| Basic Information | |
|---|---|
| Family ID | F064756 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VVRVLAVSDEVDDALAADPRAVRGAQLILACGDLPFEYLG |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.66 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 96.09 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.375 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.562 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.188 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 0.00% Coil/Unstructured: 88.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00128 | Alpha-amylase | 20.31 |
| PF00756 | Esterase | 3.12 |
| PF13561 | adh_short_C2 | 1.56 |
| PF04075 | F420H2_quin_red | 1.56 |
| PF00528 | BPD_transp_1 | 1.56 |
| PF13671 | AAA_33 | 0.78 |
| PF00202 | Aminotran_3 | 0.78 |
| PF00196 | GerE | 0.78 |
| PF00296 | Bac_luciferase | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 20.31 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 20.31 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 20.31 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 20.31 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.38 % |
| All Organisms | root | All Organisms | 40.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005329|Ga0070683_100452902 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005406|Ga0070703_10274826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300005435|Ga0070714_100451286 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300005437|Ga0070710_11055418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300005437|Ga0070710_11244470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300005439|Ga0070711_100262061 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005439|Ga0070711_101799256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300005548|Ga0070665_102116311 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005610|Ga0070763_10072831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1683 | Open in IMG/M |
| 3300005610|Ga0070763_10794966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300005719|Ga0068861_102637999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300005764|Ga0066903_108286121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300005764|Ga0066903_109094648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005843|Ga0068860_101841681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300005952|Ga0080026_10243187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 542 | Open in IMG/M |
| 3300006028|Ga0070717_10532307 | Not Available | 1063 | Open in IMG/M |
| 3300006358|Ga0068871_101107366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300006796|Ga0066665_11239897 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006806|Ga0079220_10472244 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300006954|Ga0079219_10213691 | Not Available | 1108 | Open in IMG/M |
| 3300009088|Ga0099830_10581245 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300009093|Ga0105240_11419245 | Not Available | 729 | Open in IMG/M |
| 3300009098|Ga0105245_11438333 | Not Available | 740 | Open in IMG/M |
| 3300009553|Ga0105249_11395461 | Not Available | 772 | Open in IMG/M |
| 3300009698|Ga0116216_10210678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
| 3300009792|Ga0126374_10965474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300010046|Ga0126384_10110236 | Not Available | 2050 | Open in IMG/M |
| 3300010048|Ga0126373_12901161 | Not Available | 535 | Open in IMG/M |
| 3300010152|Ga0126318_10515655 | Not Available | 540 | Open in IMG/M |
| 3300010154|Ga0127503_10453601 | Not Available | 581 | Open in IMG/M |
| 3300010341|Ga0074045_10559601 | Not Available | 732 | Open in IMG/M |
| 3300010358|Ga0126370_12614932 | Not Available | 505 | Open in IMG/M |
| 3300010360|Ga0126372_13270927 | Not Available | 504 | Open in IMG/M |
| 3300010361|Ga0126378_10684352 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300010361|Ga0126378_11457657 | Not Available | 776 | Open in IMG/M |
| 3300010361|Ga0126378_12046806 | Not Available | 653 | Open in IMG/M |
| 3300010361|Ga0126378_12091522 | Not Available | 646 | Open in IMG/M |
| 3300010361|Ga0126378_12753843 | Not Available | 562 | Open in IMG/M |
| 3300010366|Ga0126379_13484008 | Not Available | 527 | Open in IMG/M |
| 3300010376|Ga0126381_102879954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300010379|Ga0136449_101742116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
| 3300010379|Ga0136449_103971556 | Not Available | 553 | Open in IMG/M |
| 3300010396|Ga0134126_10626833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1228 | Open in IMG/M |
| 3300010396|Ga0134126_11614767 | Not Available | 713 | Open in IMG/M |
| 3300011090|Ga0138579_1067888 | Not Available | 570 | Open in IMG/M |
| 3300011106|Ga0151489_1495522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
| 3300011120|Ga0150983_14059631 | Not Available | 820 | Open in IMG/M |
| 3300011404|Ga0153951_1118940 | Not Available | 505 | Open in IMG/M |
| 3300012096|Ga0137389_11183087 | Not Available | 655 | Open in IMG/M |
| 3300012199|Ga0137383_10226160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1371 | Open in IMG/M |
| 3300012201|Ga0137365_10005797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 9886 | Open in IMG/M |
| 3300012208|Ga0137376_10270925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1473 | Open in IMG/M |
| 3300012209|Ga0137379_10502613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1120 | Open in IMG/M |
| 3300012362|Ga0137361_11855032 | Not Available | 520 | Open in IMG/M |
| 3300012386|Ga0134046_1088649 | Not Available | 550 | Open in IMG/M |
| 3300012948|Ga0126375_10631928 | Not Available | 823 | Open in IMG/M |
| 3300012971|Ga0126369_12670993 | Not Available | 583 | Open in IMG/M |
| 3300013308|Ga0157375_10217890 | Not Available | 2067 | Open in IMG/M |
| 3300014169|Ga0181531_10229376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1131 | Open in IMG/M |
| 3300015241|Ga0137418_10814348 | Not Available | 698 | Open in IMG/M |
| 3300015359|Ga0134085_10591787 | Not Available | 515 | Open in IMG/M |
| 3300016341|Ga0182035_10616494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300016445|Ga0182038_10537386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1002 | Open in IMG/M |
| 3300016445|Ga0182038_11050465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300018035|Ga0187875_10218156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1048 | Open in IMG/M |
| 3300019890|Ga0193728_1073338 | Not Available | 1623 | Open in IMG/M |
| 3300020080|Ga0206350_10827264 | Not Available | 565 | Open in IMG/M |
| 3300021171|Ga0210405_11207673 | Not Available | 560 | Open in IMG/M |
| 3300021415|Ga0193694_1019106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
| 3300022467|Ga0224712_10664359 | Not Available | 511 | Open in IMG/M |
| 3300022512|Ga0242676_1040516 | Not Available | 555 | Open in IMG/M |
| 3300025544|Ga0208078_1101061 | Not Available | 584 | Open in IMG/M |
| 3300025633|Ga0208480_1076950 | Not Available | 818 | Open in IMG/M |
| 3300025914|Ga0207671_10670111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300025920|Ga0207649_11209164 | Not Available | 597 | Open in IMG/M |
| 3300025922|Ga0207646_10434188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
| 3300025928|Ga0207700_10578750 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300026294|Ga0209839_10217495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| 3300027765|Ga0209073_10189268 | Not Available | 778 | Open in IMG/M |
| 3300027775|Ga0209177_10430694 | Not Available | 535 | Open in IMG/M |
| 3300027842|Ga0209580_10108230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1349 | Open in IMG/M |
| 3300028138|Ga0247684_1048448 | Not Available | 686 | Open in IMG/M |
| 3300028718|Ga0307307_10045274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1278 | Open in IMG/M |
| 3300028773|Ga0302234_10069018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1576 | Open in IMG/M |
| 3300030057|Ga0302176_10025841 | Not Available | 2225 | Open in IMG/M |
| 3300030509|Ga0302183_10056962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1550 | Open in IMG/M |
| 3300030602|Ga0210254_10954346 | Not Available | 584 | Open in IMG/M |
| 3300030618|Ga0311354_10432479 | Not Available | 1319 | Open in IMG/M |
| 3300031057|Ga0170834_101138127 | Not Available | 816 | Open in IMG/M |
| 3300031228|Ga0299914_11372782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300031231|Ga0170824_128271666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 589 | Open in IMG/M |
| 3300031446|Ga0170820_11968504 | Not Available | 587 | Open in IMG/M |
| 3300031544|Ga0318534_10385793 | Not Available | 805 | Open in IMG/M |
| 3300031572|Ga0318515_10111471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1441 | Open in IMG/M |
| 3300031681|Ga0318572_10688529 | Not Available | 609 | Open in IMG/M |
| 3300031681|Ga0318572_10901768 | Not Available | 525 | Open in IMG/M |
| 3300031682|Ga0318560_10066711 | Not Available | 1807 | Open in IMG/M |
| 3300031723|Ga0318493_10332448 | Not Available | 824 | Open in IMG/M |
| 3300031723|Ga0318493_10712213 | Not Available | 563 | Open in IMG/M |
| 3300031724|Ga0318500_10425828 | Not Available | 662 | Open in IMG/M |
| 3300031747|Ga0318502_10318402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
| 3300031782|Ga0318552_10160049 | Not Available | 1133 | Open in IMG/M |
| 3300031799|Ga0318565_10385673 | Not Available | 679 | Open in IMG/M |
| 3300031820|Ga0307473_10653706 | Not Available | 733 | Open in IMG/M |
| 3300031835|Ga0318517_10199848 | Not Available | 900 | Open in IMG/M |
| 3300031860|Ga0318495_10328803 | Not Available | 678 | Open in IMG/M |
| 3300031890|Ga0306925_11207796 | Not Available | 757 | Open in IMG/M |
| 3300031893|Ga0318536_10589228 | Not Available | 556 | Open in IMG/M |
| 3300031894|Ga0318522_10322860 | Not Available | 585 | Open in IMG/M |
| 3300031896|Ga0318551_10077645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1733 | Open in IMG/M |
| 3300031896|Ga0318551_10202260 | Not Available | 1099 | Open in IMG/M |
| 3300031896|Ga0318551_10308998 | Not Available | 890 | Open in IMG/M |
| 3300031941|Ga0310912_11224246 | Not Available | 571 | Open in IMG/M |
| 3300031942|Ga0310916_10108757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2238 | Open in IMG/M |
| 3300031945|Ga0310913_10603990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
| 3300031954|Ga0306926_11359387 | Not Available | 826 | Open in IMG/M |
| 3300031954|Ga0306926_12482796 | Not Available | 569 | Open in IMG/M |
| 3300032010|Ga0318569_10415619 | Not Available | 627 | Open in IMG/M |
| 3300032055|Ga0318575_10154851 | Not Available | 1140 | Open in IMG/M |
| 3300032055|Ga0318575_10622602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300032066|Ga0318514_10175666 | Not Available | 1117 | Open in IMG/M |
| 3300032174|Ga0307470_10139583 | Not Available | 1464 | Open in IMG/M |
| 3300032783|Ga0335079_10352370 | Not Available | 1596 | Open in IMG/M |
| 3300032896|Ga0335075_10421940 | Not Available | 1406 | Open in IMG/M |
| 3300032896|Ga0335075_11682340 | Not Available | 517 | Open in IMG/M |
| 3300033289|Ga0310914_10497348 | Not Available | 1103 | Open in IMG/M |
| 3300033289|Ga0310914_10791303 | Not Available | 846 | Open in IMG/M |
| 3300033290|Ga0318519_10736026 | Not Available | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.34% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070683_1004529023 | 3300005329 | Corn Rhizosphere | MVRVLAVSDEIDDALVADPTAVRGAQLILACGDLPFEYLGSL |
| Ga0070703_102748261 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGSLMN |
| Ga0070714_1004512863 | 3300005435 | Agricultural Soil | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYLGYLMN |
| Ga0070710_110554181 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAVSDEIDDALVADPTAVRGAQLILACGDLPFEYLGSLM |
| Ga0070710_112444702 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVLAVSDEIDDALVAGPTAVRGAQLILACGDLPFEYLGS |
| Ga0070711_1002620611 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYLGYL |
| Ga0070711_1017992561 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYLG |
| Ga0070665_1021163111 | 3300005548 | Switchgrass Rhizosphere | MVRVLAVSDEVDDVLRADPGAARGAELIVSCGDLPFEYL |
| Ga0070763_100728311 | 3300005610 | Soil | VLAVSDETSDALLTDLDPVRSARLILACGDLPFDY |
| Ga0070763_107949662 | 3300005610 | Soil | VSAPSYDHGVIRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLG |
| Ga0068861_1026379992 | 3300005719 | Switchgrass Rhizosphere | MVRVLAVSDEIDDALVADPTAVRGAQLILACGDLPFE |
| Ga0066903_1082861212 | 3300005764 | Tropical Forest Soil | VVLVLAVSDEVDDALLADPHAVRAAELIVACGDLPFEYLGRLMNVLD |
| Ga0066903_1090946482 | 3300005764 | Tropical Forest Soil | VVLVLAVSDEVDDALLADSHAVRAAELIVACGDLPFEYLGRL |
| Ga0068860_1018416811 | 3300005843 | Switchgrass Rhizosphere | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYLG |
| Ga0080026_102431872 | 3300005952 | Permafrost Soil | VLAVSDEVDEGLCADLGPVRAAELVVACGDLPFEYLGHL |
| Ga0070717_105323074 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLG |
| Ga0068871_1011073661 | 3300006358 | Miscanthus Rhizosphere | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGSLMN |
| Ga0066665_112398971 | 3300006796 | Soil | VVLVLAVSDEVDNALYADVGAVREARLIVACGDLPF |
| Ga0079220_104722441 | 3300006806 | Agricultural Soil | VLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLG |
| Ga0079219_102136911 | 3300006954 | Agricultural Soil | VVLVLAVSDEVDDALLADWHAVRQPQLIVACGDLP |
| Ga0099830_105812454 | 3300009088 | Vadose Zone Soil | VVRVLAVSDEVDEGLCANVGLARDAELILACGDLPF |
| Ga0105240_114192451 | 3300009093 | Corn Rhizosphere | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGSL |
| Ga0105245_114383331 | 3300009098 | Miscanthus Rhizosphere | MVRVLAISDEVDDALVADPTAVRGAQLILACGDLPFEY |
| Ga0105249_113954611 | 3300009553 | Switchgrass Rhizosphere | VVCVLAVSDQVEEGLYADLRPVRGADLILACGDLPFEYLGYLMNG |
| Ga0116216_102106781 | 3300009698 | Peatlands Soil | MVRVLAVSDEVDDALLANPTAVRGAQLILACGDLRFEYLGSLMNVLDVPL |
| Ga0126374_109654741 | 3300009792 | Tropical Forest Soil | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYLGYLMNG |
| Ga0126384_101102363 | 3300010046 | Tropical Forest Soil | VVAVLAVSDEVDSALYADLGAVRAAQLIVACGDLPFDYLAYLM |
| Ga0126373_129011611 | 3300010048 | Tropical Forest Soil | VVLVLAVADEVDDALCADVRPVREARLIVACGDLPF |
| Ga0126318_105156551 | 3300010152 | Soil | MVRVLAVSDEIDDALVADPTAVRGAQLILACGDLPFEYL |
| Ga0127503_104536012 | 3300010154 | Soil | VVLVLAVSDEVDNALYANVGAVREARLIVACGDLPFD |
| Ga0074045_105596011 | 3300010341 | Bog Forest Soil | VHVLAVSDEVAGDLLANVSRARSASLILACGDLPAGYLGAL |
| Ga0126370_126149321 | 3300010358 | Tropical Forest Soil | VVLVLAVSDEVDDVLLADWHAVRQPQLIVACGDLPF |
| Ga0126372_132709272 | 3300010360 | Tropical Forest Soil | VVLVLAVSDEVDNPLSADVGAVREARLIVACGDLPFDYLGYLM |
| Ga0126378_106843523 | 3300010361 | Tropical Forest Soil | VVLVLAVSDEVDNALYADVGAVREARLIVACGDLPFD |
| Ga0126378_114576573 | 3300010361 | Tropical Forest Soil | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFEYL |
| Ga0126378_120468062 | 3300010361 | Tropical Forest Soil | VVLVLAVSDEVDNALYADVGAVREARLIVACGDLPFDYLG |
| Ga0126378_120915221 | 3300010361 | Tropical Forest Soil | VVRVLAVSDEVDDALAADPRAVRGAQLILACGDLPFEYLG |
| Ga0126378_127538432 | 3300010361 | Tropical Forest Soil | VVLVLAVSDEVDDVLLADWHAVRRPQLIVACGDLPF |
| Ga0126379_134840081 | 3300010366 | Tropical Forest Soil | VVLVLAVSDEVDDALLADTRAVREARLIVACGDLPFG |
| Ga0126381_1028799541 | 3300010376 | Tropical Forest Soil | VVLVLAVSDQVDSALYADVGAVRDARLIVACGDLPFDYL |
| Ga0136449_1017421163 | 3300010379 | Peatlands Soil | VLAVSDVVDEALWTDVSPVRSAELIVGCGDLPFEYLGR |
| Ga0136449_1039715561 | 3300010379 | Peatlands Soil | VVRVLAVSDVVEEGLWADIGPARGADLILGCGDLPFE |
| Ga0134126_106268334 | 3300010396 | Terrestrial Soil | VVRVLAVSDEVDDALVADPAAVRGAQLILACGDLPFGYLGALMNM |
| Ga0134126_116147672 | 3300010396 | Terrestrial Soil | MVRVLAVSDEVNDALVADPTAVRGAQLILACGDLPFEYL |
| Ga0138579_10678881 | 3300011090 | Peatlands Soil | MVRVLAVSDEVDDALLANPTAVRGAQLILACGDLPFQYL |
| Ga0151489_14955223 | 3300011106 | Soil | MVRVLAVSDEIDDALVADPTAVRGAQLILACGDLP |
| Ga0150983_140596311 | 3300011120 | Forest Soil | VSTPSYDRGVVRVLAVSDEVDDALVADPTAVRRAQLILACGDLPFEYL |
| Ga0153951_11189401 | 3300011404 | Attine Ant Fungus Gardens | VLAVSDEVDDAIAADPGPAGGTDLIVACGDLPFEYL |
| Ga0137389_111830871 | 3300012096 | Vadose Zone Soil | VVCVLAVSDEVDEGLYADLGPVRAAKLIVACGDLPFEYLG |
| Ga0137383_102261601 | 3300012199 | Vadose Zone Soil | VVRVLAVSDEVDDALVADPAAVRGAQLIVACGDLPFEYL |
| Ga0137365_100057979 | 3300012201 | Vadose Zone Soil | VVLVLAVSDEVDDALLADVHAVRQAQLIVACGDLPFEYLG |
| Ga0137376_102709253 | 3300012208 | Vadose Zone Soil | VVLVLAVSDEVDDALYANAGAVREAGLIVACGDLPFDYLVT* |
| Ga0137379_105026131 | 3300012209 | Vadose Zone Soil | VVCVLAVSDEVDEGLYADLGPVRAAKLVVACGDLPFEYLGYLMNGL |
| Ga0137361_118550322 | 3300012362 | Vadose Zone Soil | VVRVLAVADEVDDALCANVSIADSAELILACGDLPFD |
| Ga0134046_10886491 | 3300012386 | Grasslands Soil | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPF |
| Ga0126375_106319282 | 3300012948 | Tropical Forest Soil | VVLVLAVSDEVDDALLADPHAVRAAELIVACGDLPFEYLGRLMNA |
| Ga0126369_126709931 | 3300012971 | Tropical Forest Soil | MVCVLAVSDEVDERLCADLRPVRAAELIVACGDLPFDYLG |
| Ga0157375_102178903 | 3300013308 | Miscanthus Rhizosphere | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFE |
| Ga0181531_102293763 | 3300014169 | Bog | VVCVLAVSDEVDERLLADLGPVRAAELVVACGDLPFEYLRYLMNGL |
| Ga0137418_108143482 | 3300015241 | Vadose Zone Soil | VVRVLAVSDVVEEGLWADIGPVRGAELILGCGDLP |
| Ga0134085_105917871 | 3300015359 | Grasslands Soil | VVRVLAVSDEVDDALVAAPAAVRGAQLILACGDLPFGYLGSL |
| Ga0182035_106164941 | 3300016341 | Soil | VLAVSDKVDEALAADPGPVHTAELILACGDLPFDYLDTLMNA |
| Ga0182038_105373863 | 3300016445 | Soil | VLAVSDEVDDALLADPSAARGVELILACGDLPMEYLGSLMDC |
| Ga0182038_110504652 | 3300016445 | Soil | VLAVSDETSEELLATPDLVRSAQLILACGDLPFDYLGALLNRLEIP |
| Ga0187875_102181561 | 3300018035 | Peatland | MVRVLAVSDVPDQGLLASLSAVATAELILACGDLP |
| Ga0193728_10733383 | 3300019890 | Soil | VVRVLAVSDVVEEGLCADIGPARGADLILACGDLP |
| Ga0206350_108272641 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGALMN |
| Ga0210405_112076731 | 3300021171 | Soil | VLAPSYDRNVVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGS |
| Ga0193694_10191063 | 3300021415 | Soil | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLG |
| Ga0224712_106643592 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSVLAVSDEVDEGLCVDLGSVRGAELVLACGDLPFDYLD |
| Ga0242676_10405162 | 3300022512 | Soil | VPVASRNRDLVRVLAVSDEVDDALVADPAAVRGAQLILACGDLPFNY |
| Ga0208078_11010611 | 3300025544 | Arctic Peat Soil | VVRVLAVSDVVEEGLRADIGPARGADIILACGDLPFEYLGY |
| Ga0208480_10769501 | 3300025633 | Arctic Peat Soil | VVRVLAVSDVVEEGLRADIGPARGADIILACGDLPFEYLGYLMNA |
| Ga0207671_106701111 | 3300025914 | Corn Rhizosphere | VLAVSDEIDDVLVADPTAVRGAQLILACGDLPFEY |
| Ga0207649_112091642 | 3300025920 | Corn Rhizosphere | MVRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGS |
| Ga0207646_104341881 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAVSDEVNEALAADPGPARAAELIVACGDLPFDYLDT |
| Ga0207700_105787503 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRVLAVSDVVDEALSANVSGVRDAELILACGDLPFEYLGSL |
| Ga0209839_102174951 | 3300026294 | Soil | VVCVLAVSDEVDERLYADLGPVRAAEFIVACGDLPFEYLGYLMN |
| Ga0209073_101892681 | 3300027765 | Agricultural Soil | VVLVLAVSDEVDDALLADPHAVRAAELIVACGDLPFEYL |
| Ga0209177_104306941 | 3300027775 | Agricultural Soil | MTRVLAVSDEVDDALVADPTAVRGAQLILACGDLPFEYLGAL |
| Ga0209580_101082304 | 3300027842 | Surface Soil | VLAVSDEVDDALLADATAVRSAQLILACGDLPFEYLGSLM |
| Ga0247684_10484481 | 3300028138 | Soil | MVCVLAVSDQVDEGLYADLRPVRGADLILACGDLPFE |
| Ga0307307_100452743 | 3300028718 | Soil | VLAISDEVDDALVADPTAVRGAQLILACGDLPFEYLGS |
| Ga0302234_100690181 | 3300028773 | Palsa | VLAVSDEVDDALVAGPTAVRGAQLILACGDLPFEYLGSLMNILD |
| Ga0302176_100258413 | 3300030057 | Palsa | VVCVLAVSDEVDEGLYADLGPVRAAELVVACGDLP |
| Ga0302183_100569621 | 3300030509 | Palsa | VLAVSDEVDDALVAGPTAVRGAQLILACGDLPFEYLGSLMNILDVP |
| Ga0210254_109543461 | 3300030602 | Soil | MVRVLAVSDEVDDALLANRTAVRGAKLILACGDLPFEYLGSL |
| Ga0311354_104324794 | 3300030618 | Palsa | VRVLAVSDEVAGDLLANVSRARSAALILACGDLPADYLGALMNALDV |
| Ga0170834_1011381271 | 3300031057 | Forest Soil | VVLVLAVSDEIDDALLADLRAVRRPQLIVACGDLPFEYL |
| Ga0299914_113727822 | 3300031228 | Soil | MVCILAVSDEVDERLLDSDLKKLDAKLVVACGDLPFDYLET |
| Ga0170824_1282716662 | 3300031231 | Forest Soil | VLAVSDEVDDALLADPAAVRGAQLILACGDLPFEYLGSLMDE |
| Ga0170820_119685041 | 3300031446 | Forest Soil | VLAVSDEVDDALLADPAAVRGAQLILACGDLPFEYLGSLMNV |
| Ga0318534_103857931 | 3300031544 | Soil | VLAVSDEVDNALYADVAAVREARLIVACGDLPFDYLG |
| Ga0318515_101114711 | 3300031572 | Soil | MVRVLAVSDETNDALAADPGPAGAAELILACGDLPSDYLGSLMNALDV |
| Ga0318572_106885291 | 3300031681 | Soil | VVLVLAVSDEVDDVLRVDMRAVRAARLIVACGDLPFEYLGYLMNALDV |
| Ga0318572_109017682 | 3300031681 | Soil | VLAVSDEVDIALYADVGSVREARLIVACGDLPFDYLGCLMNA |
| Ga0318560_100667111 | 3300031682 | Soil | VLAVSDEVDDALLANPSAVRGVELIMACGDLPMGYLS |
| Ga0318493_103324481 | 3300031723 | Soil | VVLVLAVSDEADELLRADPRAVRAARLIVACGDLP |
| Ga0318493_107122131 | 3300031723 | Soil | VISVLAVSDEADDALVADPTAVRGAQLILACGDLPFEYLGSLMNVLD |
| Ga0318500_104258282 | 3300031724 | Soil | VVLVLAVSDEVDDALLADPRAVRAAELIVACGDLPFEYLGRLM |
| Ga0318502_103184023 | 3300031747 | Soil | VVLVLAVSDEVDHARYTDVRAVREARLICCGALPA |
| Ga0318552_101600492 | 3300031782 | Soil | VVLVLAVSDEVDDALLADPRAVRAAELIVACGDLPFEYLGRLMNM |
| Ga0318565_103856732 | 3300031799 | Soil | VVLVLAVSDEADELLRADPRAVRAARLIVACGDLPFEYLGY |
| Ga0307473_106537061 | 3300031820 | Hardwood Forest Soil | VLAISDEVDDALVADPTAVRGAQLILACGDLPFEYLGSLMNA |
| Ga0318517_101998482 | 3300031835 | Soil | MVLVLAVSDEVDDVLCADVRAVRAAQLILSCGDLPFDYLD |
| Ga0318495_103288031 | 3300031860 | Soil | VVLVLAVSDEADELLRVDVRPVQAARLIVACGDLPFEYLG |
| Ga0306925_112077961 | 3300031890 | Soil | VVLVLAVSDEVDNMLRADARPVQDAQLVVACGDLPFDYL |
| Ga0318536_105892281 | 3300031893 | Soil | VVLVLAVSDEVDHARYTDVGAARKARLIACGDLPA |
| Ga0318522_103228601 | 3300031894 | Soil | VVLVLAVSDEVDDALLADWHAVRRPQLIVACGDLPFEY |
| Ga0318551_100776453 | 3300031896 | Soil | VVLVLAVSDEVDDALLADWHAVRQAQLIVACGDLPFEYLGQLMNRL |
| Ga0318551_102022601 | 3300031896 | Soil | VVLVLAISDEVDDSLLADAHAVRQAQLIVACGDLPFDYLGRLMNLL |
| Ga0318551_103089981 | 3300031896 | Soil | VVLVLAVSDEADELLRVDVRPVQAARLIVACGDLPFEYLGYLM |
| Ga0310912_112242462 | 3300031941 | Soil | VLAVSDEVDRALYADVGAVRDARLIVACGDLPFDY |
| Ga0310916_101087571 | 3300031942 | Soil | VVLVLAVSDEVDDALLADWHAVRQAQLIVACGDLP |
| Ga0310913_106039902 | 3300031945 | Soil | VVLVLAVSDEVDNMLRADARPVQDAQLVVACGDLPFDYLDYLMN |
| Ga0306926_113593872 | 3300031954 | Soil | VVRVLAVSDVVEEGLLADLGPVRGTELIVACGDLPFDYLGY |
| Ga0306926_124827961 | 3300031954 | Soil | VVLVLAVSDEVDDALLADWHAVRRPQLIVACGDLPF |
| Ga0318569_104156191 | 3300032010 | Soil | VVLVLAVSDEADELLRADPRAVRAARLIVACGDLPFE |
| Ga0318575_101548512 | 3300032055 | Soil | VVLVLAISDEVDDALLADAHAVRQAQLIVACGDLPFDYLGRLM |
| Ga0318575_106226022 | 3300032055 | Soil | VLAVSDETSEELLATPDLVRSARLILACGDLPFDYLGALLNRLE |
| Ga0318514_101756662 | 3300032066 | Soil | VVLVLAVSDEIDDALLADPRAVRAAELIVACGDLPFEYLGRLMNIL |
| Ga0307470_101395833 | 3300032174 | Hardwood Forest Soil | VVAVLAVSDEVDSALYADLGAVREAQLIVACGDLPFDYL |
| Ga0335079_103523703 | 3300032783 | Soil | VVLVLAVSDEMDDALYADVGAVREARLIVACGDLPFDYLG |
| Ga0335075_104219403 | 3300032896 | Soil | VLAVSDEVDDALLAEPTPARGAELILACGDLPLDYLGSLMNRLDV |
| Ga0335075_116823402 | 3300032896 | Soil | VLAVSDEVAENLLADPRPVRSAQLILACGDLPAEYLGALMNR |
| Ga0310914_104973481 | 3300033289 | Soil | VLAVSDEVDRVLYADVAAVREARLIVACGDLPFDYLG |
| Ga0310914_107913032 | 3300033289 | Soil | VVLVLAISDEVDDALLADAHAVRQAQLIVACGDLPFDYLGRL |
| Ga0318519_107360262 | 3300033290 | Soil | VVLVLAVSDEVDDALLADPHAVRAAELIVACGDLPFEYLGRLMNVLKV |
| ⦗Top⦘ |