NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064705

Metagenome / Metatranscriptome Family F064705

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064705
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 46 residues
Representative Sequence MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY
Number of Associated Samples 121
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.25 %
% of genes near scaffold ends (potentially truncated) 41.41 %
% of genes from short scaffolds (< 2000 bps) 92.97 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.656 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.062 % of family members)
Environment Ontology (ENVO) Unclassified
(39.844 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.781 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 36.17%    β-sheet: 0.00%    Coil/Unstructured: 63.83%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00440TetR_N 59.38
PF04055Radical_SAM 20.31
PF00106adh_short 1.56
PF07336ABATE 1.56
PF13561adh_short_C2 0.78
PF01694Rhomboid 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 1.56
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.66 %
UnclassifiedrootN/A2.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1213254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
2166559006|FI_contig04002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec1630Open in IMG/M
2170459016|G1P06HT01DFAZBNot Available607Open in IMG/M
2170459017|G14TP7Y01BEO4KAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales583Open in IMG/M
2189573002|GZIGXIF02I6SA9All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
2189573002|GZIGXIF02JZFP5All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
2199352025|deepsgr__Contig_162845Not Available681Open in IMG/M
3300003659|JGI25404J52841_10014789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec1694Open in IMG/M
3300004114|Ga0062593_101755863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300004803|Ga0058862_12677421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales538Open in IMG/M
3300005103|Ga0066813_1016934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300005158|Ga0066816_1027701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300005162|Ga0066814_10022952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300005169|Ga0066810_10017405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1155Open in IMG/M
3300005175|Ga0066673_10282321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300005175|Ga0066673_10586178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300005177|Ga0066690_10335836All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300005186|Ga0066676_10357778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300005327|Ga0070658_10174744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1806Open in IMG/M
3300005330|Ga0070690_101669233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300005332|Ga0066388_100574852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1753Open in IMG/M
3300005336|Ga0070680_100834345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300005337|Ga0070682_100192007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1434Open in IMG/M
3300005344|Ga0070661_100081282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2392Open in IMG/M
3300005356|Ga0070674_101443585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae617Open in IMG/M
3300005367|Ga0070667_100714319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300005434|Ga0070709_10626736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300005445|Ga0070708_100227357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1750Open in IMG/M
3300005451|Ga0066681_10923626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300005558|Ga0066698_10878685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005566|Ga0066693_10055235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1338Open in IMG/M
3300005577|Ga0068857_100676221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300005578|Ga0068854_102224159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300005617|Ga0068859_100270217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1792Open in IMG/M
3300006572|Ga0074051_11597219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300006573|Ga0074055_11228481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300006575|Ga0074053_10012967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia798Open in IMG/M
3300006579|Ga0074054_12025044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300006581|Ga0074048_13170598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300006755|Ga0079222_12396796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006791|Ga0066653_10265138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300006804|Ga0079221_11002005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300006871|Ga0075434_100538559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300006881|Ga0068865_100468468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300009162|Ga0075423_10770565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300010046|Ga0126384_10276949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1369Open in IMG/M
3300010152|Ga0126318_10560713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300010152|Ga0126318_10949918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1327Open in IMG/M
3300010323|Ga0134086_10502271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300010326|Ga0134065_10075369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300010335|Ga0134063_10744691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300010375|Ga0105239_10922177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300010376|Ga0126381_104931711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300010396|Ga0134126_11238346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300010396|Ga0134126_11391754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300010397|Ga0134124_11945012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300010401|Ga0134121_12609858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300010403|Ga0134123_10245530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1554Open in IMG/M
3300012200|Ga0137382_10286841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1146Open in IMG/M
3300012201|Ga0137365_10027065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis4421Open in IMG/M
3300012206|Ga0137380_10316868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1395Open in IMG/M
3300012285|Ga0137370_10698591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300012353|Ga0137367_10049682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3161Open in IMG/M
3300012355|Ga0137369_10940192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300012358|Ga0137368_10390250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300012360|Ga0137375_10314858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1408Open in IMG/M
3300012380|Ga0134047_1145024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.522Open in IMG/M
3300012488|Ga0157343_1002143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300012507|Ga0157342_1002403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1517Open in IMG/M
3300012532|Ga0137373_10043630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae4228Open in IMG/M
3300012915|Ga0157302_10328248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300012976|Ga0134076_10538636Not Available538Open in IMG/M
3300012977|Ga0134087_10182706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis930Open in IMG/M
3300012986|Ga0164304_10701738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300012987|Ga0164307_10574540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300014326|Ga0157380_10039931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3652Open in IMG/M
3300015200|Ga0173480_11104754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300015264|Ga0137403_10098601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2931Open in IMG/M
3300015371|Ga0132258_11318614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1824Open in IMG/M
3300015371|Ga0132258_11319642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1823Open in IMG/M
3300015373|Ga0132257_101089907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300018431|Ga0066655_10147042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300019361|Ga0173482_10129300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300019883|Ga0193725_1131978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300019885|Ga0193747_1024287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1499Open in IMG/M
3300020001|Ga0193731_1168307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300020062|Ga0193724_1069230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis738Open in IMG/M
3300020070|Ga0206356_10416711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1287Open in IMG/M
3300020080|Ga0206350_11551260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300020082|Ga0206353_11468737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300020140|Ga0179590_1165821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300020583|Ga0210401_10446119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1157Open in IMG/M
3300021403|Ga0210397_10312649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1156Open in IMG/M
3300021445|Ga0182009_10299124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300021475|Ga0210392_10541461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec860Open in IMG/M
3300022504|Ga0242642_1039797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300024178|Ga0247694_1009472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1185Open in IMG/M
3300024232|Ga0247664_1114973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300024249|Ga0247676_1012403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300025885|Ga0207653_10140853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia882Open in IMG/M
3300025904|Ga0207647_10130556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1477Open in IMG/M
3300025906|Ga0207699_10098851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1847Open in IMG/M
3300025907|Ga0207645_10150690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1518Open in IMG/M
3300025908|Ga0207643_10124577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1529Open in IMG/M
3300025916|Ga0207663_11143392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300025920|Ga0207649_10293272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300025932|Ga0207690_10299291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1258Open in IMG/M
3300025935|Ga0207709_10701733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300026088|Ga0207641_10330945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1447Open in IMG/M
3300027058|Ga0209111_1010741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1002Open in IMG/M
3300027725|Ga0209178_1079280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1078Open in IMG/M
3300027725|Ga0209178_1119933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300027787|Ga0209074_10057865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300027787|Ga0209074_10319993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia627Open in IMG/M
3300028711|Ga0307293_10168279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300028715|Ga0307313_10064392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1089Open in IMG/M
3300028768|Ga0307280_10011819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2388Open in IMG/M
3300028872|Ga0307314_10209300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031170|Ga0307498_10059100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1066Open in IMG/M
3300031184|Ga0307499_10176709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300031198|Ga0307500_10109792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300031226|Ga0307497_10092349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae1163Open in IMG/M
3300031716|Ga0310813_10681828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300031996|Ga0308176_10107542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2465Open in IMG/M
3300032074|Ga0308173_10850499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300032205|Ga0307472_101114516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300032770|Ga0335085_10088250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4047Open in IMG/M
3300032898|Ga0335072_11212761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.34%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.56%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005103Soil and rhizosphere microbial communities from Laval, Canada - mgLAAEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012380Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_025324302124908045SoilMSERVAIADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCG
FI_000732002166559006Grass SoilMSERVATADVIEVPAAEPELAQSELNELAEAELLVEEVSIDGMCGVY
2ZMR_022142302170459016Switchgrass, Maize And Mischanthus LitterVHERTRRDRDVIEAPVEEPELAEAELLVEEVSIDGMCGVY
4ZMR_050398302170459017Switchgrass, Maize And Mischanthus LitterMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY
FE1_002947202189573002Grass SoilTADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY
FE1_071925802189573002Grass SoilMSERVAIADVIEVPAAEPGLAQSELTETGLAEAELLVEEVSIDGMCGVY
deepsgr_027137502199352025SoilMSERVAIADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY
JGI25404J52841_1001478933300003659Tabebuia Heterophylla RhizosphereMSERVATADVIEVPAAEPGLAQSELTGLTELTEAELLVEEVSIDGMCGVY*
Ga0062593_10175586323300004114SoilMSERVATADVIEVPAAEPGLAQGELSELAEAELLVEEVSIDGMCG
Ga0058862_1267742123300004803Host-AssociatedMSERVATADVIEVPAAQPGLAQSELTDLAEAELLVEEVSIDGMCGVY*
Ga0066813_101693413300005103SoilMSERVATADVIEVPAAEPGLAQSELAETELAEAELAEAELLVEEVSIDG
Ga0066816_102770113300005158SoilMSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY*
Ga0066814_1002295223300005162SoilMSERVATADVIEVPAAEPGLAQSELAETELAETELAEAELAEAELLVEEVSIDGMCGVY*
Ga0066810_1001740523300005169SoilMSERVATADVIEVPAAEPGLAQSEATETELAGTELAEAELLVEEVSIDGMCGVY*
Ga0066673_1028232143300005175SoilADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY*
Ga0066673_1058617823300005175SoilMSERVATADVIEVPAAEPELVQGELTELAEAELLVEEVSIDG
Ga0066690_1033583623300005177SoilMSERVATADVIEVPAAEPGLAQSELTETELTETELTETELTETELTEAELLVEEVSIDG
Ga0066676_1035777813300005186SoilMSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMC
Ga0070658_1017474433300005327Corn RhizosphereMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY*
Ga0070690_10166923323300005330Switchgrass RhizosphereMSERVATADVIEVPGAEPGMTQGELTDLAEAELLVEEVSIDGMCGVY*
Ga0066388_10057485223300005332Tropical Forest SoilMSERVATADVIEVPAAEPELAQGELTELAEAELLVEEVSIDGMCGVY*
Ga0070680_10083434523300005336Corn RhizosphereMSERVAIADVIEVPAPEPGPAQSKLTETELAEAELLVEEV
Ga0070682_10019200733300005337Corn RhizosphereMSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY*
Ga0070661_10008128223300005344Corn RhizosphereMSERVAIADVIEVPAAEPGPAQSDPTDLAEAELLVEEVSIDGMCGVY*
Ga0070674_10144358523300005356Miscanthus RhizosphereMSERVATADVIEVPAAEPGLAQSDLTDLAEAELLVEEVSIDGMCGVY*
Ga0070667_10071431913300005367Switchgrass RhizosphereMSERVAIADVIEVPAPEPGPAQSELTETELAEAELLVEEVSI
Ga0070709_1062673623300005434Corn, Switchgrass And Miscanthus RhizosphereMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY*
Ga0070708_10022735723300005445Corn, Switchgrass And Miscanthus RhizosphereMSERVATADVIEVPAAEPGLARSELTETELAEAELLVEEVSIDGMCGVY*
Ga0066681_1092362623300005451SoilMSERVATADVIEVPAAEPELTRSELTQTELAEAELLVEEVSIDGMCGVY*
Ga0066698_1087868523300005558SoilMSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY*
Ga0066693_1005523523300005566SoilMSERVAIADVIEVPPAEPELTQGEPAELAEAELLVEEVSIDGMCGVY*
Ga0068857_10067622133300005577Corn RhizosphereMSERAATVDVIEAPEEEPELAEAELLVEEVSIDGMCGVY*
Ga0068854_10222415923300005578Corn RhizosphereMSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEE
Ga0068859_10027021733300005617Switchgrass RhizosphereMSERVATADVIEVPAAEPGLTQGELTELAEAELLVEEVSIDGMCGVY*
Ga0074051_1159721913300006572SoilMSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEE
Ga0074055_1122848123300006573SoilMSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY*
Ga0074053_1001296723300006575SoilMSERVATADVIEVPAAEPGLAQSELPGTELAEAELLVEEVSIDGMCGVY*
Ga0074054_1202504423300006579SoilMSERVATADVIEVPAAEPGLAQSELTETELAEAELAEAELLVEEVSIDGMCGVY*
Ga0074048_1317059813300006581SoilMSERVATADVIEVPAAEPGLAQSELTETELAEAELL
Ga0079222_1239679613300006755Agricultural SoilEESVMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY*
Ga0066653_1026513823300006791SoilMSERVAIADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY*
Ga0079221_1100200523300006804Agricultural SoilMSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY*
Ga0075434_10053855923300006871Populus RhizosphereMSERVATADVIEVPAAEPGLTQGELAELAEAELLVEEVSIDGMCGVY*
Ga0068865_10046846813300006881Miscanthus RhizosphereMSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSI
Ga0075423_1077056523300009162Populus RhizosphereMSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGM
Ga0126384_1027694933300010046Tropical Forest SoilMSERVATADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY*
Ga0126318_1056071333300010152SoilEPGLAQGELAGTELAGTELAEAELLVEEVSIDGMCGVY*
Ga0126318_1094991813300010152SoilIEVPAAGPELTQGELAELAEAELLVEEVSIDGMCGVY*
Ga0134086_1050227133300010323Grasslands SoilVIEVPAAEPELAQSELTDSELAEAELLVEEVSIDGMCGVY*
Ga0134065_1007536923300010326Grasslands SoilMSERVAIADVIEVPAAEPELAQSELTELAEAELLVE
Ga0134063_1074469113300010335Grasslands SoilVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY*
Ga0105239_1092217733300010375Corn RhizosphereDVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY*
Ga0126381_10493171133300010376Tropical Forest SoilTVDVIEAPALEGAVEEPELAEAELLVEEVSIDGMCGVY*
Ga0134126_1123834623300010396Terrestrial SoilMSERAATVDVIEAPAEEPELAEAELLVEEVSIDGMCGVY*
Ga0134126_1139175433300010396Terrestrial SoilMSERVATADVIEVPAAEPELAQGELAELAEAELLVEEVSIDGMCGVY*
Ga0134124_1194501223300010397Terrestrial SoilMSERVATADVIEVPGAEPGLAQGELTDLAEAELLVEEVSIDGMCGVY*
Ga0134121_1260985833300010401Terrestrial SoilCAARESAMSERVATADIIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY*
Ga0134123_1024553023300010403Terrestrial SoilMSERVATADVIEVPTAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY*
Ga0137382_1028684133300012200Vadose Zone SoilMSERVATADVIEVPAADPELARSELTQTELAEAGLLVEEVSIDGMCGVY*
Ga0137365_1002706563300012201Vadose Zone SoilMSERVAIADVIEVPAAEPGLAQSELTETELAETELAEAELLVEEVSIDGMCGVY*
Ga0137380_1031686833300012206Vadose Zone SoilMSERVAIADVIEVPVAEPGLAQSELTETELAETELAEAELLVEEVSIDGMCGVY*
Ga0137370_1069859123300012285Vadose Zone SoilMSERVAIAEVIEVPAAEPELTQGEPAELAEAELLVEEVSIDGMCGVY*
Ga0137367_1004968233300012353Vadose Zone SoilMSERVAIADVIEVPAAEPGLAQSKLTETELAETELAETELAEAELLVEEVSIDGMCGVY*
Ga0137369_1094019213300012355Vadose Zone SoilMSERVATADVIEVPAAEPGLAQSKLTETELAETELAETELAEAELLVEEVSIDGMCG
Ga0137368_1039025013300012358Vadose Zone SoilMSERVAIADVIEVPAAEPELAQSGLTDSELAEAELLVEEVSIDGMCGVY*
Ga0137375_1031485823300012360Vadose Zone SoilMSERVAIADVIEVPAAEPGLAQSELTETELAETELAETELAEAELLVEEVSIDGMCGVY*
Ga0134047_114502413300012380Grasslands SoilATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY*
Ga0157343_100214333300012488Arabidopsis RhizosphereMSERVATADVIEVPAAEPEMTQGELTDLAEAELLVEEVSIDGMCGVY*
Ga0157342_100240333300012507Arabidopsis RhizosphereMSERVATADVIEVPAAEPGLAQSELSELAEAELLVEEVSIDGMCGVY*
Ga0137373_1004363063300012532Vadose Zone SoilMSERVAIADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY*
Ga0157302_1032824823300012915SoilMSERVATADVIEVPAAEPGVAQGELTELAEAELLVEEVSIDGMCGVY*
Ga0134076_1053863613300012976Grasslands SoilMSERVAIADVIEVPAAEPELAQSELTDSELAEAELLVEEVSIDGMC
Ga0134087_1018270633300012977Grasslands SoilESVMSERVATADVIEVPAAEPGLAQSELTETELTEAELLVEEVSIDGMCGVY*
Ga0164304_1070173823300012986SoilMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDG
Ga0164307_1057454023300012987SoilMSARAATVDVIEAPVEEPELAEAELLVEEVSIDGMCGVY*
Ga0157380_1003993153300014326Switchgrass RhizosphereMSERVATADVIEVPASEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY*
Ga0173480_1110475413300015200SoilMSERVATADVIEVPGAEPGMTQGELTDLAEAEVLVEEVSIDGMCGVY*
Ga0137403_1009860113300015264Vadose Zone SoilRVATADVIEVPAAEPELTRSELTQTELAEAELLVEEVSIDGMCGVY*
Ga0132258_1131861423300015371Arabidopsis RhizosphereMSERVAIADVIEVPAAEPELAPGELDELAEAELLVEEVSIDGMCGVY*
Ga0132258_1131964213300015371Arabidopsis RhizosphereMSERAATVDVIEIPAEEPELADAELLVEEVSIDGMCGVY*
Ga0132257_10108990733300015373Arabidopsis RhizosphereVHVCAARESAMSERVAIADVIEVPAAEPELAPGELDELAEAELLVEEVSIDGMCGVY*
Ga0066655_1014704223300018431Grasslands SoilMSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY
Ga0173482_1012930023300019361SoilMSERVATADVIEVPAAEPGLAQGELSELAEAELLVEEVSIDGMCGVY
Ga0193725_113197823300019883SoilMSERVAIADVIEVPAPEPGLAQSELAETELAEAELLVEEVSIDGMCGVY
Ga0193747_102428723300019885SoilMSERVATAVITEVPAAEPELAQGRLGENELAEAELLVEEV
Ga0193731_116830713300020001SoilMSERVAIADVIEVPAPEPGLAQSELTETELAEAELLVEEVSIDGMCGVY
Ga0193724_106923023300020062SoilMSERVATADVIEVPAAEPELAQSGLNELAEAELLVEEVSIDGMCGVY
Ga0206356_1041671133300020070Corn, Switchgrass And Miscanthus RhizosphereMSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY
Ga0206350_1155126013300020080Corn, Switchgrass And Miscanthus RhizosphereVTKSYRRWARVGSEESVMSERAAIVDVIEAPVEEPELAEAELLVEEVSIDGMCGVY
Ga0206353_1146873723300020082Corn, Switchgrass And Miscanthus RhizosphereMSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSI
Ga0179590_116582113300020140Vadose Zone SoilMSERVATADVIEVPVAEPELTRSELTETGLAEAELLVEEVSIDGMCGVY
Ga0210401_1044611923300020583SoilMSERVAIAEITENQAPAVEPELAQDELAQDELAEAELLVEEVSIDGMCGVY
Ga0210397_1031264923300021403SoilMSERVATADVIEVPAAEPGLAPSDLTELAEAELLVEEVSIDGMCGVY
Ga0182009_1029912413300021445SoilMSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY
Ga0210392_1054146133300021475SoilMSERVATADVIEVPAAEPGLAQSDLTELAEAELLVEEVSIDGMCGVY
Ga0242642_103979733300022504SoilMSERVAIAEITENQAPAVEPELAQDELAQDELAEAELLVEEVSIDGMCGLY
Ga0247694_100947223300024178SoilMSERVATADVIEVPAAEPGMTQGELTDLAEAELLVEEVSIDGMCGVY
Ga0247664_111497313300024232SoilMSERVATADVIEVPAAEPELTQGELTELAEAELLV
Ga0247676_101240313300024249SoilMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSI
Ga0207653_1014085333300025885Corn, Switchgrass And Miscanthus RhizosphereRESAMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY
Ga0207647_1013055633300025904Corn RhizosphereMSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY
Ga0207699_1009885133300025906Corn, Switchgrass And Miscanthus RhizosphereMSERVATADIIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY
Ga0207645_1015069013300025907Miscanthus RhizosphereMSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCG
Ga0207643_1012457713300025908Miscanthus RhizosphereIIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY
Ga0207663_1114339223300025916Corn, Switchgrass And Miscanthus RhizosphereMSERVATADVIEVPAAEPELAQGELAELAEAELLVEEVS
Ga0207649_1029327233300025920Corn RhizosphereMSERVATADVIEVPAAEPGPAQSDPTDLAEAELLVEEVSIDGMCGVY
Ga0207690_1029929133300025932Corn RhizosphereAMSERVATADIIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY
Ga0207709_1070173333300025935Miscanthus RhizosphereVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY
Ga0207641_1033094533300026088Switchgrass RhizosphereMSERAATVDVIEVPVEEPELAEAELLVEEVSIEAMCGVYGGTDAGHAGRVRTLRP
Ga0209111_101074123300027058Forest SoilMSERVAIAEITENQAPAVEPELAQDELAEAELLVEEVSIDGMCGVY
Ga0209178_107928033300027725Agricultural SoilSEESVMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY
Ga0209178_111993313300027725Agricultural SoilMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSID
Ga0209074_1005786513300027787Agricultural SoilMSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY
Ga0209074_1031999313300027787Agricultural SoilCAARESAMSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY
Ga0307293_1016827923300028711SoilMSERVAIADVIEVPAPEPGLAQSELAETELAEAELLV
Ga0307313_1006439233300028715SoilVPAAEPELAQSELNELAEAELLVEEVSIDGMCGVY
Ga0307280_1001181943300028768SoilAPEPGLAQSELAETELAEAELLVEEVSIDGMCGVY
Ga0307314_1020930013300028872SoilMSERVATADVIEVPAAEPELAQSELNELAEAELLVEE
Ga0307498_1005910023300031170SoilMSERVATADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY
Ga0307499_1017670923300031184SoilMSERVATADVIEVPAAEPGLAQSELTEPELTEAELLVEEVSIDGMCGVY
Ga0307500_1010979213300031198SoilEVPAAEPGLAQCELTELAEAELLVEEVSIDGMCGVY
Ga0307497_1009234923300031226SoilMSERVAIADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY
Ga0310813_1068182823300031716SoilMSERVATADVIEVPATEPGVAQGELTELAEAELLVEEVSIDGMCGVY
Ga0308176_1010754213300031996SoilMSERVAIADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY
Ga0308173_1085049923300032074SoilMSERVAIADVIEVPAAEPELAQGELTELAEAELLVEEVSIDGMCGVY
Ga0307472_10111451613300032205Hardwood Forest SoilMSERVATLDITEATGAEAAEAELAETELAEAELAEAELLVEEVSID
Ga0335085_1008825013300032770SoilMSERVAIADVIEVPAAEPELAQSEPDELAEAELLVEEVSIDGMCGVY
Ga0335072_1121276123300032898SoilMSERVATADVIEVPAAEPELAETELLVEEVSIDGMCGVY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.