| Basic Information | |
|---|---|
| Family ID | F064774 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ESIGEVLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRQ |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.12 % |
| % of genes near scaffold ends (potentially truncated) | 95.31 % |
| % of genes from short scaffolds (< 2000 bps) | 97.66 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.219 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.719 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 92.97 |
| PF13620 | CarboxypepD_reg | 1.56 |
| PF13551 | HTH_29 | 0.78 |
| PF00665 | rve | 0.78 |
| PF01527 | HTH_Tnp_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 92.97 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.78 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.78 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.78 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.22 % |
| Unclassified | root | N/A | 25.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig95902 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1260 | Open in IMG/M |
| 3300001139|JGI10220J13317_11143217 | Not Available | 692 | Open in IMG/M |
| 3300001566|A2135W6_1005200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 596 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101248237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 633 | Open in IMG/M |
| 3300004282|Ga0066599_101405871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 531 | Open in IMG/M |
| 3300005447|Ga0066689_10985830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005537|Ga0070730_10758544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 613 | Open in IMG/M |
| 3300005541|Ga0070733_10204751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
| 3300005558|Ga0066698_10350966 | Not Available | 1019 | Open in IMG/M |
| 3300005563|Ga0068855_100645524 | Not Available | 1137 | Open in IMG/M |
| 3300005578|Ga0068854_101038288 | Not Available | 727 | Open in IMG/M |
| 3300005843|Ga0068860_100430870 | Not Available | 1308 | Open in IMG/M |
| 3300005921|Ga0070766_11257336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 513 | Open in IMG/M |
| 3300005995|Ga0066790_10531831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 502 | Open in IMG/M |
| 3300006034|Ga0066656_10635477 | Not Available | 689 | Open in IMG/M |
| 3300006050|Ga0075028_100146488 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1243 | Open in IMG/M |
| 3300006354|Ga0075021_10573937 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 719 | Open in IMG/M |
| 3300006642|Ga0075521_10232314 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 880 | Open in IMG/M |
| 3300006854|Ga0075425_102697369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 548 | Open in IMG/M |
| 3300007265|Ga0099794_10207572 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1004 | Open in IMG/M |
| 3300007788|Ga0099795_10593065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 526 | Open in IMG/M |
| 3300009098|Ga0105245_11092271 | Not Available | 844 | Open in IMG/M |
| 3300009143|Ga0099792_11052836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 546 | Open in IMG/M |
| 3300009521|Ga0116222_1252880 | Not Available | 760 | Open in IMG/M |
| 3300009524|Ga0116225_1454906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 569 | Open in IMG/M |
| 3300009616|Ga0116111_1001321 | All Organisms → cellular organisms → Bacteria | 17501 | Open in IMG/M |
| 3300009618|Ga0116127_1157916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 564 | Open in IMG/M |
| 3300009644|Ga0116121_1306546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 513 | Open in IMG/M |
| 3300010339|Ga0074046_10846542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 534 | Open in IMG/M |
| 3300010376|Ga0126381_103007646 | Not Available | 669 | Open in IMG/M |
| 3300011269|Ga0137392_10661933 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 865 | Open in IMG/M |
| 3300011270|Ga0137391_11500908 | Not Available | 519 | Open in IMG/M |
| 3300012202|Ga0137363_10249767 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1441 | Open in IMG/M |
| 3300012206|Ga0137380_10265079 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300012209|Ga0137379_10443192 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1207 | Open in IMG/M |
| 3300012349|Ga0137387_10162365 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1595 | Open in IMG/M |
| 3300012349|Ga0137387_11269797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 517 | Open in IMG/M |
| 3300012917|Ga0137395_10560115 | Not Available | 825 | Open in IMG/M |
| 3300012927|Ga0137416_11638912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 586 | Open in IMG/M |
| 3300012931|Ga0153915_10573017 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1296 | Open in IMG/M |
| 3300012948|Ga0126375_10643694 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 816 | Open in IMG/M |
| 3300012957|Ga0164303_10685167 | Not Available | 688 | Open in IMG/M |
| 3300012976|Ga0134076_10209871 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 819 | Open in IMG/M |
| 3300012977|Ga0134087_10523744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 601 | Open in IMG/M |
| 3300014164|Ga0181532_10453129 | Not Available | 707 | Open in IMG/M |
| 3300014498|Ga0182019_11345842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 528 | Open in IMG/M |
| 3300015241|Ga0137418_10367779 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1182 | Open in IMG/M |
| 3300015374|Ga0132255_100580063 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300017656|Ga0134112_10270946 | Not Available | 677 | Open in IMG/M |
| 3300017925|Ga0187856_1049598 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1848 | Open in IMG/M |
| 3300017931|Ga0187877_1344175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 566 | Open in IMG/M |
| 3300017934|Ga0187803_10316490 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300017941|Ga0187850_10470021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 545 | Open in IMG/M |
| 3300018003|Ga0187876_1001321 | All Organisms → cellular organisms → Bacteria | 21399 | Open in IMG/M |
| 3300018014|Ga0187860_1088859 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1431 | Open in IMG/M |
| 3300018018|Ga0187886_1380670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 517 | Open in IMG/M |
| 3300018021|Ga0187882_1277808 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 644 | Open in IMG/M |
| 3300018024|Ga0187881_10272075 | Not Available | 706 | Open in IMG/M |
| 3300018033|Ga0187867_10457051 | Not Available | 704 | Open in IMG/M |
| 3300018042|Ga0187871_10818455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 520 | Open in IMG/M |
| 3300018043|Ga0187887_10265846 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1014 | Open in IMG/M |
| 3300018043|Ga0187887_10489916 | Not Available | 725 | Open in IMG/M |
| 3300018044|Ga0187890_10129191 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1456 | Open in IMG/M |
| 3300018046|Ga0187851_10136336 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1497 | Open in IMG/M |
| 3300018085|Ga0187772_10460510 | Not Available | 892 | Open in IMG/M |
| 3300019377|Ga0190264_10324879 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 949 | Open in IMG/M |
| 3300019785|Ga0182022_1143723 | Not Available | 1714 | Open in IMG/M |
| 3300019788|Ga0182028_1166721 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1223 | Open in IMG/M |
| 3300020150|Ga0187768_1161331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 518 | Open in IMG/M |
| 3300020582|Ga0210395_10849426 | Not Available | 680 | Open in IMG/M |
| 3300021403|Ga0210397_11611236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 504 | Open in IMG/M |
| 3300021433|Ga0210391_10729722 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 776 | Open in IMG/M |
| 3300022520|Ga0224538_1001137 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300023088|Ga0224555_1168931 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 620 | Open in IMG/M |
| 3300023226|Ga0224536_1004453 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 980 | Open in IMG/M |
| 3300023254|Ga0224524_1053532 | Not Available | 743 | Open in IMG/M |
| 3300024430|Ga0196962_10214246 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 621 | Open in IMG/M |
| 3300025495|Ga0207932_1039320 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1128 | Open in IMG/M |
| 3300025553|Ga0208080_1089934 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 658 | Open in IMG/M |
| 3300025627|Ga0208220_1130552 | Not Available | 653 | Open in IMG/M |
| 3300025633|Ga0208480_1043301 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1203 | Open in IMG/M |
| 3300025846|Ga0209538_1331305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 527 | Open in IMG/M |
| 3300025888|Ga0209540_10223513 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1105 | Open in IMG/M |
| 3300025888|Ga0209540_10377977 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 780 | Open in IMG/M |
| 3300025891|Ga0209585_10269422 | Not Available | 677 | Open in IMG/M |
| 3300025949|Ga0207667_10677403 | Not Available | 1035 | Open in IMG/M |
| 3300026320|Ga0209131_1247036 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 726 | Open in IMG/M |
| 3300027651|Ga0209217_1140265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 673 | Open in IMG/M |
| 3300027678|Ga0209011_1065003 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1094 | Open in IMG/M |
| 3300027768|Ga0209772_10206371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 622 | Open in IMG/M |
| 3300027823|Ga0209490_10154848 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1581 | Open in IMG/M |
| 3300027857|Ga0209166_10512942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 615 | Open in IMG/M |
| 3300027875|Ga0209283_10228794 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1235 | Open in IMG/M |
| 3300027894|Ga0209068_10331090 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 859 | Open in IMG/M |
| 3300027903|Ga0209488_10691907 | Not Available | 731 | Open in IMG/M |
| 3300027911|Ga0209698_10245174 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1433 | Open in IMG/M |
| 3300028788|Ga0302189_10182242 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 889 | Open in IMG/M |
| 3300029914|Ga0311359_10414508 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1057 | Open in IMG/M |
| 3300029919|Ga0302141_1018259 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300029987|Ga0311334_10694337 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 832 | Open in IMG/M |
| 3300030002|Ga0311350_11298985 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 648 | Open in IMG/M |
| 3300030047|Ga0302286_10308705 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 796 | Open in IMG/M |
| 3300030518|Ga0302275_10151694 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1448 | Open in IMG/M |
| 3300031231|Ga0170824_124380409 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1401 | Open in IMG/M |
| 3300031261|Ga0302140_10402662 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1103 | Open in IMG/M |
| 3300031344|Ga0265316_10183095 | Not Available | 1559 | Open in IMG/M |
| 3300031524|Ga0302320_11626008 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031524|Ga0302320_11921088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 559 | Open in IMG/M |
| 3300031788|Ga0302319_11739967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 542 | Open in IMG/M |
| 3300031796|Ga0318576_10285231 | Not Available | 779 | Open in IMG/M |
| 3300031902|Ga0302322_100925896 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1046 | Open in IMG/M |
| 3300031912|Ga0306921_12240606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 575 | Open in IMG/M |
| 3300031938|Ga0308175_101204123 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 842 | Open in IMG/M |
| 3300031945|Ga0310913_10541096 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 827 | Open in IMG/M |
| 3300032174|Ga0307470_10227984 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1213 | Open in IMG/M |
| 3300032180|Ga0307471_100330383 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1626 | Open in IMG/M |
| 3300032180|Ga0307471_102382832 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 669 | Open in IMG/M |
| 3300032205|Ga0307472_101980829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 583 | Open in IMG/M |
| 3300032770|Ga0335085_11162237 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 823 | Open in IMG/M |
| 3300032782|Ga0335082_11174810 | Not Available | 635 | Open in IMG/M |
| 3300032782|Ga0335082_11696301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 506 | Open in IMG/M |
| 3300032828|Ga0335080_12232603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 525 | Open in IMG/M |
| 3300032897|Ga0335071_10844344 | Not Available | 864 | Open in IMG/M |
| 3300033004|Ga0335084_10420552 | Not Available | 1376 | Open in IMG/M |
| 3300033289|Ga0310914_10713118 | Not Available | 899 | Open in IMG/M |
| 3300033290|Ga0318519_10184703 | Not Available | 1183 | Open in IMG/M |
| 3300033887|Ga0334790_065620 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1284 | Open in IMG/M |
| 3300034282|Ga0370492_0097180 | Not Available | 1205 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.03% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.12% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.34% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001566 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illumina | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022520 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023226 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 1-5 | Environmental | Open in IMG/M |
| 3300023254 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_03154640 | 2140918007 | Soil | IGELLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRQ |
| JGI10220J13317_111432172 | 3300001139 | Soil | ESVGEVLARLDTVPPVTMVEVAPVDLAIFDQLCTEMGVPQ* |
| A2135W6_10052002 | 3300001566 | Permafrost | VITVESIGELLAKLDLIPSVTMVEVAPVDLAGFDELCPEMGVSQ* |
| JGIcombinedJ26739_1012482372 | 3300002245 | Forest Soil | EAEAEAVITAETISERLAKLDVIPPVTMVEVAMVDLANFDQLFTEMGARQ* |
| Ga0066599_1014058712 | 3300004282 | Freshwater | GEKEEVIAVDLIRELLAKLDTIPPVTMVEVAPVDLASFDQLCVEVRQ* |
| Ga0066689_109858301 | 3300005447 | Soil | KAEGAIMAEEVAELLARFGAIAPVTMVVVAPVDLASFDQLCVNMVVRQ* |
| Ga0070730_107585441 | 3300005537 | Surface Soil | RELLEKAEAVITVESISEVLAKLDAIPPVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0070733_102047511 | 3300005541 | Surface Soil | AETVITVELIGEVLAKLDTIPPVTMVEVAPVNLASFDQLCTEMGVRQ* |
| Ga0066698_103509663 | 3300005558 | Soil | SIRELLAKLDTIPPVTMVEVAPVDLASFDQLCLDMEVQP* |
| Ga0068855_1006455241 | 3300005563 | Corn Rhizosphere | EMLRRLDTITPVTMVEVAAVDLTSFDELFAETAVWQ* |
| Ga0068854_1010382882 | 3300005578 | Corn Rhizosphere | EAVITVESIGEMLARLDTIPAVTMVEVAPVDLAIFDQLCTEMGVPQ* |
| Ga0068860_1004308704 | 3300005843 | Switchgrass Rhizosphere | VLARLDTVPPVTMVEVAPVDLAIFDQLCTEMGARQ* |
| Ga0070766_112573362 | 3300005921 | Soil | TAETVITAESIGEVLAKLDTIPSVTLVEVAPVDLASFDQLCTAMGVRQ* |
| Ga0066790_105318311 | 3300005995 | Soil | ETGTAITVESIGAVLAQLDTIPPVTMVKVAPVDLASFDQLCTGMEVWQ* |
| Ga0066656_106354771 | 3300006034 | Soil | ESIGEVLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0075028_1001464881 | 3300006050 | Watersheds | TVDSIGVLLTQLDMIAPVTMVEVAAVDLASFDQLCTEMGVRQ* |
| Ga0075021_105739372 | 3300006354 | Watersheds | DSIGVLLTQLDMIAPVTMVEVAAVDLASFDQLCTEMGIRQ* |
| Ga0075521_102323141 | 3300006642 | Arctic Peat Soil | LLERKAEAVITVESIGEVLARLDAMVPVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0075425_1026973692 | 3300006854 | Populus Rhizosphere | ITVESIGEVLAKLERLPPVTMVEVAPVDLASFDELCTEMGVSQ* |
| Ga0099794_102075722 | 3300007265 | Vadose Zone Soil | LAKLDTIPSVTLVEVAPVDLASFDQLCAAMGVRQ* |
| Ga0099795_105930652 | 3300007788 | Vadose Zone Soil | EGNAETVITVESIEEALAKLDTIPAVTMVEVAPVNLASFDQLCTEMGVRQ* |
| Ga0105245_110922711 | 3300009098 | Miscanthus Rhizosphere | EVLARLDTLPAVTMVEVAPVDLAIFDQLCTEMGARQ* |
| Ga0099792_110528361 | 3300009143 | Vadose Zone Soil | AEAVITVESIGEVLAKLDTIPAVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0116222_12528801 | 3300009521 | Peatlands Soil | GKIEVAITAESIGELLVKLDTIAPVTMVEVAPVDLTSFDLLCTEMGVRQ* |
| Ga0116225_14549061 | 3300009524 | Peatlands Soil | KIEVAITAESIGELLVKLDTIAPVTMVEVAPVDLTSFDLLCTEMGVRQ* |
| Ga0116111_10013211 | 3300009616 | Peatland | AEAMITAESIGEVLAKLDSMAPVTMVEVAPVDLASFDQFCPQMEVQP* |
| Ga0116127_11579161 | 3300009618 | Peatland | LAKLESMAPVTMVEVAPVDLVSFDQFCPQMGVQP* |
| Ga0116121_13065461 | 3300009644 | Peatland | TVGAIGAMLTRLDTIAPVTMVEVALVDLASFDQLCTEMLVQQ* |
| Ga0074046_108465421 | 3300010339 | Bog Forest Soil | VLARLDAIVPVTMVEVAPVDLTSFDQLCTEMGVRQ* |
| Ga0126381_1030076461 | 3300010376 | Tropical Forest Soil | ERKGEAAITVESIGEVLRRLDTIRPVTVVEVAAVNLASFDELCAETAVRQ* |
| Ga0137392_106619331 | 3300011269 | Vadose Zone Soil | VLAKLDTIPPVTMVEVAPVDLASFDQLCTETGAPQ* |
| Ga0137391_115009081 | 3300011270 | Vadose Zone Soil | AESVGELLRRLDTITPVTVVEVAAVDLASFDQLCAETAVQQ* |
| Ga0137363_102497671 | 3300012202 | Vadose Zone Soil | SIGEVLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0137380_102650793 | 3300012206 | Vadose Zone Soil | VELIGAMLAQLDTIAPVTMVEVALVDLASFDQLCSEMAVRQ* |
| Ga0137379_104431921 | 3300012209 | Vadose Zone Soil | EVLAKLDTIPPVTMVEVTPVDLASFDQLCTERGVPQ* |
| Ga0137387_101623651 | 3300012349 | Vadose Zone Soil | TVESIGEVLAKLDTIPPVTMVEVTPVDLASFDQLCTEMGVRQ* |
| Ga0137387_112697972 | 3300012349 | Vadose Zone Soil | VESIGEVLAKLDTLPPPVTMVEVAPVDLAIFDQLCTAMGAPQ* |
| Ga0137395_105601152 | 3300012917 | Vadose Zone Soil | ELLERKAETVITVESIGEVLAKLETIPPVTLVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0137416_116389121 | 3300012927 | Vadose Zone Soil | TEVAITVESIGELLVKLDTIAPVTMVEVAPVDLAGFDQLFTEMAVRQ* |
| Ga0153915_105730171 | 3300012931 | Freshwater Wetlands | ITVESIGEVLAKLDTIAPVTMVEVAPVDLASFDQLCAEMGVRP* |
| Ga0126375_106436942 | 3300012948 | Tropical Forest Soil | ITVESIQEVLRRLDTIAPVTEVEVAAVNLASFDELCAETAVRQ* |
| Ga0164303_106851672 | 3300012957 | Soil | RIIELLAKLDTIPPVTMVEVAIVDLTSYDQLCTGMGVQQ* |
| Ga0134076_102098711 | 3300012976 | Grasslands Soil | GNAETVITVESIGEVLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0134087_105237442 | 3300012977 | Grasslands Soil | TVESVGEVLAKLDTVPPVTMVEVAPVDLAIFDQLCTEMGVRQ* |
| Ga0181532_104531292 | 3300014164 | Bog | SIRELLAKLDTIPPVTMVKVAPVDLASFDQLCVEVRQ* |
| Ga0182019_113458421 | 3300014498 | Fen | LLERKAEAVITMESIGEVLARLDAIVPVTMVEVAPVDLTSFDQLCTEMGVRQ* |
| Ga0137418_103677791 | 3300015241 | Vadose Zone Soil | GEVLARLETIPSVTWVEVAPVDLASFDQLCTEMGVRQ* |
| Ga0132255_1005800634 | 3300015374 | Arabidopsis Rhizosphere | ITVESIGELLAKLDLIAPVTMVEVAPVDLASFDQLCLDMQVPQ* |
| Ga0134112_102709462 | 3300017656 | Grasslands Soil | VVITVESIGEVLAKLDTIPPVTMVEVAPVDLASFDQLCTEMGVPQ |
| Ga0187856_10495981 | 3300017925 | Peatland | ESIGEVLAKLDSMAPVTMVEVAPVDLVSFDQFCPQMGVQP |
| Ga0187877_13441751 | 3300017931 | Peatland | ESIRELLAKLDTIPPVTMVKVAPVDLASFDQLCVEVRQ |
| Ga0187803_103164902 | 3300017934 | Freshwater Sediment | VIAVESIRELLAKLDTIPPVTMVEVAPVDLASFDQLCMEVRQ |
| Ga0187850_104700211 | 3300017941 | Peatland | LLEGEAEAVITEASIRELLAKLDTIAPVTMVEVAPVDLASFDQLCLDMEVPQ |
| Ga0187876_100132118 | 3300018003 | Peatland | MITAESIGEVLAKLDSMAPVTMVEVAPVDLASFDQFCPQMEVQP |
| Ga0187860_10888593 | 3300018014 | Peatland | ITAESIGEVLAKLDSMAPVTMVEVAPVDLASFDQFCPQMEVQP |
| Ga0187886_13806702 | 3300018018 | Peatland | ITVESIGEVLARLDAIVPVTMVEVAPVDLAGFDQLCTEMGVRQ |
| Ga0187882_12778082 | 3300018021 | Peatland | AVITMESIGEVLARLDAIVPVTMVEVAPVDLASFDQLCTEMGVRQ |
| Ga0187881_102720752 | 3300018024 | Peatland | LERKAEAMITAESIGEVLAKLDSMAPVTMVEVAPVDLASFDQFCPQMEVQP |
| Ga0187867_104570511 | 3300018033 | Peatland | ITVASIGEVLARLDTIAPVTMVEVAPVDLASFDQLCAGMGVRL |
| Ga0187871_108184551 | 3300018042 | Peatland | VESIGEVLARLDTIAPVTMVEVAPVDLASYDQLCAGTGARL |
| Ga0187887_102658462 | 3300018043 | Peatland | EVLARLDTIAPVTMVEVAPVDLAIFDQLCAEMEVRP |
| Ga0187887_104899161 | 3300018043 | Peatland | RTGAVITAESIGAVLAKLDAIQPVTMVEVAPVDLSIFDRLCTEMKVWQ |
| Ga0187890_101291911 | 3300018044 | Peatland | LLEAETVITVESIGDVLATLDTIPPVTMVEVAPVDLASFDRLCTEMGVRQ |
| Ga0187851_101363361 | 3300018046 | Peatland | PQRCGCKAEAVITMESIGEVLARLDAIVPVTMVEVAPVDLASFDQLCVEVRQ |
| Ga0187772_104605102 | 3300018085 | Tropical Peatland | SIREVLLRLDTITPVTMVEVAAVDLTSFDELCPETAVRQ |
| Ga0190264_103248791 | 3300019377 | Soil | VLVKLDTIAPVTMVDVAPVDLAGFDQLCTEMGVRQ |
| Ga0182022_11437232 | 3300019785 | Fen | VITMESIGEVLARLDAIVPVTMVEVAAVDLASFDQLCTEMGVRQ |
| Ga0182028_11667211 | 3300019788 | Fen | VITEASIRELLAKLDTIAPVTMVEVAPVDLAGFDQLCLDMEVPQ |
| Ga0187768_11613312 | 3300020150 | Tropical Peatland | AITVASIGEVLGRLDTITPVTDVEVAAVNLASFDELCAETAGRQ |
| Ga0210395_108494261 | 3300020582 | Soil | TVESISEVLARLDTIPAVTMVEVAPVDLASFDLLCTEMGVRQ |
| Ga0210397_116112361 | 3300021403 | Soil | EVLARLDTIPPVTMVEVAPVDLASFDLLGPEMGVRQ |
| Ga0210391_107297222 | 3300021433 | Soil | EVVITAEAIGELLAKLDAIPPVTMVEVAMVDLTSFDELFTEMGVRQ |
| Ga0224538_10011372 | 3300022520 | Soil | MESIGEVLARLDAIVPVTMVEVAPVDLASFDQLCTEMGVRQ |
| Ga0224555_11689312 | 3300023088 | Soil | VITMESIGEVLARLDAIVPVTMVEVAPVDLASFDQLCTEMGVRQ |
| Ga0224536_10044532 | 3300023226 | Soil | RELLAKLDTIPPVTMVQVAPVDLASFDQLCMAVRQ |
| Ga0224524_10535321 | 3300023254 | Soil | GDKEAVIAVESIRELLAKLDTIPPVTMVEVAPVDLASFDQLCLDMEVPQ |
| Ga0196962_102142462 | 3300024430 | Soil | AVLAQLDTLAPVTMVEVTPVDLASFDQLCTAMAVRQ |
| Ga0207932_10393201 | 3300025495 | Arctic Peat Soil | IRELLAKLDTIPPVTMVKVAPVDLASFDQLCVEVRQ |
| Ga0208080_10899342 | 3300025553 | Arctic Peat Soil | EGEKEAVIAVESIRELLAKLDTIPPVTMVEVAPVDLASFDQLCLDMQVRQ |
| Ga0208220_11305521 | 3300025627 | Arctic Peat Soil | ITAETIREVLAKLDDIAPVTMVEVAPVDLASYDRLCGAMGVQA |
| Ga0208480_10433011 | 3300025633 | Arctic Peat Soil | VVITVDSIGEVLAQLETIVPVTMVEVTLVDLASFDQLCREMAVRQ |
| Ga0209538_13313052 | 3300025846 | Arctic Peat Soil | ELLERKAEAVITVESIGEVLARLDAMVPVTMVEVAPVDLASFDQLCLEMGVRQ |
| Ga0209540_102235133 | 3300025888 | Arctic Peat Soil | GEAEVAITVESIGEVLAQLDTIAPVTMVEVTLVDLASFDQLCTETAVRQ |
| Ga0209540_103779772 | 3300025888 | Arctic Peat Soil | ESIGELLAKLDGIPPVTMVEVAPVDLAGFDQLCTEMGVRQ |
| Ga0209585_102694222 | 3300025891 | Arctic Peat Soil | VESIRELLAKLDTIPPVTMVNVAPVDLASFDQLCMAVRQ |
| Ga0207667_106774031 | 3300025949 | Corn Rhizosphere | EMLRRLDTITPVTMVEVAAVDLTSFDELFAETAVWQ |
| Ga0209131_12470361 | 3300026320 | Grasslands Soil | EVAITVESIGELMARLDTIAPVTMVEVAPVDLTSFDLLCTEMGVRQ |
| Ga0209217_11402652 | 3300027651 | Forest Soil | KAETVITVESIGKVLAELDMIPSVTWVEVAPVDLASFDQLCTEMGVRQ |
| Ga0209011_10650031 | 3300027678 | Forest Soil | ESIGEVLAKLDTIPSVTLVEVAPVDLASFDQLCTAMGVRQ |
| Ga0209772_102063711 | 3300027768 | Bog Forest Soil | GEEEAVITMEAIGAMLAQLDTIAPVTMVEVTLVDLASFDQLCTGMQQ |
| Ga0209490_101548482 | 3300027823 | Freshwater | LLTTLDTIAPVTMVEVTPVDLASFDQLCTEMGVPL |
| Ga0209166_105129422 | 3300027857 | Surface Soil | RELLEKAEAVITVESISEVLAKLDAIPPVTMVEVAPVDLASFDQLCTEMGVRQ |
| Ga0209283_102287941 | 3300027875 | Vadose Zone Soil | VESIGEVLTKLDTIPPVTMVEVAPVDLASFDQLCTEMGVRP |
| Ga0209068_103310901 | 3300027894 | Watersheds | EEVSITVDSIGAMLAQLDTIVPVTMVEVALVDLASFDQLCTEMVVQQ |
| Ga0209488_106919071 | 3300027903 | Vadose Zone Soil | ELLEAEAVITVESVGEVLAKLDTLPPVTMVEVAPVDLAIFDQLCTEMGVPQ |
| Ga0209698_102451742 | 3300027911 | Watersheds | VESIGELLVKLDLIPPVTMVEVAPVDLAGFDQLCPEMGVPQ |
| Ga0302189_101822422 | 3300028788 | Bog | AMLARLDTIPPVTMVKVAPVDLASFDQLCTVMGRPQ |
| Ga0311359_104145082 | 3300029914 | Bog | DLLGRAEAAITVESIRELLAKLDTIPPVTMVQVAPVDLASFDQLYMAVRQ |
| Ga0302141_10182593 | 3300029919 | Bog | ITMASIGEVLAQLDAIAPVTMVEVAPVDLTSFDQLCTEMAVRQ |
| Ga0311334_106943372 | 3300029987 | Fen | LLEGRLEIAITVEAIGELLAKLDTITPVTMVEVAPVDLASFDQLCLDMQVRQ |
| Ga0311350_112989851 | 3300030002 | Fen | ITAESIGAMLAKLDTVAPVTMVKVAPVDLASFDQLCTVMGRPQ |
| Ga0302286_103087052 | 3300030047 | Fen | LLEGRLEIAITVEAIGELLAKLDTITPVTMVEVAPVDLTSFDQLCLDMQVRQ |
| Ga0302275_101516944 | 3300030518 | Bog | DLLGRAEAAITVESIRELLAKLDTIPPVTMVQVAPVDLASFDELCMAVRQ |
| Ga0170824_1243804092 | 3300031231 | Forest Soil | AEAISELLAKLDTIPPVTMVEVAMVDLASFDQLFTEIGVRQ |
| Ga0302140_104026621 | 3300031261 | Bog | VITAESIGAMLARLDTIPPVTMVKVAPVDLASFDQLCTVMGRPQ |
| Ga0265316_101830951 | 3300031344 | Rhizosphere | IGEVLARLDTIAPVTMVEVAPVDLASYDQLCAGTGAQL |
| Ga0302320_116260081 | 3300031524 | Bog | MPALTLDTIAPVTMVEVALVDLASFDQLCTEMLVQQ |
| Ga0302320_119210882 | 3300031524 | Bog | TVGAIGAMLTRLDTIAPVTMVEVALVDLASFDQLCTEMLVQQ |
| Ga0302319_117399671 | 3300031788 | Bog | ITVESISAMLAQLDTIQPVTMVKVALVDLASFDQLCTEMLVRQ |
| Ga0318576_102852311 | 3300031796 | Soil | IREVLQRLDTIAPVTMVEVAAVDLASFDELCAETAVRQ |
| Ga0302322_1009258961 | 3300031902 | Fen | AITVEAIGELLAKLDTITPVTMVEVAPVDLASFDQLCLDMQVRQ |
| Ga0306921_122406061 | 3300031912 | Soil | TVESMGEVLRRLDTIAPVTEVEVAAVNLASFDELCAETAVRQ |
| Ga0308175_1012041231 | 3300031938 | Soil | LLERKTETAITVESIGEELARLDTIAPVTTVEVAPVDLASFDQLCAGMEARQ |
| Ga0310913_105410961 | 3300031945 | Soil | ESIGEVLRRLDTIRPVTVVEVAAVNLASFDELCAEMAVRQ |
| Ga0307470_102279841 | 3300032174 | Hardwood Forest Soil | AAITVESIREVIAKLDTIAPVTMVEVAPVNLASFDQLYTELGVRQ |
| Ga0307471_1003303833 | 3300032180 | Hardwood Forest Soil | ITVESISEVIAKLDTIAPVTMVEVAPVNLASFDQLYTEMGVRQ |
| Ga0307471_1023828321 | 3300032180 | Hardwood Forest Soil | VVITVESIGELLAKLDLIPPVTMVEVAPVDLAGFDQLYTEMGALQ |
| Ga0307472_1019808291 | 3300032205 | Hardwood Forest Soil | ELLERKTETAITVESIAAVLVKLDTIAPVTMVEVAPVNLASFDQLYTEMGVRQ |
| Ga0335085_111622372 | 3300032770 | Soil | EAAITVESIGEVLRRLDTIRPVTVVEVSAVNLASFDELCAEMAVRQ |
| Ga0335082_111748101 | 3300032782 | Soil | ESIGEVVRRLDTIAPATEVEVAAVNLASFDELCAETAVRQ |
| Ga0335082_116963011 | 3300032782 | Soil | GEVLRRLDTIAPVTEVEVAAVNLASFDELCAETAVRQ |
| Ga0335080_122326031 | 3300032828 | Soil | VITVDAIGAMLAQLDTIAPVTMVEVTRVDLTSFDQLCTEMAVRQ |
| Ga0335071_108443442 | 3300032897 | Soil | RKAEAAITVESIGEVLRRLDTLAPVTEVEVAAVNLASFDELCAETAVRQ |
| Ga0335084_104205522 | 3300033004 | Soil | RKAEASITVESITEVLRRLDTIAPATEVEVAAVNLASFDELCAETAVRQ |
| Ga0310914_107131182 | 3300033289 | Soil | KAGRVITVESIGEVLRRLDTIAPVTEVEVAAVNLASFDELCAETAVRQ |
| Ga0318519_101847033 | 3300033290 | Soil | AITVESIREVLQRLDTIAPVTMVEVAAVDLASFDELCAETAVRQ |
| Ga0334790_065620_7_132 | 3300033887 | Soil | VGAIGAMLTRLDTIAPVTMVEVALVDLASFDQLCTEMLVQQ |
| Ga0370492_0097180_1047_1205 | 3300034282 | Untreated Peat Soil | LLEERTGAVITAESIGAVLAKLDAIQPVTMVEVAPVDLSIFDRLCTEMKVWQ |
| ⦗Top⦘ |