| Basic Information | |
|---|---|
| Family ID | F064585 |
| Family Type | Metagenome |
| Number of Sequences | 128 |
| Average Sequence Length | 46 residues |
| Representative Sequence | FGVAPTPVLADPRDPARGLQPSGDLEATPEFRLHLVRVLTEKAFAA |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.88 % |
| % of genes from short scaffolds (< 2000 bps) | 92.19 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.219 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.594 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 0.00% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01799 | Fer2_2 | 72.66 |
| PF01315 | Ald_Xan_dh_C | 15.62 |
| PF02738 | MoCoBD_1 | 7.03 |
| PF01061 | ABC2_membrane | 0.78 |
| PF00164 | Ribosom_S12_S23 | 0.78 |
| PF09663 | Amido_AtzD_TrzD | 0.78 |
| PF00111 | Fer2 | 0.78 |
| PF00941 | FAD_binding_5 | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.22 % |
| Unclassified | root | N/A | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000878|AL9A1W_1189291 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300000880|AL20A1W_1085576 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300001089|JGI12683J13190_1019420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300001535|A3PFW1_10200093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300001536|A1565W1_10524183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1242 | Open in IMG/M |
| 3300001545|JGI12630J15595_10064699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 722 | Open in IMG/M |
| 3300001661|JGI12053J15887_10340900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100544254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1038 | Open in IMG/M |
| 3300005093|Ga0062594_103171485 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005172|Ga0066683_10152687 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300005175|Ga0066673_10007113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4598 | Open in IMG/M |
| 3300005178|Ga0066688_10147787 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300005179|Ga0066684_10914098 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005186|Ga0066676_10168734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1388 | Open in IMG/M |
| 3300005435|Ga0070714_102015339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 563 | Open in IMG/M |
| 3300005445|Ga0070708_100403186 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005445|Ga0070708_101427270 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005446|Ga0066686_10128494 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300005446|Ga0066686_10748848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300005467|Ga0070706_101877487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300005471|Ga0070698_101838314 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005536|Ga0070697_100099893 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300005540|Ga0066697_10314218 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005555|Ga0066692_10906250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300005558|Ga0066698_10179732 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300005559|Ga0066700_10019830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3740 | Open in IMG/M |
| 3300005560|Ga0066670_10065740 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300005561|Ga0066699_10435716 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005561|Ga0066699_10597073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300005566|Ga0066693_10096739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1060 | Open in IMG/M |
| 3300005575|Ga0066702_10621409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300005587|Ga0066654_10157578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
| 3300005598|Ga0066706_10734743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300005764|Ga0066903_101977117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300006028|Ga0070717_11445966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300006032|Ga0066696_10088155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1838 | Open in IMG/M |
| 3300006791|Ga0066653_10356933 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006804|Ga0079221_10698296 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006852|Ga0075433_11595781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 563 | Open in IMG/M |
| 3300006903|Ga0075426_10274205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
| 3300009012|Ga0066710_101666372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300009012|Ga0066710_102398108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300009038|Ga0099829_10386730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300009038|Ga0099829_10858084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300009088|Ga0099830_11127203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300009088|Ga0099830_11220895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300009088|Ga0099830_11832873 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009089|Ga0099828_10769697 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300009090|Ga0099827_10748158 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300009090|Ga0099827_11060627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300010047|Ga0126382_10315029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
| 3300010323|Ga0134086_10232001 | Not Available | 698 | Open in IMG/M |
| 3300010329|Ga0134111_10260826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
| 3300010329|Ga0134111_10296807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300010329|Ga0134111_10303119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300010333|Ga0134080_10414127 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010337|Ga0134062_10518446 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010361|Ga0126378_10858444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1015 | Open in IMG/M |
| 3300010379|Ga0136449_101870688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
| 3300010401|Ga0134121_13050325 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300011269|Ga0137392_10556590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 952 | Open in IMG/M |
| 3300011269|Ga0137392_11312081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300011269|Ga0137392_11433197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300011271|Ga0137393_11576726 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300011998|Ga0120114_1051391 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012096|Ga0137389_11585931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300012189|Ga0137388_11094169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300012198|Ga0137364_10239210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1339 | Open in IMG/M |
| 3300012200|Ga0137382_10201853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300012200|Ga0137382_10518363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300012207|Ga0137381_11193590 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012208|Ga0137376_11798538 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012210|Ga0137378_11800359 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012285|Ga0137370_10032395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2724 | Open in IMG/M |
| 3300012349|Ga0137387_10645560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300012356|Ga0137371_10019644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5203 | Open in IMG/M |
| 3300012363|Ga0137390_11592404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300012922|Ga0137394_11549429 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012925|Ga0137419_10843869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300012977|Ga0134087_10508063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300013770|Ga0120123_1146377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
| 3300013772|Ga0120158_10023033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5021 | Open in IMG/M |
| 3300014052|Ga0120109_1146399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300015358|Ga0134089_10129537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 985 | Open in IMG/M |
| 3300016371|Ga0182034_11629589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300017994|Ga0187822_10209357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300018468|Ga0066662_10722904 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300018482|Ga0066669_10538747 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300020006|Ga0193735_1002556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5897 | Open in IMG/M |
| 3300021046|Ga0215015_10585184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
| 3300021180|Ga0210396_11519445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300021432|Ga0210384_10591798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300021432|Ga0210384_10708728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
| 3300021559|Ga0210409_10377291 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300025509|Ga0208848_1053006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 863 | Open in IMG/M |
| 3300025910|Ga0207684_10202474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1712 | Open in IMG/M |
| 3300025910|Ga0207684_10621961 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025922|Ga0207646_10452536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1158 | Open in IMG/M |
| 3300025929|Ga0207664_10538388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300025939|Ga0207665_11197816 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026301|Ga0209238_1269243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300026308|Ga0209265_1102310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300026310|Ga0209239_1055018 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300026316|Ga0209155_1028819 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
| 3300026333|Ga0209158_1261016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300026343|Ga0209159_1032773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2753 | Open in IMG/M |
| 3300026529|Ga0209806_1316907 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026538|Ga0209056_10198533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1472 | Open in IMG/M |
| 3300026542|Ga0209805_1355336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
| 3300026547|Ga0209156_10029469 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300027383|Ga0209213_1107650 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027587|Ga0209220_1079804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 865 | Open in IMG/M |
| 3300027651|Ga0209217_1199728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300027857|Ga0209166_10352913 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300027862|Ga0209701_10349090 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027910|Ga0209583_10113516 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300027911|Ga0209698_10789315 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300027986|Ga0209168_10125698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1311 | Open in IMG/M |
| 3300028536|Ga0137415_11182974 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028828|Ga0307312_10133616 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300031671|Ga0307372_10244603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1082 | Open in IMG/M |
| 3300031720|Ga0307469_11741564 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031754|Ga0307475_11217501 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032160|Ga0311301_11402680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300032174|Ga0307470_11622185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300032180|Ga0307471_102492308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300032205|Ga0307472_100728913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 896 | Open in IMG/M |
| 3300032205|Ga0307472_102297471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.25% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL9A1W_11892911 | 3300000878 | Permafrost | VGAGAKLALFGVAPTPVLADAADPTRGLKPSGDLEATPEFRLHLVRVLTEKVFAA* |
| AL20A1W_10855762 | 3300000880 | Permafrost | VVRAGQRLALFGVAPTPVLADPVDSTRGLHPTGDIEATTEFRLHLVRVLTEKALAA* |
| JGI12683J13190_10194202 | 3300001089 | Forest Soil | FGVAPTPVLADPRDPARGLRPSGDLEASPDFRLHLVRVLTERVLAA* |
| A3PFW1_102000933 | 3300001535 | Permafrost | FGVAPTPVLADPRDPARGLQPSGDLEATPEFRLHLVRVLTEKAFAA* |
| A1565W1_105241831 | 3300001536 | Permafrost | PVLAEPGDPTRGLQPSGDLEASPEFRLHLVRVLVEKALAA* |
| JGI12630J15595_100646993 | 3300001545 | Forest Soil | LALFGVAPTPVLADAEDPTRDLHPSGDLESSPEFKLHLVRVLVGRAA* |
| JGI12053J15887_103409001 | 3300001661 | Forest Soil | VLADPLDPARGLRPSGDLEATPEFRLHLVRVLTERVLAA* |
| JGIcombinedJ26739_1005442543 | 3300002245 | Forest Soil | RRLALFGVAPTPVLADAEDPTRDLHPSGDLESSPEFKLHLVRVLVGRAA* |
| Ga0062594_1031714851 | 3300005093 | Soil | GDRLTLFGVAPTPVLADRSQPTRGLQPSGDLEATAEFRLHLVGALTEKVFAA* |
| Ga0066683_101526873 | 3300005172 | Soil | LFGVAPTPVLADRLDPTRGLEPSGDLEASADFRLHLIRALTAQAFAA* |
| Ga0066673_100071135 | 3300005175 | Soil | ALFGVASRPVLADRRDPTHGLQPSGDLEATPDFRMHLVRVLTEKAFAA* |
| Ga0066688_101477873 | 3300005178 | Soil | GDRLALFGVAGTPVMADRGEPTRGLQPSGDLEATPEFRLHLVRVLTEQAFAA* |
| Ga0066684_109140982 | 3300005179 | Soil | TPVLADPRDPARNLQPSGDIEATPEFRIHLVKVLTERAFAA* |
| Ga0066676_101687341 | 3300005186 | Soil | GNRVALFGVAPTPVLADPRDPARGLEPSGDLEATRDFRLHLVRVLTERAMAA* |
| Ga0070714_1020153392 | 3300005435 | Agricultural Soil | AGDSMALFGVAPTPVRADPQNPTAGLQPSADLEATSEFRLHLVRVLTERAFAA* |
| Ga0070708_1004031861 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | APTPVLADPKNPTRGLEPSGDLEATPEFRLHLVQVLCDRLFAA* |
| Ga0070708_1014272702 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TPVLADPKDPARGLQPSGDLEATPEFRLHLVQVVTDRLFN* |
| Ga0066686_101284943 | 3300005446 | Soil | LFGVASRPVLADRRDPTHGLQPSGDLEATPDFRLHLVRVLTEKAFAA* |
| Ga0066686_107488482 | 3300005446 | Soil | LALFGVAPTPVLADARDPARGLQPSGDLEATPEFRLHLVRALTLKAFAA* |
| Ga0070706_1018774872 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRYGDRLALFGVAPTPVLAGPRNPSRGLQPSGDLEASTEFRLHLVQVVTDRVFPQ* |
| Ga0070698_1018383142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LFGVAPTPVLADPKDPARGLQPSGDLEATPEFRLHLVQVVTDRLFAA* |
| Ga0070697_1000998933 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DRLALFGVAPTPVLADARDPGRGLQPSGDLEATPEFRLHLVRALTEKAFAA* |
| Ga0066697_103142181 | 3300005540 | Soil | RGDPTRGLQPSGDLEATAEFRLHLVRVLTEQAFAA* |
| Ga0066692_109062501 | 3300005555 | Soil | AGPKLALFGVAPTPVLADPRDPVAELQPSGDLEATPEFRMHLVRVLTERAFAA* |
| Ga0066698_101797323 | 3300005558 | Soil | DRLALFGVAPTPVLADPRDPARGLEPSRDLEASPDFRLHLIRVLTEQAFAA* |
| Ga0066700_100198301 | 3300005559 | Soil | ALFGVAPTPVLADPRDPARELQPSGDLEATPEFRMHLVRVLTERAFAA* |
| Ga0066670_100657401 | 3300005560 | Soil | RDPARGLEPSRDLEASPDFRLHLIRVLTEQAFAA* |
| Ga0066699_104357163 | 3300005561 | Soil | ADRGDPTRGLQPSGDLEATAEFRLHLVRVLTEQAFAA* |
| Ga0066699_105970733 | 3300005561 | Soil | GVALAGERMALFGVAPTPVLADPKDPTRGLTPSADLEATPEFRLHLVNVLVQRALQ* |
| Ga0066693_100967391 | 3300005566 | Soil | PSNPTAGLEPSGDLEATPEFRLHLVRVLVERAFAA* |
| Ga0066702_106214093 | 3300005575 | Soil | ADPTDPSHGLSPSGDLEATPAFRLHLVEVLVRRAFAS* |
| Ga0066654_101575783 | 3300005587 | Soil | LALFGVGSTPVLADRSDATRGLQPSGDLEATPDFRLHLVRVLTEKAFAA* |
| Ga0066706_107347433 | 3300005598 | Soil | VAGTPVIADRGDPTRGLQPSGDLEATAEFRLHLVRVLTEQAFAA* |
| Ga0066903_1019771171 | 3300005764 | Tropical Forest Soil | PVLADPRDPARGLDPSGDLEASPAFRIHLVRVLAEKALAAA* |
| Ga0070717_114459662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LALFGVAPTPVLADPKNPTRGLEPSGDLEATPEFRLHLVQVLCDRLFAA* |
| Ga0066696_100881553 | 3300006032 | Soil | VRAGERLGLFGVAPTPVLADPADPARGLQPSGDLEATAEFRLHLVRVLSDRAFAA* |
| Ga0066653_103569333 | 3300006791 | Soil | AATPVLADPRDPSRGLQPSADLEATADFRLQLVRVLTEKAFAA* |
| Ga0079221_106982961 | 3300006804 | Agricultural Soil | RIALFGVASTAVLADPRDPARGLEPSGDLEATGEFRIHLVRALTERAMAA* |
| Ga0075433_115957812 | 3300006852 | Populus Rhizosphere | GEKLALFGVAPTPVLADPRDPARGLQPSGDLEASSAFRIHLVSVLAERVLAA* |
| Ga0075426_102742051 | 3300006903 | Populus Rhizosphere | GVVRAGERIALFGVAPTPVLADPRDPARGLQPSGDLEASSDFRLHLVRVLAEKALAA* |
| Ga0066710_1016663721 | 3300009012 | Grasslands Soil | RLALFGVAPTPVLADPADPARGLQPSADLESSADFKLHLVRVLSERAASAATMEGGA |
| Ga0066710_1023981083 | 3300009012 | Grasslands Soil | VRAADRLALFGVAPTPVLADPADPARGLRPSGDLEATPEFRLHLVRTLTDRAFAA |
| Ga0099829_103867303 | 3300009038 | Vadose Zone Soil | ATPVLADPKNPAGGLQPSGDLEASPEFRLHLVQVLTERLFAA* |
| Ga0099829_108580841 | 3300009038 | Vadose Zone Soil | AKDPARGLQPSGDLEATPEFRLHLVRVLTDKAFAA* |
| Ga0099830_111272032 | 3300009088 | Vadose Zone Soil | VAPTPVLADPKNPTNGLQPSGDLEATAEFRLHLVQVVTDRLFAA* |
| Ga0099830_112208951 | 3300009088 | Vadose Zone Soil | TPVLADPRDPTKGLSPSGDLEATPEFRLHLVRVLTAKAFAA* |
| Ga0099830_118328731 | 3300009088 | Vadose Zone Soil | RLALFGVAPTAVLADPRDPTRGLQPSGDLEASPEFRLHLVRTLTEKAFAA* |
| Ga0099828_107696973 | 3300009089 | Vadose Zone Soil | PTPVVADRRDPARGLQPSGDLEATPEFRLHLVRVLADRAFAA* |
| Ga0099827_107481581 | 3300009090 | Vadose Zone Soil | GDRLALFGVAPTPVLADPKDPTRGLQPSGDLEATPEFRLHLVQVVTDRLFAA* |
| Ga0099827_110606272 | 3300009090 | Vadose Zone Soil | GVAPTPVLADPKNPTQGLRPSGDLEATPEFRLHLVQVLTDRLFAA* |
| Ga0126382_103150291 | 3300010047 | Tropical Forest Soil | RDPARGLQPSGDLEATPEFRLHLVRTLTELALAA* |
| Ga0134086_102320012 | 3300010323 | Grasslands Soil | GVVRAGDRLALFGVAPTPVLADPRDPGRGLKPSGDLEATPDFRIHLVRALSEKAFAA* |
| Ga0134111_102608262 | 3300010329 | Grasslands Soil | LFGVAPTPVLADAKDPARGLQPSGDLEATPEFRLHLVRVLTDKAFAA* |
| Ga0134111_102968071 | 3300010329 | Grasslands Soil | ADPRDPARGLEPSRDLEASPDFRLHLIRVLTEQAFAA* |
| Ga0134111_103031193 | 3300010329 | Grasslands Soil | VLADPRDPGRGLRPSGDLEATPDFRVHLVRALSEKAFAA* |
| Ga0134080_104141272 | 3300010333 | Grasslands Soil | GDRLALFGVAPTPVLADRLDPTRGLEPSGDLEASADFRLHLIRALTAQAFAA* |
| Ga0134062_105184462 | 3300010337 | Grasslands Soil | VAATPVLADPHDPARGLQPSADLEASADFRLHLVRVLTEKAFAA* |
| Ga0126378_108584443 | 3300010361 | Tropical Forest Soil | VRAGDRLALFGVAPTAVLADPKDPAKGLQPTGDLEATPEFRTHLVRVLTEKAFAA* |
| Ga0136449_1018706881 | 3300010379 | Peatlands Soil | PVLADPRDPARGLRPSGDLEASPEFRLHLVRVLTERAFAA* |
| Ga0134121_130503252 | 3300010401 | Terrestrial Soil | LADRSQPTRGLQPSGDLEATAEFRLHLVGALTEKVFAA* |
| Ga0137392_105565901 | 3300011269 | Vadose Zone Soil | LFGVAPTPVLADPKNPTRGLHPSGDLEATPEFRLHLAQVVTDRLFAA* |
| Ga0137392_113120812 | 3300011269 | Vadose Zone Soil | LFGVAPTPVLADPKNPTTGLQPSGDLEATPEFRLHLVQVVTDRLFAA* |
| Ga0137392_114331971 | 3300011269 | Vadose Zone Soil | ATPVLADPKNPAGGLQPSGDLEASPEFRLHLVQVLTDRLFA* |
| Ga0137393_115767262 | 3300011271 | Vadose Zone Soil | APTPVLADPKDPTKALQPSGDLEATPEFRLHLVQVLTDRVFTS* |
| Ga0120114_10513911 | 3300011998 | Permafrost | PGGPRAGARLALFGVAPMPVLADPADPTRGLQPSADLESTPDFKLHLVRTLVQRAAA* |
| Ga0137389_115859312 | 3300012096 | Vadose Zone Soil | LADPKNPTGGLQPSGDLEASPEFRLHLVQVLTERLFAA* |
| Ga0137388_110941691 | 3300012189 | Vadose Zone Soil | DPRDPLKGLRPSGDLEATPEFRLHLVRVLTEKAFAA* |
| Ga0137364_102392101 | 3300012198 | Vadose Zone Soil | DRLDPARGLEPSGDLEASPDFRLHLVRVLTAQAFAA* |
| Ga0137382_102018533 | 3300012200 | Vadose Zone Soil | LALFGVASRPVLADRRDPTHGLQPSGDLEATPDFRLHLVRVLTEKAFAA* |
| Ga0137382_105183631 | 3300012200 | Vadose Zone Soil | TPVLADAKDPSRGLQPSSDLEATPEFRLHLVRALTLKAFAA* |
| Ga0137381_111935901 | 3300012207 | Vadose Zone Soil | RLALFGVAPTPVLADAKDPARGLQPSGDLEATPEFRLHLVRVLTDRAFAA* |
| Ga0137376_117985382 | 3300012208 | Vadose Zone Soil | STPVLADRSDATRGLQPSGDLEATPDFRLHLVRVLTEKAFAA* |
| Ga0137378_118003591 | 3300012210 | Vadose Zone Soil | LFGVAPTPVLADPAHPDRDLQPSGDLEASPEFRKHLVRVLTDDLFAA* |
| Ga0137370_100323953 | 3300012285 | Vadose Zone Soil | DRHDPTRGLEPSGDLEASPDFRLHLIRALTAQAFAA* |
| Ga0137387_106455601 | 3300012349 | Vadose Zone Soil | LFGVAPTPVLADSKDASRGLQPSGDLEATPEFRLHLVRVLTERAFAA* |
| Ga0137371_100196445 | 3300012356 | Vadose Zone Soil | GVAPTPVLADPQDPARGLEPSGDLEASSDFRIHLVRVLAEKALA* |
| Ga0137390_115924041 | 3300012363 | Vadose Zone Soil | LALFGVAPTPVLADPKNPTRGLQPSGDLEATPEFRLHLVQVLTDRLFAA* |
| Ga0137394_115494291 | 3300012922 | Vadose Zone Soil | DRLALFGVAPTPVLADPSDPTRGLQPSGDLEATPEFRLHLVRVLTQKAFAA* |
| Ga0137419_108438693 | 3300012925 | Vadose Zone Soil | FGVAPTPVLADRNDPTHGLQPSGDLEASPEFRLHLVRILTEKVFAA* |
| Ga0134087_105080632 | 3300012977 | Grasslands Soil | RAGDRLALFGVAPTPVLADPRDPGRGLRPSGDLEATPDFRVHLVRALSEKAFAA* |
| Ga0120123_11463772 | 3300013770 | Permafrost | LALFGVARTPVLADPRDPAAGLQPSGDLEATPEFRLHLVRVLTEKAFAA* |
| Ga0120158_100230335 | 3300013772 | Permafrost | FGVAPTPVLADPGDPTRGLRPTGDLEATTEFRLHLVRVLTEKALAA* |
| Ga0120109_11463992 | 3300014052 | Permafrost | LALFGVAPTPVLADPKNPTQGLTPSGDLEATPEFRLHLVQVLTERVFAA* |
| Ga0134089_101295373 | 3300015358 | Grasslands Soil | GVVRAGDRLALFGVAPTPVLADPRDPGRGLHPSGDLEATPDFRIHLVRVLSERAFAA* |
| Ga0182034_116295892 | 3300016371 | Soil | TPVLADPQNPTAGLQPSGDLEATSEFRLHLVRAMTEKAFAA |
| Ga0187822_102093572 | 3300017994 | Freshwater Sediment | VLADPRDPSRGLQPSGDLEASPEFRLHLVRVLTERALAA |
| Ga0066662_107229041 | 3300018468 | Grasslands Soil | STPVLADPRDPTRGLQPGGDLEASAEFRLHIVRVLTEKAFAA |
| Ga0066669_105387473 | 3300018482 | Grasslands Soil | LADRLDPTRGLEPSGDLEASADFRLHLIRALTAQAFAA |
| Ga0193735_10025561 | 3300020006 | Soil | AGAVRAGSRLALFGVAPTAVLVDPKDPTNGLRPSGDLEATPEFRLHLIKVLIERAFAA |
| Ga0215015_105851842 | 3300021046 | Soil | LADPKNPSSGLQPSGDLEATPEFRLQLVHVLTQRAFAA |
| Ga0210396_115194452 | 3300021180 | Soil | VAPTPVLADPRDPVKGLQPSGDLEATPEFRLHLVRVLTEKAFAA |
| Ga0210384_105917981 | 3300021432 | Soil | AVDRLALFGVAPTPVLADPRDPVKGLQPSGDLEATPEFRLHLVRVLTEKAFAA |
| Ga0210384_107087281 | 3300021432 | Soil | PTPVLADPKNPVQGLQPSGDLEATPEFRLHLVQVLTDRVFGA |
| Ga0210409_103772913 | 3300021559 | Soil | AGERLALFGVAPTPVLADPKNPTRGLQPSGDLEATPEFRLHLVQVLADRVFAA |
| Ga0208848_10530061 | 3300025509 | Arctic Peat Soil | PTPVLADPANPGRGLQPSGDLEATPEFRLHLVRVLTERVFAA |
| Ga0207684_102024743 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GVAPTPVLADPSDPARGLHPSGDLEATPEFRLHLVRVLAEKAMAS |
| Ga0207684_106219613 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | APTPVLADPKNPTRGLEPSGDLEATPEFRLHLVQVLCDRLFAA |
| Ga0207646_104525361 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAGDVMALFGVAPTPVRADPQNPTAGLQPSADLEATAEFRLHLVRVLTQRAFAA |
| Ga0207664_105383881 | 3300025929 | Agricultural Soil | PTPVLADPREPAEGLRPSGDLEASAEFRLHLVRVLAAKAFAA |
| Ga0207665_111978161 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLADPGDPTRGLQPSGDLEATPEFRLHLVRALTEKAFAA |
| Ga0209238_12692431 | 3300026301 | Grasslands Soil | APTPVLADAKDPARGLQPSGDLEATPDFRLHLVRVLTDRAFAA |
| Ga0209265_11023103 | 3300026308 | Soil | GSTPVLADRSDATRGLQPSGDLEATPDFRLHLVRVLTEKAFAA |
| Ga0209239_10550183 | 3300026310 | Grasslands Soil | RAGDRLALFGVAGTPVMAERGDPTRGLQPSGDLEATAEFRLHLVRVLTEQAFAA |
| Ga0209155_10288191 | 3300026316 | Soil | SRPVLADRRDPTHGLQPSGDLEATPDFRMHLVRVLTEKAFAA |
| Ga0209158_12610162 | 3300026333 | Soil | RAGDKLALFGVAPTPVLADARDPARGLQPSGDLEATPEFRLHLVRALTLKAFAA |
| Ga0209159_10327733 | 3300026343 | Soil | RLALFGVAPTPVLAGAKDPARGLQPSGDLEATPEFRLHLVRVLTDKAFAA |
| Ga0209806_13169072 | 3300026529 | Soil | LALFGVASRPVLADRRDPTHGLQPSGDLEATPDFRLHLVRVLTEKAFAA |
| Ga0209056_101985331 | 3300026538 | Soil | VVRAGDRLALFGVAPTPVLAAAKDPARGLQPSGDLEATPEFRLHLVRVLTDKAFAA |
| Ga0209805_13553362 | 3300026542 | Soil | PVMADPRDPALGLQPGGDLEASADFRLHLVRVLTEKAFAA |
| Ga0209156_100294694 | 3300026547 | Soil | VASRPVLADRRDPTHGLQPSGDLEATPDFRLHLVRVLTEKAFAA |
| Ga0209213_11076502 | 3300027383 | Forest Soil | ALFGVAPTPVLADPRDPLRGLQPSGDLEATTEFRLHLVQVVTDRVFPR |
| Ga0209220_10798042 | 3300027587 | Forest Soil | VVRVADRLALFGVAPTPVLADPRDPTRGLDPSGDLEATPEFRLHLVKVLTERVLAA |
| Ga0209217_11997281 | 3300027651 | Forest Soil | QPGQRARQGADRLALFGVAPIPVLADPRHPASGLQPSGDLEATPEFRIHLVNVLTEKVFA |
| Ga0209166_103529133 | 3300027857 | Surface Soil | VLADPADPARGLRPSGDLEATPEFRRHLVRVLTERAFAS |
| Ga0209701_103490903 | 3300027862 | Vadose Zone Soil | PTPVLADAKDPARGLQPSGDLEATPEFRLHLVRALTDRAFAA |
| Ga0209583_101135163 | 3300027910 | Watersheds | RAVDRLALFGVAPTPVLADPRDPAKGLQPSGDLEASPEFRLHLVRVLTEKAFAA |
| Ga0209698_107893153 | 3300027911 | Watersheds | ADPSDPTRGLSPSGDLEASSDFRLHLVQVLTDRVFAA |
| Ga0209168_101256981 | 3300027986 | Surface Soil | LFGDAPTPVLADPADPTRGLRPSGDLEASPDFRLHLVRILVERALAA |
| Ga0137415_111829741 | 3300028536 | Vadose Zone Soil | DRLTLFGVAPTPVLADPNDPTRGLNPSGDLEASPEFRLHLIKVLTERAFAA |
| Ga0307312_101336163 | 3300028828 | Soil | APTAVLVDPKDPTNGLRPSGDLEATPEFRLHLIKVLIERAFAA |
| Ga0307372_102446033 | 3300031671 | Soil | PTPVLADPKDPTLGLRPSGDLEASAEFRLHLVRVLTARAFAA |
| Ga0307469_117415642 | 3300031720 | Hardwood Forest Soil | AGAVRYADRLALFGVAPTPVLADPHDPTRGLEPSADLEASREFRLHLVRVLTDRAFAA |
| Ga0307475_112175011 | 3300031754 | Hardwood Forest Soil | PVLADPSDPSRGLEPSGDLEATAEFRRHLVRVLAQRAMAA |
| Ga0311301_114026803 | 3300032160 | Peatlands Soil | LFGVAPTPVLADPRDPARGLRPSGDLEASPEFRLHLVRVLTERAFAA |
| Ga0307470_116221851 | 3300032174 | Hardwood Forest Soil | GVAPTPVLADPRDPSKGLQPSGDLEASPEFRLHLVRVLTERALAA |
| Ga0307471_1024923082 | 3300032180 | Hardwood Forest Soil | TLFGVAPTPVLADPSDPARGLQPSGDLEATPEFRLHLVRVLAAKAMAA |
| Ga0307472_1007289131 | 3300032205 | Hardwood Forest Soil | APTAVLADPGDPARGLEPSGDLEATGEFRKHLVRVLTERAMAA |
| Ga0307472_1022974712 | 3300032205 | Hardwood Forest Soil | FGVAPTPVLADPRDPARGLQPSGDLEATPEFRLHLVRVLAERAFAA |
| ⦗Top⦘ |