Metagenome / Metatranscriptome Family F064609

Basic Information
Family ID	F064609
Family Type	Metagenome / Metatranscriptome
Number of Sequences	128
Average Sequence Length	47 residues
Representative Sequence	FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL
Number of Associated Samples	108
Number of Associated Scaffolds	128

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	7.03 %
% of genes near scaffold ends (potentially truncated)	91.41 %
% of genes from short scaffolds (< 2000 bps)	92.97 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (96.875 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.938 % of family members)
Environment Ontology (ENVO)	Unclassified (36.719 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (59.375 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF01479	S4	10.16
PF00107	ADH_zinc_N	4.69
PF00571	CBS	3.12
PF12833	HTH_18	3.12
PF01872	RibD_C	2.34
PF03706	LPG_synthase_TM	1.56
PF12681	Glyoxalase_2	1.56
PF00296	Bac_luciferase	1.56
PF01183	Glyco_hydro_25	1.56
PF08450	SGL	1.56
PF06441	EHN	1.56
PF01850	PIN	0.78
PF08378	NERD	0.78
PF08031	BBE	0.78
PF00067	p450	0.78
PF01594	AI-2E_transport	0.78
PF08352	oligo_HPY	0.78
PF01934	HepT-like	0.78
PF08241	Methyltransf_11	0.78
PF07883	Cupin_2	0.78
PF08240	ADH_N	0.78
PF10604	Polyketide_cyc2	0.78
PF12867	DinB_2	0.78
PF06772	LtrA	0.78
PF11565	PorB	0.78
PF00005	ABC_tran	0.78
PF03176	MMPL	0.78
PF00211	Guanylate_cyc	0.78
PF08327	AHSA1	0.78
PF03640	Lipoprotein_15	0.78
PF13302	Acetyltransf_3	0.78
PF01522	Polysacc_deac_1	0.78
PF04542	Sigma70_r2	0.78
PF00440	TetR_N	0.78
PF08281	Sigma70_r4_2	0.78
PF13376	OmdA	0.78
PF04299	FMN_bind_2	0.78

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	2.34
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	2.34
COG0392	Predicted membrane flippase AglD2/YbhN, UPF0104 family	Cell wall/membrane/envelope biogenesis [M]	1.56
COG0596	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold	Coenzyme transport and metabolism [H]	1.56
COG3757	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family	Cell wall/membrane/envelope biogenesis [M]	1.56
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	1.56
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	1.56
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.56
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.78
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.78
COG4315	Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)	Function unknown [S]	0.78
COG4292	Low temperature requirement protein LtrA (function unknown)	Function unknown [S]	0.78
COG2445	Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family	General function prediction only [R]	0.78
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	0.78
COG2361	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.78
COG2124	Cytochrome P450	Defense mechanisms [V]	0.78
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.78
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.78
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	0.78
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.78
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.78
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.78
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.88 %
Unclassified	root	N/A	3.12 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.88 %
Unclassified	root	N/A	3.12 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.88 %
Unclassified	root	N/A	3.12 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	75.00 %
Unclassified	root	N/A	3.12 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.56 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	53.91 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	14.06 %
Unclassified	root	N/A	3.12 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.56 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	47.66 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4.69 %
Unclassified	root	N/A	3.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.56 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.78 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.78 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.78 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.78 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.78 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.78 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.78 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.78 %
unclassified Flavobacteriales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales	0.78 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.78 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.78 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
Flavobacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	0.78 %
Sediminibacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium	0.78 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.78 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.78 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
unclassified Sediminibacterium	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium	0.78 %
Flavobacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	0.78 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.78 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.78 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	46.88 %
Unclassified	root	N/A	3.12 %
Sediminibacterium sp. RHBRASLY1	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp. RHBRASLY1	0.78 %
Flavobacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	0.78 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.78 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.78 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.78 %
Chloroflexi bacterium RBG_16_70_13	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	0.78 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.78 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000881\|JGI10215J12807_1255428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	635	Open in IMG/M
3300000956\|JGI10216J12902_102854412	All Organisms → cellular organisms → Bacteria → Terrabacteria group	670	Open in IMG/M
3300000956\|JGI10216J12902_104386044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	729	Open in IMG/M
3300000956\|JGI10216J12902_107605995	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1376	Open in IMG/M
3300000956\|JGI10216J12902_111132904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	527	Open in IMG/M
3300000956\|JGI10216J12902_111279069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	788	Open in IMG/M
3300002568\|C688J35102_117738374	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	502	Open in IMG/M
3300004081\|Ga0063454_100805600	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	727	Open in IMG/M
3300004156\|Ga0062589_102014521	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	586	Open in IMG/M
3300004156\|Ga0062589_102735708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	514	Open in IMG/M
3300004157\|Ga0062590_102070420	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	592	Open in IMG/M
3300004463\|Ga0063356_100253859	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2134	Open in IMG/M
3300004479\|Ga0062595_100252615	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300004479\|Ga0062595_101416002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	635	Open in IMG/M
3300004479\|Ga0062595_101582833	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300004479\|Ga0062595_102270015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	534	Open in IMG/M
3300004480\|Ga0062592_100284129	All Organisms → cellular organisms → Bacteria	1240	Open in IMG/M
3300004480\|Ga0062592_100504008	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1001	Open in IMG/M
3300004480\|Ga0062592_100591450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	941	Open in IMG/M
3300005093\|Ga0062594_100012422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3166	Open in IMG/M
3300005176\|Ga0066679_10097043	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1786	Open in IMG/M
3300005327\|Ga0070658_11513466	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	582	Open in IMG/M
3300005335\|Ga0070666_11239719	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005336\|Ga0070680_101580288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	568	Open in IMG/M
3300005337\|Ga0070682_100448088	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300005344\|Ga0070661_100843889	All Organisms → cellular organisms → Bacteria	754	Open in IMG/M
3300005354\|Ga0070675_100963589	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	783	Open in IMG/M
3300005438\|Ga0070701_11368828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	508	Open in IMG/M
3300005445\|Ga0070708_100037236	All Organisms → cellular organisms → Bacteria	4243	Open in IMG/M
3300005458\|Ga0070681_11320765	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	644	Open in IMG/M
3300005468\|Ga0070707_100002015	All Organisms → cellular organisms → Bacteria	19451	Open in IMG/M
3300005471\|Ga0070698_100024782	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	6255	Open in IMG/M
3300005518\|Ga0070699_100651363	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	961	Open in IMG/M
3300005535\|Ga0070684_102038671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	541	Open in IMG/M
3300005544\|Ga0070686_101202902	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	629	Open in IMG/M
3300005545\|Ga0070695_100456204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	980	Open in IMG/M
3300005547\|Ga0070693_100539739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	833	Open in IMG/M
3300005554\|Ga0066661_10310495	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	970	Open in IMG/M
3300005564\|Ga0070664_101254770	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	700	Open in IMG/M
3300005614\|Ga0068856_101827235	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	619	Open in IMG/M
3300005719\|Ga0068861_102518617	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	518	Open in IMG/M
3300005842\|Ga0068858_100543969	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300005937\|Ga0081455_10852486	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300006046\|Ga0066652_101695292	All Organisms → cellular organisms → Bacteria → Terrabacteria group	576	Open in IMG/M
3300006755\|Ga0079222_11148438	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	689	Open in IMG/M
3300006791\|Ga0066653_10118234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1239	Open in IMG/M
3300006844\|Ga0075428_101486348	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	710	Open in IMG/M
3300006845\|Ga0075421_101835777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	651	Open in IMG/M
3300006852\|Ga0075433_11804949	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	526	Open in IMG/M
3300006852\|Ga0075433_11842574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	520	Open in IMG/M
3300006914\|Ga0075436_101450517	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	521	Open in IMG/M
3300007076\|Ga0075435_101899105	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	523	Open in IMG/M
3300009012\|Ga0066710_104489368	All Organisms → cellular organisms → Bacteria → Terrabacteria group	521	Open in IMG/M
3300009094\|Ga0111539_11615400	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	752	Open in IMG/M
3300009098\|Ga0105245_11084120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	847	Open in IMG/M
3300009100\|Ga0075418_12362117	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	580	Open in IMG/M
3300009101\|Ga0105247_11130735	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	619	Open in IMG/M
3300009148\|Ga0105243_10717568	Not Available	976	Open in IMG/M
3300009156\|Ga0111538_13270884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	564	Open in IMG/M
3300009162\|Ga0075423_10795367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1000	Open in IMG/M
3300009162\|Ga0075423_11245968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	794	Open in IMG/M
3300009176\|Ga0105242_10171441	All Organisms → cellular organisms → Bacteria	1907	Open in IMG/M
3300009176\|Ga0105242_10747990	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	962	Open in IMG/M
3300009868\|Ga0130016_10094670	All Organisms → cellular organisms → Bacteria	2655	Open in IMG/M
3300010322\|Ga0134084_10351089	All Organisms → cellular organisms → Bacteria → Terrabacteria group	562	Open in IMG/M
3300010335\|Ga0134063_10361168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	707	Open in IMG/M
3300011119\|Ga0105246_10277392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1343	Open in IMG/M
3300011119\|Ga0105246_10335196	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1234	Open in IMG/M
3300011119\|Ga0105246_11184461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	702	Open in IMG/M
3300011400\|Ga0137312_1005501	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1420	Open in IMG/M
3300012203\|Ga0137399_11707964	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300012362\|Ga0137361_10502671	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1113	Open in IMG/M
3300012507\|Ga0157342_1043578	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	609	Open in IMG/M
3300012532\|Ga0137373_11220369	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300012896\|Ga0157303_10066341	Not Available	788	Open in IMG/M
3300012904\|Ga0157282_10306279	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	561	Open in IMG/M
3300012913\|Ga0157298_10385436	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	528	Open in IMG/M
3300012957\|Ga0164303_10287235	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	963	Open in IMG/M
3300012960\|Ga0164301_10540705	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	849	Open in IMG/M
3300012984\|Ga0164309_10424065	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	999	Open in IMG/M
3300012985\|Ga0164308_11237674	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300012989\|Ga0164305_11286462	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300013297\|Ga0157378_12602006	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp. RHBRASLY1	558	Open in IMG/M
3300013308\|Ga0157375_11066068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13	945	Open in IMG/M
3300013308\|Ga0157375_13346606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	534	Open in IMG/M
3300014267\|Ga0075313_1103608	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	704	Open in IMG/M
3300014325\|Ga0163163_11749580	Not Available	682	Open in IMG/M
3300014745\|Ga0157377_10419212	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300014968\|Ga0157379_10577585	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1048	Open in IMG/M
3300014968\|Ga0157379_11201500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	729	Open in IMG/M
3300015371\|Ga0132258_11664800	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1610	Open in IMG/M
3300015372\|Ga0132256_102499720	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	618	Open in IMG/M
3300015373\|Ga0132257_100766355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1202	Open in IMG/M
3300015373\|Ga0132257_102771985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	639	Open in IMG/M
3300015374\|Ga0132255_100838968	All Organisms → cellular organisms → Bacteria	1371	Open in IMG/M
3300015374\|Ga0132255_102950911	All Organisms → cellular organisms → Bacteria → Terrabacteria group	726	Open in IMG/M
3300018469\|Ga0190270_11736860	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	678	Open in IMG/M
3300018482\|Ga0066669_11344946	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	647	Open in IMG/M
3300022899\|Ga0247795_1076358	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	582	Open in IMG/M
3300025907\|Ga0207645_11234671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501	Open in IMG/M
3300025910\|Ga0207684_10101799	All Organisms → cellular organisms → Bacteria	2456	Open in IMG/M
3300025913\|Ga0207695_11700896	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	512	Open in IMG/M
3300025914\|Ga0207671_11341226	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300025922\|Ga0207646_10003007	All Organisms → cellular organisms → Bacteria	19437	Open in IMG/M
3300025922\|Ga0207646_10081670	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2890	Open in IMG/M
3300025934\|Ga0207686_11196901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	622	Open in IMG/M
3300025935\|Ga0207709_10842859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	742	Open in IMG/M
3300025937\|Ga0207669_10153717	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1615	Open in IMG/M
3300025944\|Ga0207661_11588571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	599	Open in IMG/M
3300025945\|Ga0207679_11465638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	626	Open in IMG/M
3300025981\|Ga0207640_10882202	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	780	Open in IMG/M
3300025986\|Ga0207658_11610551	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	594	Open in IMG/M
3300026062\|Ga0208654_1052181	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	513	Open in IMG/M
3300026078\|Ga0207702_11835257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	598	Open in IMG/M
3300026116\|Ga0207674_10278071	All Organisms → cellular organisms → Bacteria	1622	Open in IMG/M
3300026343\|Ga0209159_1226422	All Organisms → cellular organisms → Bacteria → Terrabacteria group	575	Open in IMG/M
3300026867\|Ga0207475_1011453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	573	Open in IMG/M
3300027360\|Ga0209969_1052249	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	642	Open in IMG/M
3300028380\|Ga0268265_11509402	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300028784\|Ga0307282_10056351	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1763	Open in IMG/M
3300028791\|Ga0307290_10228480	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300028807\|Ga0307305_10264959	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	784	Open in IMG/M
3300028828\|Ga0307312_10735764	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	653	Open in IMG/M
3300028884\|Ga0307308_10528587	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	566	Open in IMG/M
3300031547\|Ga0310887_10800299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	592	Open in IMG/M
3300031902\|Ga0302322_102626481	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300031908\|Ga0310900_11763498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	526	Open in IMG/M
3300034668\|Ga0314793_041045	Not Available	816	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.47%
Host-Associated	Host-Associated	43.75%
Engineered	Engineered	0.78%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.69%
Plants	Host-Associated → Plants	43.75%
Aquatic	Environmental → Aquatic	0.78%
Wastewater	Engineered → Wastewater	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	53.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.47%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.50%
Sediment	Environmental → Aquatic → Sediment	0.78%
Peat	Environmental → Terrestrial → Peat	0.78%
Roots	Host-Associated → Plants → Roots	0.78%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.66%
Loam	Environmental → Terrestrial → Soil → Loam	14.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.91%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.66%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.50%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	10.94%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.16%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.34%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.56%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	9.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	7.03%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.91%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.12%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.12%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.34%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.56%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.56%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.56%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.56%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.78%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.78%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.78%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.78%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000881	Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009868	Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant	Engineered	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011400	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012904	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014267	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300022899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026062	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026867	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300034668	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F064609

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10215J12807_12554282	3300000881	Soil	TFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
JGI10216J12902_1028544122	3300000956	Soil	WMREENDQLPAEVVDHAFRSLVLPGVSNVLELDLEVPKSL*
JGI10216J12902_1043860441	3300000956	Soil	FIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVGNVLELQLELPRSL*
JGI10216J12902_1076059954	3300000956	Soil	VGTFIGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELELELPTSL*
JGI10216J12902_1111329042	3300000956	Soil	WMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
JGI10216J12902_1112790692	3300000956	Soil	GFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
C688J35102_1177383741	3300002568	Soil	EWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0063454_1008056001	3300004081	Soil	FQFETLVRFLVGTFVGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPASL
Ga0062589_1020145211	3300004156	Soil	FLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLEFPRAL*
Ga0062589_1027357081	3300004156	Soil	FIGFMDWWMREENEHLPAEQVDHAFRSLVLPGIANVLELDLELPLAL*
Ga0062590_1020704201	3300004157	Soil	RLETVVRFLVGTFVGFMDWWMRDENAHLPPELVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0063356_1002538594	3300004463	Arabidopsis Thaliana Rhizosphere	FMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELELPKSL*
Ga0062595_1002526153	3300004479	Soil	MDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0062595_1014160021	3300004479	Soil	WWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
Ga0062595_1015828331	3300004479	Soil	LVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELELELPKSL*
Ga0062595_1022700151	3300004479	Soil	FLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0062592_1002841293	3300004480	Soil	VRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0062592_1005040081	3300004480	Soil	FMDWWMREENENLPAEQVDHAFRSLVLPGVATVLELDLELPKSL*
Ga0062592_1005914501	3300004480	Soil	GFMDWWMREENEHLPPELVDHAYRLLVLPGVANVLELDLELPMAP*
Ga0062594_1000124221	3300005093	Soil	MDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0066679_100970431	3300005176	Soil	LVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL*
Ga0070658_115134661	3300005327	Corn Rhizosphere	TFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELEIDLPTSL*
Ga0070666_112397192	3300005335	Switchgrass Rhizosphere	FMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL*
Ga0070680_1015802882	3300005336	Corn Rhizosphere	DWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0070682_1004480883	3300005337	Corn Rhizosphere	LQTVVRFLVGTFMGFMDWWMRDENDHLPAEDVDHAFRTLALPGVANVLELRLNLPKSL*
Ga0070661_1008438893	3300005344	Corn Rhizosphere	TFIGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELTLDVPESL*
Ga0070675_1009635891	3300005354	Miscanthus Rhizosphere	GFMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELELPKSL*
Ga0070701_113688281	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	FIGFMDWWMREENEHLPAEVVDHAYRSLVLPGVANVLELDLELPKAL*
Ga0070708_1000372361	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	IVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070681_113207651	3300005458	Corn Rhizosphere	FLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0070707_10000201523	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070698_1000247828	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	VGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070699_1006513633	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070684_1020386711	3300005535	Corn Rhizosphere	ETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0070686_1012029021	3300005544	Switchgrass Rhizosphere	FLVGTFIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0070695_1004562042	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	TVVRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0070693_1005397392	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	TFIGFMDWWMREENEHLPAEVVDHAYRSLVLPGIANVLEVDLELPKAL*
Ga0066661_103104952	3300005554	Soil	WWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL*
Ga0070664_1012547703	3300005564	Corn Rhizosphere	FMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0068856_1018272351	3300005614	Corn Rhizosphere	NEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0068861_1025186171	3300005719	Switchgrass Rhizosphere	FIGFMDWWMREENEHLPAEGVDHAFRSLVLPGVANVLELDLELPTRL*
Ga0068858_1005439691	3300005842	Switchgrass Rhizosphere	IGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL*
Ga0081455_108524862	3300005937	Tabebuia Heterophylla Rhizosphere	FLVGTFIGFMDWWMRKENEHLPAEQVDHAFRSLVLPGVSNVLGLRLELPKAL*
Ga0066652_1016952921	3300006046	Soil	GFMDWWMREENDHLPAEQVDHAYRSLVLPGLANVLELELELPKSL*
Ga0079222_111484381	3300006755	Agricultural Soil	MREENEHVPPEQVDHAFRSLALPGVANVLELDIELPKAL*
Ga0066653_101182342	3300006791	Soil	FMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLDLELELPKSL*
Ga0075428_1014863481	3300006844	Populus Rhizosphere	TFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELELELPKAL*
Ga0075421_1018357771	3300006845	Populus Rhizosphere	FMDWWMREENEHLPAEQVDHAFRSLALPGVTTVLELDLELPTSL*
Ga0075433_118049491	3300006852	Populus Rhizosphere	FLVGTFIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVASVLQLDLELPRSL*
Ga0075433_118425742	3300006852	Populus Rhizosphere	GFMDWWLRAENEHLPAEQVDHAFRSLVLPGVANALELEIELPTSL*
Ga0075436_1014505171	3300006914	Populus Rhizosphere	VGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0075435_1018991052	3300007076	Populus Rhizosphere	WWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0066710_1044893681	3300009012	Grasslands Soil	GTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0111539_116154001	3300009094	Populus Rhizosphere	IRFMDRWFREENHHFPPEQVDHAFRSLVLPGVARVLELELDLPSAL*
Ga0105245_110841201	3300009098	Miscanthus Rhizosphere	EENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL*
Ga0075418_123621172	3300009100	Populus Rhizosphere	DWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELELELPKAL*
Ga0105247_111307353	3300009101	Switchgrass Rhizosphere	VRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELEIDLPTSL*
Ga0105243_107175682	3300009148	Miscanthus Rhizosphere	FIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0111538_132708841	3300009156	Populus Rhizosphere	EHVPPAQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0075423_107953673	3300009162	Populus Rhizosphere	REENDHLPPEQVDHAFRTLVLPGVARVLELELDLPGAL*
Ga0075423_112459681	3300009162	Populus Rhizosphere	NDHLPPEQVDHAFRSLVLPGVARVLELELDLPSAL*
Ga0105242_101714411	3300009176	Miscanthus Rhizosphere	MREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0105242_107479901	3300009176	Miscanthus Rhizosphere	MDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLKLELELPESL*
Ga0130016_100946702	3300009868	Wastewater	MEWWMREENDGVPPEVVDHAFRSLVLPGVSNVLGLEIDLPTKL*
Ga0134084_103510891	3300010322	Grasslands Soil	VVGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLDLELELPKSL*
Ga0134063_103611682	3300010335	Grasslands Soil	MREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL*
Ga0105246_102773924	3300011119	Miscanthus Rhizosphere	FRVETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPSVANVLELDLELPTAL
Ga0105246_103351963	3300011119	Miscanthus Rhizosphere	VWDWWLREENDQIPAEQFDHAFRSLVLPGVARVLELEIDPPATL*
Ga0105246_111844612	3300011119	Miscanthus Rhizosphere	LVGTFIGFMDWWMREENEHLPAEVVDHAYRSLVLPGVANVLELDLELPKAL*
Ga0137312_10055011	3300011400	Soil	GTFIGFMDWWMREENEHLPAEQVDHIFRSLALPGVANVLELELELPTTL*
Ga0137399_117079642	3300012203	Vadose Zone Soil	MREENDHLPAEQVDHAFRALVLPGVANALELKLDVPESL*
Ga0137361_105026711	3300012362	Vadose Zone Soil	LRLEIVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL
Ga0157342_10435781	3300012507	Arabidopsis Rhizosphere	EHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0137373_112203691	3300012532	Vadose Zone Soil	ENEHLPAEQVDHAFRSLVLPGVANVLELELELPKSL*
Ga0157303_100663411	3300012896	Soil	TVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0157282_103062791	3300012904	Soil	IGFMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0157298_103854362	3300012913	Soil	VRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0164303_102872351	3300012957	Soil	GFMDWWLRAENEHLPAERVDHAFRSLVLPGVANALELEIELPTSL*
Ga0164301_105407051	3300012960	Soil	MSEENEHLPAEQVDRAFRALVLPGVANVLELDLELPMSL*
Ga0164309_104240653	3300012984	Soil	MDWWMREENDHLPAEQVDHAFRALALPGVANVLELKLDVPESL*
Ga0164308_112376743	3300012985	Soil	FMDWWMREENDNLPAEQVDHAFRTLALPGVAHVLELRLNLPKSL*
Ga0164305_112864623	3300012989	Soil	GTFIGFMDWWIREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL*
Ga0157378_126020062	3300013297	Miscanthus Rhizosphere	FMGFMDWWMRDENDHLPAEDVDHAFRTLALPGVANVLELRLNLPKSL*
Ga0157375_110660683	3300013308	Miscanthus Rhizosphere	WWMREENEHLPAEGVDHAFRSLVLPGVANVLKLDLELPRSL*
Ga0157375_133466062	3300013308	Miscanthus Rhizosphere	FLVGTFIGFMDWWLRDENRQLSAEQVDQSFRSLVLPGVSNVLELEIAVPKSP*
Ga0075313_11036083	3300014267	Natural And Restored Wetlands	GAFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELELELPKAL*
Ga0163163_117495801	3300014325	Switchgrass Rhizosphere	GTFIGFMDWWMREENEHVPPEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0157377_104192121	3300014745	Miscanthus Rhizosphere	MREKNNHLPAEQVDHAFRALVLPGVANVLELTLDVPESL*
Ga0157379_105775853	3300014968	Switchgrass Rhizosphere	AFRVETVVRFLVGTFIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0157379_112015002	3300014968	Switchgrass Rhizosphere	IGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
Ga0132258_116648002	3300015371	Arabidopsis Rhizosphere	VVRFLVGTFIGFMDWWMREENEHLPPELVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0132256_1024997202	3300015372	Arabidopsis Rhizosphere	FRLETVVRFLVGTFIGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL
Ga0132257_1007663552	3300015373	Arabidopsis Rhizosphere	LETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRTL*
Ga0132257_1027719852	3300015373	Arabidopsis Rhizosphere	MDWWMREENEHLPAEQVDHALRSLVLPGVANVLELEIDLPTSL*
Ga0132255_1008389684	3300015374	Arabidopsis Rhizosphere	FIGFMDWWVREENEQLSAETVDKAFRSLVLPGLANVLDLEIDVPKAL*
Ga0132255_1029509113	3300015374	Arabidopsis Rhizosphere	FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0190270_117368603	3300018469	Soil	GFMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELDLPKSL
Ga0066669_113449462	3300018482	Grasslands Soil	VGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0247795_10763581	3300022899	Soil	NEHLPAEQVDHAFRSLVLPGVTNVLELDLELPKAL
Ga0207645_112346711	3300025907	Miscanthus Rhizosphere	GFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207684_101017991	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	VVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207695_117008961	3300025913	Corn Rhizosphere	ENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207671_113412261	3300025914	Corn Rhizosphere	GTFVGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0207646_1000300723	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	REENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207646_100816701	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL
Ga0207686_111969013	3300025934	Miscanthus Rhizosphere	FMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0207709_108428591	3300025935	Miscanthus Rhizosphere	FIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPKAL
Ga0207669_101537174	3300025937	Miscanthus Rhizosphere	FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207661_115885712	3300025944	Corn Rhizosphere	VWDWWLREENDQIPAEQFDHVFRSLVLPGVARVLELEIDPPATL
Ga0207679_114656382	3300025945	Corn Rhizosphere	GFMDWWMREENEHLPAEQVDRAFRSLVLPGVASVLELDLELPTSL
Ga0207640_108822023	3300025981	Corn Rhizosphere	FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL
Ga0207658_116105511	3300025986	Switchgrass Rhizosphere	WWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0208654_10521812	3300026062	Natural And Restored Wetlands	VVRFLVGAFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELDLELPKAL
Ga0207702_118352572	3300026078	Corn Rhizosphere	RFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207674_102780714	3300026116	Corn Rhizosphere	VRFLVGTFVGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0209159_12264222	3300026343	Soil	RFVVGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0207475_10114531	3300026867	Soil	VRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0209969_10522491	3300027360	Arabidopsis Thaliana Rhizosphere	RFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELNLELPTAL
Ga0268265_115094023	3300028380	Switchgrass Rhizosphere	MREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0307282_100563512	3300028784	Soil	MREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307290_102284801	3300028791	Soil	SFQLETIVHFLVGTFIGFMDWWMRKENDHLPAEQVDHAFRSLVLPGVANVLELDLQLPRS
Ga0307305_102649592	3300028807	Soil	LVGTFIGFMDWWMREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307312_107357641	3300028828	Soil	MDWWMREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307308_105285872	3300028884	Soil	ALRLEIVVRFLVGTFIGFMDWWMREENEHLPAAQVDHAFRSLVLPGVASVLELDLELPRA
Ga0310887_108002992	3300031547	Soil	WWMREENDHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0302322_1026264811	3300031902	Fen	EENGHLPPEAVDHAFRSLVLPGIANVLELDIELPRNL
Ga0310900_117634981	3300031908	Soil	VVRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL
Ga0314793_041045_695_814	3300034668	Soil	MWDWWLREERDQIPAEQFDHAFRSLVLRGVARVLELEIDL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign