	43.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.72%
Sediment	Environmental → Aquatic → Sediment	9.38%
Freshwater	Environmental → Aquatic → Freshwater	6.25%
Roots	Host-Associated → Plants → Roots	3.12%
Peat	Environmental → Terrestrial → Peat	2.34%
Marine	Environmental → Aquatic → Marine	0.78%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	28.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.72%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.16%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	9.38%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.59%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.47%
Loam	Environmental → Terrestrial → Soil → Loam	4.69%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	3.12%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.34%
Lake	Environmental → Aquatic → Freshwater → Lake	0.78%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.78%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.41%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	9.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.25%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.25%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	5.47%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	3.91%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.91%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	3.12%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.34%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.56%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.78%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.78%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.78%

Habitat

Habitat	Taxonomy	Distribution
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	6.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	6.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	6.25%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	5.47%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.69%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.69%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.91%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	3.12%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.12%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	2.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.34%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.34%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.56%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.56%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	1.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.56%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.56%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	1.56%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.78%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.78%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.78%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.78%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.78%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.78%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.78%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.78%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.78%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.78%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.78%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.78%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.78%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.78%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2189573004	Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)	Environmental
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental
3300004782	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh	Environmental
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental
3300014162	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG	Environmental
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014493	Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG	Environmental
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015063	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine)	Environmental
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental
3300018033	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10	Environmental
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental
3300020214	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300029987	I_Fen_E3 coassembly	Environmental
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Host-Associated
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FG2_07925030	2189573004	Grass Soil	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVPS
Ga0055436_101170781	3300004024	Natural And Restored Wetlands	MLMDFQPSDIVFFAIVIWLAIHLSDGGSGGRRSRVPAAL*
Ga0062382_103627621	3300004782	Wetland Sediment	MKALMDVQPSDIVFLAIVIWLAIDLTGGGGGGRRKRIPVLA*
Ga0070658_100303893	3300005327	Corn Rhizosphere	MGPRMDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS*
Ga0070658_105011791	3300005327	Corn Rhizosphere	MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI*
Ga0070661_1001617152	3300005344	Corn Rhizosphere	MDVQPSDLVFLAIVIWLVIELTGGGGGGLRDRTPALSRAA*
Ga0070711_1018597331	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	IMEPRMDFQPSDIVFLAVVIWLAIELTSGGGGGRRKRVPVAS*
Ga0070681_100469702	3300005458	Corn Rhizosphere	MEPRMDFQPSDFVFLALVIWLAIELTSGGGGGRRQRVPAAS*
Ga0070734_105111962	3300005533	Surface Soil	KPRMDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAI*
Ga0068853_1000584891	3300005539	Corn Rhizosphere	MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS*
Ga0070693_1010853381	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MEPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS*
Ga0070665_1010527161	3300005548	Switchgrass Rhizosphere	MDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL*
Ga0070665_1011329132	3300005548	Switchgrass Rhizosphere	MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS*
Ga0068855_1000155377	3300005563	Corn Rhizosphere	MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPVAS*
Ga0068855_1001921722	3300005563	Corn Rhizosphere	MDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS*
Ga0068855_1002139872	3300005563	Corn Rhizosphere	MDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI*
Ga0068855_1006690922	3300005563	Corn Rhizosphere	MDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS*
Ga0068864_1000182365	3300005618	Switchgrass Rhizosphere	MDFQPSDFIFLAMVIWLAIELTSGGGGGRRKRVPVVS*
Ga0068864_1007245442	3300005618	Switchgrass Rhizosphere	MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKP
Ga0074470_103596603	3300005836	Sediment (Intertidal)	MDFQPSDIVFFAIVIWLAIHLSDGGSGGRRSRVPAAL*
Ga0074470_105647892	3300005836	Sediment (Intertidal)	MKTLMDVQPSDIVFLAIVIWLAIELTGGGGGGRRKRVPVAG*
Ga0074470_1084203211	3300005836	Sediment (Intertidal)	MDFQPSDAIFWALVLWIAIDLTGGGGGGRRRKRAPATQ*
Ga0074470_109330022	3300005836	Sediment (Intertidal)	MDFQPSDIVFLAMVIWLAIEITSGGGGGRRSRVPAAS*
Ga0068858_1000140946	3300005842	Switchgrass Rhizosphere	MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS*
Ga0068860_1010860862	3300005843	Switchgrass Rhizosphere	MDVQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPLQT*
Ga0068860_1011200581	3300005843	Switchgrass Rhizosphere	LSTVRHNETSMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVLVAS*
Ga0066789_101271481	3300005994	Soil	MEARMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKRVPVAA*
Ga0075028_1001610021	3300006050	Watersheds	MDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPVAI*
Ga0075028_1006134742	3300006050	Watersheds	MPMDFQPSDVIFFAIVIWLAIHLSDGGGGGRRSRVSAAL*
Ga0075029_1011160321	3300006052	Watersheds	MKLRMDFQPSDIVFLAMVLWLAIELTSGGGGGRRKRVPVLS*
Ga0097691_10707261	3300006055	Arctic Peat Soil	MDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAF*
Ga0075017_1006699002	3300006059	Watersheds	MKQHMDLDPSDIVFLAMVIWLAIELTSGGGGGRRQRVPAAA*
Ga0075030_1001638272	3300006162	Watersheds	MDFQPSDFVFLAIVIWLAVELSGGGGGGRRKRVPVPI*
Ga0097621_1004536192	3300006237	Miscanthus Rhizosphere	MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPAAS*
Ga0068871_1000536043	3300006358	Miscanthus Rhizosphere	MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPV
Ga0068871_1002510072	3300006358	Miscanthus Rhizosphere	VCGIIKPRMDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL*
Ga0075522_100778012	3300006638	Arctic Peat Soil	MDLQPSDLVFLAVVLWLVIELTSGGGGGRRKPVPVAI*
Ga0075522_103662342	3300006638	Arctic Peat Soil	MDFQPSDLLFIAIVLWIAIELTNGGGGGRRSRVPVRA*
Ga0075522_104626192	3300006638	Arctic Peat Soil	MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVAS*
Ga0075522_105365502	3300006638	Arctic Peat Soil	MDLQPSDIVFLAVVIWLAIELTSGGGGGRRARVPVA
Ga0079221_100138052	3300006804	Agricultural Soil	MDLQPSDIVFLAVVLWLAIELSSGGGGGRRKRVPAAS*
Ga0068865_1003592932	3300006881	Miscanthus Rhizosphere	MEPRMDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS*
Ga0105240_100032696	3300009093	Corn Rhizosphere	MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPAAS*
Ga0099792_102172912	3300009143	Vadose Zone Soil	MDFQPSDIVFLAVVLWLAIELTNGGGGGRRRRVPVAI*
Ga0105248_113077052	3300009177	Switchgrass Rhizosphere	MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS*
Ga0074045_107934662	3300010341	Bog Forest Soil	MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRVPVRS*
Ga0134128_105340752	3300010373	Terrestrial Soil	MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAF*
Ga0134128_116449822	3300010373	Terrestrial Soil	MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPAPVAS*
Ga0134128_120782642	3300010373	Terrestrial Soil	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRQRVPAAS*
Ga0134124_109948202	3300010397	Terrestrial Soil	MDFQPSDFVFLAMVIWLAIELSSGGGGGGRKRVPAAS*
Ga0134121_112580592	3300010401	Terrestrial Soil	MDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRFPAAS*
Ga0134123_119494812	3300010403	Terrestrial Soil	MDVQPSDIVFLAIIIWLAIDLTGGGGGGRRKRIPVLG*
Ga0126350_122287472	3300010880	Boreal Forest Soil	SSPSDIVFLAMVIWLAIELTNGGGGGRRKRVPVAS*
Ga0126350_122872362	3300010880	Boreal Forest Soil	MDFQPSDIVFLAMVIWLAIELTNGGGGGRRKRVPVAS*
Ga0137363_115095202	3300012202	Vadose Zone Soil	MDLQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPAAS*
Ga0137361_104607282	3300012362	Vadose Zone Soil	MDFQPSDVVFLAIVIWLAIELTGGGGGGRRARVPVRA*
Ga0137395_101383812	3300012917	Vadose Zone Soil	MDFQPSDVVFLAIVIWLAIELTGGGGGGRRARVPVRT*
Ga0137419_119457382	3300012925	Vadose Zone Soil	MKPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS*
Ga0137404_103069112	3300012929	Vadose Zone Soil	MEPRMDFQPSDFVFLAMVIWLAIEFTSGGGGGRRKRVPVAS*
Ga0153915_107117262	3300012931	Freshwater Wetlands	MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRVPV*
Ga0157374_102472452	3300013296	Miscanthus Rhizosphere	MDFQPSDIIFLAVVLWLAIELTSGGGGGRRRPVPVAI*
Ga0157378_106746702	3300013297	Miscanthus Rhizosphere	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPIAS*
Ga0157375_117576622	3300013308	Miscanthus Rhizosphere	MKPRMDLKPSDLVFLAVVLWLAIELTSGGGGGRRKPVLVAF*
Ga0181530_103621822	3300014159	Bog	MDFQPSDIVFLAIVIWLAVELSGGGGGGRRKRVPVPV*
Ga0181538_106562941	3300014162	Bog	LLCAIIKPRMDFQPSDIVFLAMVLWLAIELTNGGGGGRRKRVPVAS*
Ga0181526_105506681	3300014200	Bog	MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRAPVRF*
Ga0163163_100149596	3300014325	Switchgrass Rhizosphere	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVVS*
Ga0182016_100090542	3300014493	Bog	MDFQPSDFLFIAIVLWIALDLTNGGGGGRRSRSPVRVR*
Ga0182015_102312902	3300014495	Palsa	MDFQPSDLVFLAIVIWLAVELSGGGGGGRRKRVPVPI*
Ga0182024_101459993	3300014501	Permafrost	MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVVS*
Ga0182030_102887122	3300014838	Bog	MDFQPSDIVFLAMVLWLAIELTNGGGGGRRKRVPVAS*
Ga0157379_116863502	3300014968	Switchgrass Rhizosphere	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRIPVVS*
Ga0157376_116317622	3300014969	Miscanthus Rhizosphere	FQPSDFVFLAMVIWLAIEITSSGGGGRRKRVPVAS*
Ga0167649_1003346	3300015063	Glacier Forefield Soil	MDFQPSDIVFLAMVIWLAIELTSGGGGGRRQRVPVAA*
Ga0167658_10405432	3300015195	Glacier Forefield Soil	MDFQPSDIVFLAVVLWLAIELTSGGGGGRRTRVPAAL*
Ga0187867_106211491	3300018033	Peatland	MDFQPSDFLFIAIVLWIAVELTNGGGGGRRSRAPVRF
Ga0187863_108199542	3300018034	Peatland	MDFQPSDLGFLAIVIWLAVELSGGGGGGRRKRVPVPI
Ga0187784_100548592	3300018062	Tropical Peatland	MDFQPTDFLFIAIVLWIAVELTNGGGGGRWSRLPVRL
Ga0187769_103978992	3300018086	Tropical Peatland	MDLQPSDIIFLAIIIWLAIELTGGGGGGRRRKRVPVAAL
Ga0187771_100082463	3300018088	Tropical Peatland	MDFQPSDFLFIAIVLWIAIELTNGGGGGRRLRMPVQP
Ga0194132_104032872	3300020214	Freshwater Lake	MDFQPSDALFIVVVIAIALVLTGGGSGGRCSRVPSVS
Ga0210403_111901152	3300020580	Soil	MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS
Ga0210394_111564262	3300021420	Soil	MDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVA
Ga0209483_11370732	3300025862	Arctic Peat Soil	MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRKPVPVAI
Ga0209483_12033452	3300025862	Arctic Peat Soil	MKPRMDFQPSDIVFLAMVIWLAIEITSGGGGGRRKPVPVAS
Ga0207705_101721492	3300025909	Corn Rhizosphere	MGPRMDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS
Ga0207654_104501472	3300025911	Corn Rhizosphere	MDLQPSDIVFLAVVLWLAIELSSGGGGGRRKRVPAAS
Ga0207654_104925132	3300025911	Corn Rhizosphere	MKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVL
Ga0207654_105186152	3300025911	Corn Rhizosphere	MDVQPSDLVFLAIVIWLVIELTGGGGGGLRDRTPALSRA
Ga0207695_1000518810	3300025913	Corn Rhizosphere	MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPAAS
Ga0207695_101756442	3300025913	Corn Rhizosphere	MDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI
Ga0207671_107765852	3300025914	Corn Rhizosphere	RPRMDFQPSDIIFLAVVLWLAIELTSGGGGGRRRPVPVAI
Ga0207657_112696732	3300025919	Corn Rhizosphere	MDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS
Ga0207652_109827172	3300025921	Corn Rhizosphere	MDFQPSDIVFLAVVIWLAIELTSGGGGGRRSQVPAAS
Ga0207694_115635302	3300025924	Corn Rhizosphere	MKPRMDLQPSDLVFLAVVLWLVIELTSGGGGGRRRPVPVAI
Ga0207687_102380932	3300025927	Miscanthus Rhizosphere	MEPRMDFQPSDIVFLAMVIWLAIELTSGGGGGRRKRVPVAS
Ga0207664_112329872	3300025929	Agricultural Soil	MDFQPSDIVFLAVVIWLAIEITNGGGGGRRSRVPVAS
Ga0207686_100904862	3300025934	Miscanthus Rhizosphere	MDVQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPLQT
Ga0207686_104467112	3300025934	Miscanthus Rhizosphere	MEPRMDFQPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVAS
Ga0207709_102381632	3300025935	Miscanthus Rhizosphere	MEPRMDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS
Ga0207669_106293931	3300025937	Miscanthus Rhizosphere	VRSAIMKPRMDLQPSDLVFLAVVLWLAIELTSGGGGGRRKPVPVAS
Ga0207667_100054239	3300025949	Corn Rhizosphere	MGLQPSDIVFLAMVLWLAIELTSGGGGGRRQPVPVAS
Ga0207639_105284032	3300026041	Corn Rhizosphere	MDLQPSDIVFLAVVLWLAIELSSGGGGGGRKRVPAAS
Ga0207702_123369601	3300026078	Corn Rhizosphere	EPRMDLQPSDIVFLALVLWLAIELSSGGGGGGRKRVPAAS
Ga0207641_100242776	3300026088	Switchgrass Rhizosphere	MDFQPSDFIFLAMVIWLAIELTSGGGGGRRKRVPVVS
Ga0209169_104286092	3300027879	Soil	MKPRMDFQPSDIVFLAVVLWLVIELTSGGGGGRRKPVPVAF
Ga0209068_100708902	3300027894	Watersheds	MDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPVAI
Ga0209698_101603762	3300027911	Watersheds	MDFQPSDFVFLAIVIWLAVELSGGGGGGRRKRVPVPI
Ga0209698_107008542	3300027911	Watersheds	MKQHMDLDPSDIVFLAMVIWLAIELTSGGGGGRRQRVPAAA
Ga0268266_100187402	3300028379	Switchgrass Rhizosphere	MDIRPSDIVFLAMVLWLAIELTSGGGGGRRKPVRVAL
Ga0311334_103206532	3300029987	Fen	MDFQPSDFLFIALVLLIAFDLTNGGGGGRRSRLPVPR
Ga0302325_113230592	3300031234	Palsa	MDLQPSDLVFLAVVLWLAIELTSGGGGGRRKRVPVPA
Ga0265331_101422562	3300031250	Rhizosphere	MKSRMDLQPSDLVFLAVVFWLVIELTNGGGGGRRKPVPVAF
Ga0170818_1123265771	3300031474	Forest Soil	MDFQPSDFVFLAMVIWLAIELTSGGGGGRRKRVPVAS
Ga0310686_1077132332	3300031708	Soil	MDFQPSDLVFLAIVIWLAVELTGGGGGRRKRVPVPI
Ga0310686_1146268572	3300031708	Soil	MKPRMDFQPSDIVFLAMVIWLAIEITSGGGCGRRKPVPVAS
Ga0310686_1146276192	3300031708	Soil	MTLEPTDFLFIAMVIWLAIQFTSGGGGGHRSRVPVPVSRS
Ga0265314_104546552	3300031711	Rhizosphere	MKSRMDLQPSDLVFLAVVFWLVIELTNGGGGGRRK
Ga0307476_103215002	3300031715	Hardwood Forest Soil	MESRMDFQPSDIVFLAVVIWLAIELTSGGGGGRRKRVSAAS
Ga0307474_105944461	3300031718	Hardwood Forest Soil	MDFQPSDFVFLAVVIWLAIELTSGGGGGRRKRVPVAS
Ga0307474_113548182	3300031718	Hardwood Forest Soil	MEPRMDLQPSDIVFLAMVIWLAIELTSGGGGGRRKRIPVAS
Ga0307469_105395102	3300031720	Hardwood Forest Soil	MKPSMDFQPSDIVFLAVVLWLAIELTSGGGGGRRRRVPVPA
Ga0307479_108147562	3300031962	Hardwood Forest Soil	MKRSMDFQPSDIAFLAVVLWLAIELTSGGGGGRRRRVPAA
Ga0326726_118375802	3300033433	Peat Soil	MDFEPSDFVFLAMVIWLAIEITSGGGGGRRKRVPVVT
Ga0316620_103830262	3300033480	Soil	MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRIPV
Ga0316620_113966641	3300033480	Soil	MDFQPSDLVFLAIVIWLAIELTGGGGGGRRKRVPVPV
Ga0316624_108077812	3300033486	Soil	MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVHIPV
Ga0316628_1040067481	3300033513	Soil	MDFQPSDLVFLAIVIWLAIELTGGGGGGRRARVRVPV