| Basic Information | |
|---|---|
| Family ID | F064716 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 82.81 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (92.188 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (67.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.59% β-sheet: 0.00% Coil/Unstructured: 55.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 3.12 |
| PF01165 | Ribosomal_S21 | 0.78 |
| PF13884 | Peptidase_S74 | 0.78 |
| PF03237 | Terminase_6N | 0.78 |
| PF10805 | DUF2730 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.22 % |
| Unclassified | root | N/A | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10138032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300001282|B570J14230_10137876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300001450|JGI24006J15134_10055501 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
| 3300001450|JGI24006J15134_10183954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300001472|JGI24004J15324_10134969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300002144|M2t2BS2_10129177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300002144|M2t2BS2_10972461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300002514|JGI25133J35611_10011669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3787 | Open in IMG/M |
| 3300002514|JGI25133J35611_10021682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2530 | Open in IMG/M |
| 3300002514|JGI25133J35611_10089357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300003277|JGI25908J49247_10047091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300005581|Ga0049081_10293223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300006025|Ga0075474_10054002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1354 | Open in IMG/M |
| 3300006025|Ga0075474_10085007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300006484|Ga0070744_10059070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300006484|Ga0070744_10077941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300006735|Ga0098038_1282036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300006735|Ga0098038_1287747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300006737|Ga0098037_1028358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2069 | Open in IMG/M |
| 3300006737|Ga0098037_1095838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
| 3300006737|Ga0098037_1143328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300006793|Ga0098055_1008066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4876 | Open in IMG/M |
| 3300006867|Ga0075476_10295710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300006916|Ga0070750_10034873 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300006916|Ga0070750_10158537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300006916|Ga0070750_10444085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300006928|Ga0098041_1291606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300007229|Ga0075468_10138445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300007344|Ga0070745_1287469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300007538|Ga0099851_1116684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300007538|Ga0099851_1166708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300007541|Ga0099848_1148335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300007559|Ga0102828_1159426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300007692|Ga0102823_1148016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300008113|Ga0114346_1014567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4363 | Open in IMG/M |
| 3300008113|Ga0114346_1214136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300008266|Ga0114363_1105924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
| 3300008267|Ga0114364_1039741 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300009027|Ga0102957_1126250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300009075|Ga0105090_10484662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300009170|Ga0105096_10045984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2151 | Open in IMG/M |
| 3300009181|Ga0114969_10619984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009435|Ga0115546_1144854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300009449|Ga0115558_1305705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300010148|Ga0098043_1226290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300010318|Ga0136656_1157218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300011011|Ga0139556_1004821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1976 | Open in IMG/M |
| 3300012920|Ga0160423_10289428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
| 3300012920|Ga0160423_10755750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300012936|Ga0163109_10369242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10009599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11980 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10094902 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300017713|Ga0181391_1033379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300017719|Ga0181390_1017625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2380 | Open in IMG/M |
| 3300017721|Ga0181373_1075007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300017728|Ga0181419_1151119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300017731|Ga0181416_1090037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300017738|Ga0181428_1089860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300017743|Ga0181402_1077809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300017743|Ga0181402_1097620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300017752|Ga0181400_1210028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300017753|Ga0181407_1072347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300017753|Ga0181407_1142800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300017758|Ga0181409_1094230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300017760|Ga0181408_1060411 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300017764|Ga0181385_1196318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300017766|Ga0181343_1207018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300017768|Ga0187220_1013520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2460 | Open in IMG/M |
| 3300017770|Ga0187217_1317352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300017773|Ga0181386_1089401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300017774|Ga0181358_1038922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1833 | Open in IMG/M |
| 3300017777|Ga0181357_1009592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3858 | Open in IMG/M |
| 3300017777|Ga0181357_1025446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2347 | Open in IMG/M |
| 3300017778|Ga0181349_1041044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1834 | Open in IMG/M |
| 3300017780|Ga0181346_1019457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2856 | Open in IMG/M |
| 3300017780|Ga0181346_1032130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2172 | Open in IMG/M |
| 3300017780|Ga0181346_1039504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1934 | Open in IMG/M |
| 3300017780|Ga0181346_1269634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300017784|Ga0181348_1024695 | All Organisms → Viruses → Predicted Viral | 2550 | Open in IMG/M |
| 3300017785|Ga0181355_1345675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300018424|Ga0181591_10750082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300020187|Ga0206130_10220591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300020347|Ga0211504_1077272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300020400|Ga0211636_10405465 | Not Available | 509 | Open in IMG/M |
| 3300021957|Ga0222717_10461291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300021958|Ga0222718_10001960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19014 | Open in IMG/M |
| 3300021959|Ga0222716_10602967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300021962|Ga0222713_10442431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300021964|Ga0222719_10015147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6262 | Open in IMG/M |
| 3300022179|Ga0181353_1155443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300022190|Ga0181354_1179609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300024316|Ga0228654_1036271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300024346|Ga0244775_10956276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300025086|Ga0208157_1141213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300025108|Ga0208793_1124675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300025110|Ga0208158_1159271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300025112|Ga0209349_1079700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300025127|Ga0209348_1030718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1930 | Open in IMG/M |
| 3300025131|Ga0209128_1081427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300025151|Ga0209645_1142189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300025647|Ga0208160_1035685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
| 3300025751|Ga0208150_1058276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
| 3300025759|Ga0208899_1096141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300025771|Ga0208427_1213205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300025806|Ga0208545_1168317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300025815|Ga0208785_1156381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300025828|Ga0208547_1160681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300025840|Ga0208917_1091295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300025853|Ga0208645_1218851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300025889|Ga0208644_1018609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4444 | Open in IMG/M |
| 3300025892|Ga0209630_10394704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300026138|Ga0209951_1054117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300027631|Ga0208133_1021728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1653 | Open in IMG/M |
| 3300027631|Ga0208133_1120070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027659|Ga0208975_1180033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300027899|Ga0209668_10189937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1272 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1233929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300028111|Ga0233397_1015075 | All Organisms → Viruses → Predicted Viral | 2739 | Open in IMG/M |
| 3300031758|Ga0315907_10025401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5416 | Open in IMG/M |
| 3300031784|Ga0315899_10735067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300031784|Ga0315899_11086746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300031787|Ga0315900_10008749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12970 | Open in IMG/M |
| 3300031787|Ga0315900_10503138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300031951|Ga0315904_10750360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300031963|Ga0315901_11033374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300034102|Ga0335029_0180485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
| 3300034106|Ga0335036_0500300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300034375|Ga0348336_136919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.19% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.91% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.12% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.56% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.56% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.56% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.56% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.78% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024316 | Seawater microbial communities from Monterey Bay, California, United States - 66D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028111 | Seawater microbial communities from Monterey Bay, California, United States - 35D | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101380321 | 3300000116 | Marine | SLDAEHISAVANLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKNDGFSQILHV* |
| B570J14230_101378762 | 3300001282 | Freshwater | VVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT* |
| JGI24006J15134_100555011 | 3300001450 | Marine | LFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKPNGYSQILHV* |
| JGI24006J15134_101839542 | 3300001450 | Marine | EYFRTKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQIQHV* |
| JGI24004J15324_101349691 | 3300001472 | Marine | FSIIISHVESMRDMVDNLIEVNKIKNFSHIQHV*YL* |
| M2t2BS2_101291772 | 3300002144 | Marine | LRVKFDFSIIISHVDTMRDMVDNLIEVNKIDGYSYINHK* |
| M2t2BS2_109724611 | 3300002144 | Marine | DYFRTKFDFSIIISHVDTMRDMVDNLIEVNKINGYSQILHI* |
| JGI25133J35611_100116693 | 3300002514 | Marine | INLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKINNYSQINHT* |
| JGI25133J35611_100216822 | 3300002514 | Marine | FEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKIDNYSQINHV* |
| JGI25133J35611_100893572 | 3300002514 | Marine | INLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKIDNYSQINHV* |
| JGI25908J49247_100470911 | 3300003277 | Freshwater Lake | NLFDYFRNKFDFSIIISHVDTMRDMVDNLIEVNKINGFSQICHT* |
| Ga0049081_102932231 | 3300005581 | Freshwater Lentic | ISSVVNLFEYFKTKFDFSIIISHVDSMRDMVDNLIEVNKLNGYSQIHHT* |
| Ga0075474_100540021 | 3300006025 | Aqueous | SLDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV* |
| Ga0075474_100850072 | 3300006025 | Aqueous | DAEHISSVVNLFEYLRTKFDFSIIISHVDSMRDMVDNLLEVNKINKFSQINHV* |
| Ga0070744_100590702 | 3300006484 | Estuarine | AEHISAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT* |
| Ga0070744_100779411 | 3300006484 | Estuarine | VTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIDNFSQIIHT* |
| Ga0098038_12820361 | 3300006735 | Marine | SLDQEHIASVVNLFEYFRTKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQIYHT* |
| Ga0098038_12877471 | 3300006735 | Marine | KFDFSIIISHVESMRDMVDNLIDVNKIDNFSHIVHT* |
| Ga0098037_10283581 | 3300006737 | Marine | HIASVINLFEYFRTKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQINHT* |
| Ga0098037_10958382 | 3300006737 | Marine | RTKFDFSIIISHVESMRDMVDNLIEVNKIENFSQILHT* |
| Ga0098037_11433281 | 3300006737 | Marine | TKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQINHT* |
| Ga0098055_10080661 | 3300006793 | Marine | LDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV* |
| Ga0075476_102957101 | 3300006867 | Aqueous | FEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKTQGFSQISHV* |
| Ga0070750_100348732 | 3300006916 | Aqueous | SEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT* |
| Ga0070750_101585372 | 3300006916 | Aqueous | FRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT* |
| Ga0070750_104440852 | 3300006916 | Aqueous | LDSEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSHIYM* |
| Ga0098041_12916061 | 3300006928 | Marine | YFRTKFDFSIIISHVDTMRDMVDNLIEVNKPNGYSQILHI* |
| Ga0075468_101384452 | 3300007229 | Aqueous | TKFDFSIIISHVESMRDMVDNLIEVNKIDNFSQIIHT* |
| Ga0070745_12874692 | 3300007344 | Aqueous | VNLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKTQGFSQISHV* |
| Ga0099851_11166841 | 3300007538 | Aqueous | SEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSHIYM* |
| Ga0099851_11667081 | 3300007538 | Aqueous | LFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKTAGYSQICHV* |
| Ga0099848_11483351 | 3300007541 | Aqueous | ISAVVNLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKTAGYSQICHV* |
| Ga0102828_11594262 | 3300007559 | Estuarine | DAEHISAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT* |
| Ga0102823_11480162 | 3300007692 | Estuarine | DHISAVVNLFDYFRIKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQISHN* |
| Ga0114346_10145671 | 3300008113 | Freshwater, Plankton | FRTKFDFSIIISHVDSMRDMVDNLIEVNKQNGYSQINHT* |
| Ga0114346_12141361 | 3300008113 | Freshwater, Plankton | FRTKFDFSIIISHVDSMRDMVDNLIEVNKQNGYSQINHS* |
| Ga0114363_11059241 | 3300008266 | Freshwater, Plankton | FDFSIIISHVDTMRDMVDNLLEVNKINGFSEIRHT* |
| Ga0114364_10397412 | 3300008267 | Freshwater, Plankton | AEHISAVVNLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKINGFSQILHN* |
| Ga0102957_11262502 | 3300009027 | Pond Water | FEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT* |
| Ga0105090_104846621 | 3300009075 | Freshwater Sediment | LDSEHISSVVNLFDYFRTKFDFSTIISHVESMRDMVDSLINVDKNNGFSQINHV* |
| Ga0105096_100459842 | 3300009170 | Freshwater Sediment | LVFNLFDYFRTKCDFLIIISHVESMRDMVDSLINVDKNNGFSQINHV* |
| Ga0114969_106199842 | 3300009181 | Freshwater Lake | NLFDYFRNKFDFSIIISHVDTMRDMVDNLIEVNKINGFSQILHN* |
| Ga0115546_11448542 | 3300009435 | Pelagic Marine | SKFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT* |
| Ga0115558_13057052 | 3300009449 | Pelagic Marine | FDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT* |
| Ga0098043_12262901 | 3300010148 | Marine | LFEYFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHT* |
| Ga0136656_11572182 | 3300010318 | Freshwater To Marine Saline Gradient | GSLDSEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT* |
| Ga0139556_10048211 | 3300011011 | Freshwater | GSLDAEHISAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT* |
| Ga0160423_102894282 | 3300012920 | Surface Seawater | LFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIKNFSQILHT* |
| Ga0160423_107557502 | 3300012920 | Surface Seawater | YFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV* |
| Ga0163109_103692421 | 3300012936 | Surface Seawater | NLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV* |
| (restricted) Ga0172373_1000959910 | 3300013131 | Freshwater | FDYFRNKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQISQA* |
| (restricted) Ga0172373_100949021 | 3300013131 | Freshwater | FDYFRNKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQISHS* |
| Ga0181391_10333792 | 3300017713 | Seawater | EYFRTKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQINHT |
| Ga0181390_10176251 | 3300017719 | Seawater | QEHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHVXYL |
| Ga0181373_10750072 | 3300017721 | Marine | NLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV |
| Ga0181419_11511191 | 3300017728 | Seawater | SVTNLFEYFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT |
| Ga0181416_10900371 | 3300017731 | Seawater | YFRTKFDFSIIISHVESMRDMVDNLIEVNKIKNFSQILHT |
| Ga0181428_10898602 | 3300017738 | Seawater | VSNLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKPNGYSQILHV |
| Ga0181402_10778092 | 3300017743 | Seawater | WGSLDQEHIASVINLFEYFRTKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQINHT |
| Ga0181402_10976201 | 3300017743 | Seawater | ISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIKNFSQILHT |
| Ga0181400_12100282 | 3300017752 | Seawater | RTKFDFSIIISHVDTMRDMVDNLVEVNKTNGYSQILHV |
| Ga0181407_10723472 | 3300017753 | Seawater | GWGSLDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV |
| Ga0181407_11428001 | 3300017753 | Seawater | TKFDFSIIISHVESMRDMVDNLIEVNKIENFSQILHT |
| Ga0181409_10942302 | 3300017758 | Seawater | DEGWGSLDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIKNFSQILHT |
| Ga0181408_10604111 | 3300017760 | Seawater | WGSLDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV |
| Ga0181385_11963181 | 3300017764 | Seawater | SLDAEHISAVSNLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKIENFSQIQHT |
| Ga0181343_12070182 | 3300017766 | Freshwater Lake | FDFCIIISHVDSMRDMVDNLIEVNKINGYSQISHT |
| Ga0187220_10135202 | 3300017768 | Seawater | RTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHVXYL |
| Ga0187217_13173522 | 3300017770 | Seawater | LDAEHISAVSNLFDYFRTKFDFSIIISHVDTMRDMVDNLVEVNKTNGYSQILHV |
| Ga0181386_10894012 | 3300017773 | Seawater | AVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSQILHT |
| Ga0181358_10389222 | 3300017774 | Freshwater Lake | FDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQIQHIXYLY |
| Ga0181357_10095921 | 3300017777 | Freshwater Lake | AVVNLFDYFRNKFDFSIIISHVDTMRDMVDNLIEVNKINGFSQISHN |
| Ga0181357_10254462 | 3300017777 | Freshwater Lake | FEYFRNKFDFSIIISHVDSMRDMVDTLIEVNKINKFSHILHT |
| Ga0181349_10410441 | 3300017778 | Freshwater Lake | EHISAVVNLFEYFKTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSCINHS |
| Ga0181346_10194571 | 3300017780 | Freshwater Lake | WGSLDAEHISAVVNLFDYFRNKFDFSIIISHVDTMRDMVDNLIEVNKIQGFSQICHT |
| Ga0181346_10321301 | 3300017780 | Freshwater Lake | VNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHTXYLYKKTSYVSA |
| Ga0181346_10395041 | 3300017780 | Freshwater Lake | YFKNKFDFSIIISHVDSMRDMVDTLIEVNKINKFSHISHT |
| Ga0181346_12696341 | 3300017780 | Freshwater Lake | KFDFCIIISHVDTMRDMVDNLIEVNKINKFSQICHS |
| Ga0181348_10246951 | 3300017784 | Freshwater Lake | SAVVNLFDYFRNKFDFSIIISHVDTMRDMVDNLIEVNKINGLSQISHS |
| Ga0181355_13456751 | 3300017785 | Freshwater Lake | AEHISAVVNLFEYFKTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSCINHS |
| Ga0181591_107500821 | 3300018424 | Salt Marsh | VINLFEYLRTKFDFSIIISHVDSMRDMVDNLLEVNKIEGFSHILHT |
| Ga0206130_102205911 | 3300020187 | Seawater | WGSLDREHISSVTNLFEYFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT |
| Ga0211504_10772722 | 3300020347 | Marine | NLFDYFRNKFEFCVIISHVDTMRDMVDSLIEVNKIDNFSHISKT |
| Ga0211636_104054652 | 3300020400 | Marine | YFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHT |
| Ga0222717_104612912 | 3300021957 | Estuarine Water | DQEHISSVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIKNFSHIQHV |
| Ga0222718_100019601 | 3300021958 | Estuarine Water | AAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0222716_106029672 | 3300021959 | Estuarine Water | VNLFEYLRTKFDFSIIISHVDSMRDMVDNLLEVNKIDKFSQIIHA |
| Ga0222713_104424312 | 3300021962 | Estuarine Water | GSLDSEHISSVVNLFDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKTNGYSQILHS |
| Ga0222719_100151474 | 3300021964 | Estuarine Water | VINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0181353_11554431 | 3300022179 | Freshwater Lake | SAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQIIHS |
| Ga0181354_11796091 | 3300022190 | Freshwater Lake | AEHIASVVNLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKIDKFSQICHT |
| Ga0228654_10362711 | 3300024316 | Seawater | EYFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT |
| Ga0244775_109562762 | 3300024346 | Estuarine | DAEHISAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT |
| Ga0208157_11412132 | 3300025086 | Marine | TKFDFCIIISHVDTMRDMVDNLIEVNKINNYSQINHT |
| Ga0208793_11246752 | 3300025108 | Marine | LDREHISAVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIENFSHIQHV |
| Ga0208158_11592712 | 3300025110 | Marine | YFRTKFDFSIIISHVDTMRDMVDNLIEVNKPNGYSQILHI |
| Ga0209349_10797002 | 3300025112 | Marine | IASVINLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKIDNYSQINHV |
| Ga0209348_10307181 | 3300025127 | Marine | FDFSIIISHVESMRDMVDNLIEVNKINNFSQIQHT |
| Ga0209128_10814271 | 3300025131 | Marine | AVINLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKINNYSQINHT |
| Ga0209645_11421891 | 3300025151 | Marine | NLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKPNGYSQILHI |
| Ga0208160_10356852 | 3300025647 | Aqueous | SLDAEHISAVVNLFEYFRTKFDFSIIISHVDTMRDMVDNLIEVNKTAGYSQICHV |
| Ga0208150_10582761 | 3300025751 | Aqueous | FSIIISHVESMRDMVDNLIEVNKIENFSHIQHVXYL |
| Ga0208899_10961412 | 3300025759 | Aqueous | DSEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0208427_12132051 | 3300025771 | Aqueous | LFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0208545_11683172 | 3300025806 | Aqueous | FEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIDNFSQIIHT |
| Ga0208785_11563811 | 3300025815 | Aqueous | AEHISSVVNLFEYLRTKFDFSIIISHVDSMRDMVDNLLEVNKINKFSQINHV |
| Ga0208547_11606811 | 3300025828 | Aqueous | GWGSLDAEHISAVANLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKNNGYSQILHV |
| Ga0208917_10912951 | 3300025840 | Aqueous | GWGSLDSEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0208645_12188511 | 3300025853 | Aqueous | HIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0208644_10186091 | 3300025889 | Aqueous | SLDSEHIAAVINLFEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0209630_103947041 | 3300025892 | Pelagic Marine | DEGWGSLDREHISSVTNLFEYFRSKFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT |
| Ga0209951_10541171 | 3300026138 | Pond Water | NKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| Ga0208133_10217284 | 3300027631 | Estuarine | AEHISAVVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGYSKILHT |
| Ga0208133_11200702 | 3300027631 | Estuarine | EHISSVTNLFEYFRTKFDFSIIISHVESMRDMVDNLIEVNKIDNFSQIIHT |
| Ga0208975_11800332 | 3300027659 | Freshwater Lentic | AEHISSVVNLFEYFKTKFDFSIIISHVDSMRDMVDNLIEVNKLNGYSQIHHT |
| Ga0209668_101899372 | 3300027899 | Freshwater Lake Sediment | VNLFDYFRTKFDFSIIISHVDTMRDMVDNLIEVNKINNFSCIQHN |
| (restricted) Ga0247838_12339291 | 3300028044 | Freshwater | FDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKIDGYSKINHV |
| Ga0233397_10150752 | 3300028111 | Seawater | KFDFSIIISHVESMRDMVDNLIEVNKIENFSQIIHT |
| Ga0315907_100254014 | 3300031758 | Freshwater | TKFDFSIIISHVDSMRDMVDNLIEVNKQNGYSQINHS |
| Ga0315899_107350671 | 3300031784 | Freshwater | FDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKQNGYSQINHS |
| Ga0315899_110867462 | 3300031784 | Freshwater | GWGSLDSEHISAVVNLFDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQIHHM |
| Ga0315900_1000874911 | 3300031787 | Freshwater | AVVNLFDYFRIKFDFSVIISHVDSMRDMVDNLIEVNKIAGYSQIQHN |
| Ga0315900_105031383 | 3300031787 | Freshwater | LFDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKQNGYSQINHS |
| Ga0315904_107503602 | 3300031951 | Freshwater | WGSLDSEHISAVVNLFDYFRTKFDFSIIISHVDSMRDMVDNLIEVNKINGFSQIHHM |
| Ga0315901_110333741 | 3300031963 | Freshwater | FDFSIIISHVDSMRDMVDNLIEVNKINGYSQICHN |
| Ga0335029_0180485_1306_1419 | 3300034102 | Freshwater | TKFDFSIIISHVDSMRDMVDNLIEVNKTQGYSKINHA |
| Ga0335036_0500300_617_757 | 3300034106 | Freshwater | VVNLFEYFRTKFDFSIIISHVDSMRDMVDNLIEVNKTQGYSKINHA |
| Ga0348336_136919_624_752 | 3300034375 | Aqueous | FEYFRNKFDFSIIISHVDSMRDMVDKLLEVNKQNGFSQIQNT |
| ⦗Top⦘ |