| Basic Information | |
|---|---|
| Family ID | F064610 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.60 % |
| % of genes near scaffold ends (potentially truncated) | 96.09 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.656 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.125 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.656 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00127 | Copper-bind | 39.84 |
| PF13478 | XdhC_C | 7.03 |
| PF13490 | zf-HC2 | 7.03 |
| PF02625 | XdhC_CoxI | 4.69 |
| PF13473 | Cupredoxin_1 | 4.69 |
| PF08281 | Sigma70_r4_2 | 2.34 |
| PF07883 | Cupin_2 | 0.78 |
| PF02627 | CMD | 0.78 |
| PF13561 | adh_short_C2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 4.69 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.78 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.66 % |
| Unclassified | root | N/A | 2.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10118442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 759 | Open in IMG/M |
| 3300002916|JGI25389J43894_1036896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 843 | Open in IMG/M |
| 3300005166|Ga0066674_10168536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1038 | Open in IMG/M |
| 3300005175|Ga0066673_10646358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300005179|Ga0066684_10836927 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005180|Ga0066685_10154100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1564 | Open in IMG/M |
| 3300005181|Ga0066678_10298685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1053 | Open in IMG/M |
| 3300005406|Ga0070703_10014900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2219 | Open in IMG/M |
| 3300005458|Ga0070681_10820887 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005518|Ga0070699_101954918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 536 | Open in IMG/M |
| 3300005536|Ga0070697_100096833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2448 | Open in IMG/M |
| 3300005536|Ga0070697_100387369 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005540|Ga0066697_10617523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 600 | Open in IMG/M |
| 3300005546|Ga0070696_100685678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 834 | Open in IMG/M |
| 3300005552|Ga0066701_10046759 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
| 3300005554|Ga0066661_10874398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300005555|Ga0066692_10163153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1375 | Open in IMG/M |
| 3300005555|Ga0066692_10485718 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005555|Ga0066692_10835103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300005557|Ga0066704_10201640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1345 | Open in IMG/M |
| 3300005559|Ga0066700_10106190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1848 | Open in IMG/M |
| 3300005569|Ga0066705_10446208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 811 | Open in IMG/M |
| 3300005574|Ga0066694_10017895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3097 | Open in IMG/M |
| 3300005574|Ga0066694_10054639 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300005586|Ga0066691_10057832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2095 | Open in IMG/M |
| 3300005587|Ga0066654_10433401 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300006031|Ga0066651_10224955 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 995 | Open in IMG/M |
| 3300006032|Ga0066696_10427415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 866 | Open in IMG/M |
| 3300006034|Ga0066656_11135764 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300006046|Ga0066652_100211622 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300006755|Ga0079222_11085663 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
| 3300006796|Ga0066665_10676335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300006797|Ga0066659_10320480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1191 | Open in IMG/M |
| 3300006797|Ga0066659_10360652 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300006852|Ga0075433_10920377 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300006871|Ga0075434_100242175 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300006880|Ga0075429_100365151 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300007255|Ga0099791_10379002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 680 | Open in IMG/M |
| 3300007255|Ga0099791_10647638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300007258|Ga0099793_10418831 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009012|Ga0066710_101820971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 918 | Open in IMG/M |
| 3300009012|Ga0066710_104194327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
| 3300009090|Ga0099827_10495838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1049 | Open in IMG/M |
| 3300009137|Ga0066709_100443013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1814 | Open in IMG/M |
| 3300010126|Ga0127482_1162912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
| 3300010304|Ga0134088_10170607 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1038 | Open in IMG/M |
| 3300010304|Ga0134088_10477158 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010323|Ga0134086_10029987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1786 | Open in IMG/M |
| 3300010329|Ga0134111_10233126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 751 | Open in IMG/M |
| 3300010333|Ga0134080_10062812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1478 | Open in IMG/M |
| 3300010336|Ga0134071_10302852 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010336|Ga0134071_10769750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300010360|Ga0126372_12771928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300011269|Ga0137392_10952017 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300011435|Ga0137426_1142584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 699 | Open in IMG/M |
| 3300011444|Ga0137463_1015580 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300012198|Ga0137364_10151547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1676 | Open in IMG/M |
| 3300012198|Ga0137364_10265937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1269 | Open in IMG/M |
| 3300012200|Ga0137382_10407447 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 959 | Open in IMG/M |
| 3300012203|Ga0137399_10149953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1862 | Open in IMG/M |
| 3300012203|Ga0137399_10441419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1088 | Open in IMG/M |
| 3300012204|Ga0137374_10979679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300012208|Ga0137376_10678443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 889 | Open in IMG/M |
| 3300012209|Ga0137379_10315402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1474 | Open in IMG/M |
| 3300012209|Ga0137379_10428481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1232 | Open in IMG/M |
| 3300012210|Ga0137378_11699781 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012211|Ga0137377_10668014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 974 | Open in IMG/M |
| 3300012285|Ga0137370_10195290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1185 | Open in IMG/M |
| 3300012285|Ga0137370_10288882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 977 | Open in IMG/M |
| 3300012350|Ga0137372_10079244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2801 | Open in IMG/M |
| 3300012354|Ga0137366_10599474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 790 | Open in IMG/M |
| 3300012355|Ga0137369_10137447 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1954 | Open in IMG/M |
| 3300012356|Ga0137371_10446741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1001 | Open in IMG/M |
| 3300012358|Ga0137368_10395906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 908 | Open in IMG/M |
| 3300012359|Ga0137385_10497922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1031 | Open in IMG/M |
| 3300012359|Ga0137385_11284619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300012363|Ga0137390_11889850 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012371|Ga0134022_1123851 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300012386|Ga0134046_1147025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 801 | Open in IMG/M |
| 3300012405|Ga0134041_1073385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300012683|Ga0137398_10449460 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012917|Ga0137395_10167573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1513 | Open in IMG/M |
| 3300012924|Ga0137413_11706679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300012929|Ga0137404_10180120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1778 | Open in IMG/M |
| 3300012944|Ga0137410_10184745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1606 | Open in IMG/M |
| 3300012944|Ga0137410_11129879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 672 | Open in IMG/M |
| 3300012948|Ga0126375_11184086 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 635 | Open in IMG/M |
| 3300012976|Ga0134076_10299433 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300014154|Ga0134075_10200752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 858 | Open in IMG/M |
| 3300014154|Ga0134075_10404969 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300014157|Ga0134078_10237309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 759 | Open in IMG/M |
| 3300015264|Ga0137403_10352921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1357 | Open in IMG/M |
| 3300015356|Ga0134073_10037265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1251 | Open in IMG/M |
| 3300015372|Ga0132256_101536585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 776 | Open in IMG/M |
| 3300017656|Ga0134112_10258406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300018082|Ga0184639_10392075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300018084|Ga0184629_10347624 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018433|Ga0066667_10549606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 958 | Open in IMG/M |
| 3300019279|Ga0184642_1282182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1222 | Open in IMG/M |
| 3300021046|Ga0215015_10067967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1551 | Open in IMG/M |
| 3300021951|Ga0222624_1158310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1210 | Open in IMG/M |
| 3300025910|Ga0207684_10026491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4942 | Open in IMG/M |
| 3300026307|Ga0209469_1103451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 773 | Open in IMG/M |
| 3300026308|Ga0209265_1117228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
| 3300026310|Ga0209239_1236236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300026324|Ga0209470_1039165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2358 | Open in IMG/M |
| 3300026325|Ga0209152_10159095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 853 | Open in IMG/M |
| 3300026332|Ga0209803_1058181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1682 | Open in IMG/M |
| 3300026333|Ga0209158_1021618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2898 | Open in IMG/M |
| 3300026342|Ga0209057_1057083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1792 | Open in IMG/M |
| 3300026524|Ga0209690_1036828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2297 | Open in IMG/M |
| 3300026540|Ga0209376_1358367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300026548|Ga0209161_10015560 | All Organisms → cellular organisms → Bacteria | 5593 | Open in IMG/M |
| 3300026548|Ga0209161_10574884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300027671|Ga0209588_1057275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1260 | Open in IMG/M |
| 3300027775|Ga0209177_10338474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300027903|Ga0209488_11045927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
| 3300028884|Ga0307308_10408993 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300030997|Ga0073997_11867482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 533 | Open in IMG/M |
| 3300031576|Ga0247727_10097494 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300031949|Ga0214473_11477111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300032180|Ga0307471_101793821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
| 3300032955|Ga0335076_11687463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 522 | Open in IMG/M |
| 3300033417|Ga0214471_10242459 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300034177|Ga0364932_0241775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 683 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101184422 | 3300002558 | Grasslands Soil | GPALGVPEIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| JGI25389J43894_10368963 | 3300002916 | Grasslands Soil | EIVPSINGGAGPALGVPEIGATLLFGGLFLLSFGWFGALFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0066674_101685361 | 3300005166 | Soil | IGVALFFGGLFFLSWAWFAGRYPIISPRLAANALEREHH* |
| Ga0066673_106463582 | 3300005175 | Soil | PEIGVTLLFAGLFLLSYGWFGSRYPMLSPRLAADTLERERH* |
| Ga0066684_108369272 | 3300005179 | Soil | GLPETASTLLFGGLFLLSYGWFGGRYPMLSPRLAADALERERH* |
| Ga0066685_101541001 | 3300005180 | Soil | EVGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH* |
| Ga0066678_102986851 | 3300005181 | Soil | GLPEVGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0070703_100149004 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGVALLFGGLFLASLGWFGARYPMLSPRLAADALERERH* |
| Ga0070681_108208873 | 3300005458 | Corn Rhizosphere | EVGTTLFFAGLFFLSWAWFAGRYPIVSPRLAADALEREAH* |
| Ga0070699_1019549182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGTGLFFLGLFLLAWAWFASRYPMVSPRLAEDALEREHH* |
| Ga0070697_1000968334 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEAGVTLFFAGLFFLSWAWFAGRYPIISPRLAADALQRAPH* |
| Ga0070697_1003873693 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEAGVTLFFAGLFFLSWAWFAGRYPIISPRLAADALQREPH* |
| Ga0066697_106175232 | 3300005540 | Soil | AVGIPEIGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH* |
| Ga0070696_1006856781 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EVGMALFFGGLFLLSWGWFAGRYPIISPRLAADALEREHH* |
| Ga0066701_100467594 | 3300005552 | Soil | ELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH* |
| Ga0066661_108743982 | 3300005554 | Soil | LLFGGLFLAALGWFGARYPMLSPRLAADAVERERH* |
| Ga0066692_101631533 | 3300005555 | Soil | PELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH* |
| Ga0066692_104857181 | 3300005555 | Soil | GIPEVGVALLFGGLYLLSIAWFAGRYPMISPRLAADTLEREQH* |
| Ga0066692_108351032 | 3300005555 | Soil | LLFGGLFLASLGWFGARYPMLSPRLAADALERERH* |
| Ga0066704_102016404 | 3300005557 | Soil | PAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH* |
| Ga0066700_101061901 | 3300005559 | Soil | TLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0066705_104462081 | 3300005569 | Soil | INGGAGPAIGLPEDGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLEREGH* |
| Ga0066694_100178955 | 3300005574 | Soil | GVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH* |
| Ga0066694_100546391 | 3300005574 | Soil | AGVTLLFAGLFLLAMGWFATRYPMISPRLAADTLQREAH* |
| Ga0066691_100578324 | 3300005586 | Soil | GVALFFGGLFFLSWAWFAGRYPIISPRLAANALEREHH* |
| Ga0066654_104334012 | 3300005587 | Soil | GAGPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH* |
| Ga0066651_102249551 | 3300006031 | Soil | GAGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH* |
| Ga0066696_104274153 | 3300006032 | Soil | LGVPEIGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH* |
| Ga0066656_111357641 | 3300006034 | Soil | VTLFFAGLFFLSWGWFAGRYPIISPRLAADALQREQH* |
| Ga0066652_1002116221 | 3300006046 | Soil | IGIPEIGVTLLYGGLFLLSMAWFALRYPMLSPRLAADTLEREAH* |
| Ga0079222_110856631 | 3300006755 | Agricultural Soil | ATLLFGGLFVLSFGWFGARYPMLSPRLAADTVEREHH* |
| Ga0066665_106763351 | 3300006796 | Soil | IGVTLLFAGLFLVSFGWFGARYPMLSPRLAADALERERH* |
| Ga0066659_103204801 | 3300006797 | Soil | IGVTLLFAGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0066659_103606521 | 3300006797 | Soil | GPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH* |
| Ga0075433_109203773 | 3300006852 | Populus Rhizosphere | FAGLFALSYSWFAGRYPMLSPRLAADTLDREHGH* |
| Ga0075434_1002421754 | 3300006871 | Populus Rhizosphere | LLFAGLFILSWAFFASRYPIISPRLAADALEREQH* |
| Ga0075429_1003651514 | 3300006880 | Populus Rhizosphere | GVPEVGTAMFFAGLFLLAWAWFAGRYPIISPRHAADALEREAH* |
| Ga0099791_103790021 | 3300007255 | Vadose Zone Soil | VTVLFGGLFLLAMGWFATRYPMISPRLAADTLEREQH* |
| Ga0099791_106476382 | 3300007255 | Vadose Zone Soil | LFFGGLFFISWAWFARKYPIISPRLAADALEREQH* |
| Ga0099793_104188312 | 3300007258 | Vadose Zone Soil | FFGGLFFLSWAWFANRYPIISPRLAADALEREQH* |
| Ga0066710_1018209712 | 3300009012 | Grasslands Soil | GPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH |
| Ga0066710_1041943272 | 3300009012 | Grasslands Soil | GPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLERERH |
| Ga0099827_104958381 | 3300009090 | Vadose Zone Soil | LFFGGLFFLAWAWFAGRYPIISPRLAANALEREHH* |
| Ga0066709_1004430134 | 3300009137 | Grasslands Soil | LFFAGVFFLSWAWFARRYPIISPRLAADALEREQH* |
| Ga0127482_11629123 | 3300010126 | Grasslands Soil | PALGMPEVGVTLLFAGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0134088_101706071 | 3300010304 | Grasslands Soil | LLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0134088_104771582 | 3300010304 | Grasslands Soil | LPELGVTALFGGLFLLSLGWFAARYPMVSPRLAADTLEREHH* |
| Ga0134086_100299874 | 3300010323 | Grasslands Soil | GVTLFFGGLFCMSWAWFASRYPIISPRLAADALEREQH* |
| Ga0134111_102331262 | 3300010329 | Grasslands Soil | PELGVTVLFGGLFLMAMGWFGARYPMISPRLAADTLEREAH* |
| Ga0134080_100628123 | 3300010333 | Grasslands Soil | GVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0134071_103028523 | 3300010336 | Grasslands Soil | FFGGLFFLSWAWFAGRYPIISPRLAANALEREHH* |
| Ga0134071_107697502 | 3300010336 | Grasslands Soil | SINGGAGPAIGVPELGVTALFAGLYFLCIAWFAARRPMLSPRLAADTLERESH* |
| Ga0126372_127719282 | 3300010360 | Tropical Forest Soil | HGPITSVLFFGGLFALSYSWFAGRYPMVSPRLAADTLEREHGH* |
| Ga0137392_109520171 | 3300011269 | Vadose Zone Soil | TLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH* |
| Ga0137426_11425841 | 3300011435 | Soil | PAIGVPEIGTTLLFGGLFLLALGWFAGRYPMLSPRLAADTLEREAH* |
| Ga0137463_10155805 | 3300011444 | Soil | GVPELGAVLFFGGLYALSYSWFAGRYPMISPRLAADTLEREHGH* |
| Ga0137364_101515473 | 3300012198 | Vadose Zone Soil | LLYSGLFLLSMAWFALRYPMISPRLAADTLEREAH* |
| Ga0137364_102659371 | 3300012198 | Vadose Zone Soil | EIGVTLFFGGVFLLAWAWFAARYPIISPRLAADALEREAH* |
| Ga0137382_104074473 | 3300012200 | Vadose Zone Soil | IGIPEVGVTLLYSGLFLLSMAWFALRYPMISPRSASDTLEREAY* |
| Ga0137399_101499531 | 3300012203 | Vadose Zone Soil | PEVGVALFFGGLFLLSWTWFASRYPIISPRLAADALEREQH* |
| Ga0137399_104414193 | 3300012203 | Vadose Zone Soil | LPEIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0137374_109796792 | 3300012204 | Vadose Zone Soil | GVTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH* |
| Ga0137376_106784431 | 3300012208 | Vadose Zone Soil | IGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH* |
| Ga0137379_103154023 | 3300012209 | Vadose Zone Soil | LFGGLFLLSIAWFARRDPMISPRLAADTLEREAH* |
| Ga0137379_104284811 | 3300012209 | Vadose Zone Soil | LFAGLYLLSIAWFAARRPMLSPRLAADTLERESH* |
| Ga0137378_116997812 | 3300012210 | Vadose Zone Soil | AGGLCFAGLFLLAYAWFAGRYPMLSPRLAADTLEREHH* |
| Ga0137377_106680144 | 3300012211 | Vadose Zone Soil | APVLGVPEIGVALLFGGLFLASLGWFAARYPMLSPRLAADALERERH* |
| Ga0137370_101952903 | 3300012285 | Vadose Zone Soil | VPELGVTALFAGLYFLSIAWFAARRPMLSPRLAADTLEREQH* |
| Ga0137370_102888823 | 3300012285 | Vadose Zone Soil | EIGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH* |
| Ga0137372_100792441 | 3300012350 | Vadose Zone Soil | VTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH* |
| Ga0137367_105861642 | 3300012353 | Vadose Zone Soil | PSINNGAGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH* |
| Ga0137366_105994741 | 3300012354 | Vadose Zone Soil | AIGLPEAGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0137369_101374471 | 3300012355 | Vadose Zone Soil | LFFAGLFLLAWAWFAGRYPIISPRLAADALEREAH* |
| Ga0137371_104467413 | 3300012356 | Vadose Zone Soil | LTEAGVTLFFAGLFFLSWGWFAGRYPIISPRLAADALEREQH* |
| Ga0137368_103959061 | 3300012358 | Vadose Zone Soil | EIGVTLLFGGLFLSSLGWFAARYPMLSPRLAADTLERERH* |
| Ga0137385_104979221 | 3300012359 | Vadose Zone Soil | AGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0137385_112846192 | 3300012359 | Vadose Zone Soil | GPAIGIPELGVTCFFGGLYLLSIAWFAGRYPMLSPRLAADTLEREQH* |
| Ga0137390_118898502 | 3300012363 | Vadose Zone Soil | VALFFGGLFFLSWAWFASRYPIISPRLAADALEREQH* |
| Ga0134022_11238512 | 3300012371 | Grasslands Soil | GVTLLFGGLFLVSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0134046_11470253 | 3300012386 | Grasslands Soil | PAIGVPEIGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0134041_10733851 | 3300012405 | Grasslands Soil | IGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH* |
| Ga0137398_104494601 | 3300012683 | Vadose Zone Soil | VMLLGVFLLAYGAFARKYPMVSPRLAADTLEREDSH* |
| Ga0137395_101675733 | 3300012917 | Vadose Zone Soil | VTLLFAGLFLLSFGWFGGRYPMLSPRLAADTLERERH* |
| Ga0137413_117066792 | 3300012924 | Vadose Zone Soil | VTLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH* |
| Ga0137404_101801201 | 3300012929 | Vadose Zone Soil | VTLLFGGLFLLSFGWFGACYPMLSPRLAADTLERERH* |
| Ga0137410_101847453 | 3300012944 | Vadose Zone Soil | FFAGLFLLSWAWFAARYPIISPRLAADALEREQH* |
| Ga0137410_111298791 | 3300012944 | Vadose Zone Soil | PEVGVALFFGGLFLLSWTWFASRYPIISPRLAADALEREGH* |
| Ga0126375_111840861 | 3300012948 | Tropical Forest Soil | ELGGLLFFSGLYALSYSWFAGRYPMISPRLAADTLEREHGH* |
| Ga0134110_104353082 | 3300012975 | Grasslands Soil | VPSINGGAGPAIGLPEIAVTSLFGGLFLLSLGWFAARYPMLSPRLAADTLERERH* |
| Ga0134076_102994333 | 3300012976 | Grasslands Soil | GVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0134075_102007521 | 3300014154 | Grasslands Soil | VPSINGGAGPAIGVPELGVTALFAGLYFLSIAWFAARRPMLSPRLAA |
| Ga0134075_104049691 | 3300014154 | Grasslands Soil | TALFGGLFLLSLGWFAARYPMVSPRLAADTLEREHH* |
| Ga0134078_102373093 | 3300014157 | Grasslands Soil | AGPASGVPEVGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH* |
| Ga0137403_103529213 | 3300015264 | Vadose Zone Soil | LGVPEVGVTLLFAGLFLLSLGWFGARYPMLSPRLAADTLERERH* |
| Ga0134073_100372651 | 3300015356 | Grasslands Soil | PEIGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH* |
| Ga0132256_1015365852 | 3300015372 | Arabidopsis Rhizosphere | VGMALFFGGLFLLSWGWFAGRYPIISPRLAADALEREHH* |
| Ga0134112_102584062 | 3300017656 | Grasslands Soil | GVPEIAVTLLFGGLFLLSYGWFGARYPMLSPRLAADTLHREHH |
| Ga0184639_103920752 | 3300018082 | Groundwater Sediment | FFGGLYALSVAWFAGRYPMISPRLAADTLEREHGH |
| Ga0184629_103476243 | 3300018084 | Groundwater Sediment | ALFFGGLFLLSWAWFAGRYPIISPRLAADALEREQH |
| Ga0066667_101396461 | 3300018433 | Grasslands Soil | PSINGGAGPAIGIPEIGVTLLYGGLFLLSMAWFALRYPMLSPRLAADTLEREAH |
| Ga0066667_105496063 | 3300018433 | Grasslands Soil | VPEIGVTLLFAGLFLLSYGWFGSRYPMLSPRLAADTLERERH |
| Ga0184642_12821821 | 3300019279 | Groundwater Sediment | VGVTLLFGGLFLLSIGWFGARYPMLSPRLAADTLERERH |
| Ga0215015_100679672 | 3300021046 | Soil | VLIFGGLFLLSYGWFGARYPMPSRRLAADTLEREHH |
| Ga0222624_11583101 | 3300021951 | Groundwater Sediment | EIGTGVFFLGLFLLAWAWFASRYPMVSPRLAADALEREAP |
| Ga0207684_100264916 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH |
| Ga0209469_11034512 | 3300026307 | Soil | AGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH |
| Ga0209265_11172281 | 3300026308 | Soil | GGAGPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH |
| Ga0209239_12362362 | 3300026310 | Grasslands Soil | GVTLLFGGLFLLSFGWFAGRYPMLSPRLAADTLEREHH |
| Ga0209470_10391654 | 3300026324 | Soil | VTLFFGGLFCMSWAWFASRYPIISPRLAADALEREQH |
| Ga0209152_101590953 | 3300026325 | Soil | AGPAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH |
| Ga0209803_10581813 | 3300026332 | Soil | EIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH |
| Ga0209158_10216181 | 3300026333 | Soil | NGGAGPAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH |
| Ga0209057_10570831 | 3300026342 | Soil | VPEIGVTLLFAGLFLLSYGWFGARYPMLSPRLAVDTLERERH |
| Ga0209690_10368285 | 3300026524 | Soil | LGLPELGVTALFGGLFLLSLGWFAARYPMLSPRLAADTLERENH |
| Ga0209376_13583671 | 3300026540 | Soil | TALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH |
| Ga0209161_100155608 | 3300026548 | Soil | PELGATLLFAGLFLLSFGWFGARYPMLSPRLAADAIEREQH |
| Ga0209161_105748842 | 3300026548 | Soil | LGGPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLERERH |
| Ga0209588_10572753 | 3300027671 | Vadose Zone Soil | IGVPEIGVTLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH |
| Ga0209177_103384741 | 3300027775 | Agricultural Soil | SVNGGAGPAIGLPELAATLLFGGLFVLSLGWFGARYPMLSPRLAADTVEREHH |
| Ga0209488_110459272 | 3300027903 | Vadose Zone Soil | GVFFLGLFLISWAWFARKYPIISPRLSADALEREAH |
| Ga0307308_104089931 | 3300028884 | Soil | VTLFFGGLFFMSWAWFASRYPIISPRLAADALEREHH |
| Ga0073997_118674822 | 3300030997 | Soil | GVTLLFGGLFLLAFGWFAARYPMLSPRLAADTLEREAH |
| Ga0247727_100974941 | 3300031576 | Biofilm | VTLFFLGLFLLAYAAFAARYPMVSPRLAADTIEREQH |
| Ga0214473_114771111 | 3300031949 | Soil | VALLFFGLFLLSLAWFASRYPMLSPRLAADTLEREGH |
| Ga0307471_1017938213 | 3300032180 | Hardwood Forest Soil | GVPEIGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH |
| Ga0335076_116874632 | 3300032955 | Soil | PEIGVTLLYLGLFLLALGWFAKRYPLISPRLAADTLEREAH |
| Ga0214471_102424591 | 3300033417 | Soil | TALFFGGLFLLAWAWFAARYPIVSPRLAADALERERH |
| Ga0364932_0241775_1_108 | 3300034177 | Sediment | FFGGLYALSVAWFAGRYPMLSPRLAADTLEREHGH |
| ⦗Top⦘ |