| Basic Information | |
|---|---|
| Family ID | F064581 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPP |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.03 % |
| % of genes near scaffold ends (potentially truncated) | 96.88 % |
| % of genes from short scaffolds (< 2000 bps) | 86.72 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.312 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.844 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01661 | Macro | 69.53 |
| PF13432 | TPR_16 | 10.94 |
| PF03091 | CutA1 | 7.03 |
| PF13428 | TPR_14 | 2.34 |
| PF14559 | TPR_19 | 2.34 |
| PF13424 | TPR_12 | 2.34 |
| PF00005 | ABC_tran | 2.34 |
| PF13414 | TPR_11 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 69.53 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 7.03 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10181682 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300002558|JGI25385J37094_10119661 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300002560|JGI25383J37093_10074285 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300002562|JGI25382J37095_10064515 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1378 | Open in IMG/M |
| 3300002908|JGI25382J43887_10391941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300002915|JGI25387J43893_1077350 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005174|Ga0066680_10024804 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300005174|Ga0066680_10431237 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005175|Ga0066673_10436540 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005176|Ga0066679_10169781 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300005341|Ga0070691_10565036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300005437|Ga0070710_11380578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300005444|Ga0070694_101734004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300005446|Ga0066686_10310295 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005446|Ga0066686_10910792 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005471|Ga0070698_100750085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 919 | Open in IMG/M |
| 3300005540|Ga0066697_10166263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1306 | Open in IMG/M |
| 3300005545|Ga0070695_100915905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 709 | Open in IMG/M |
| 3300005547|Ga0070693_100821347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 691 | Open in IMG/M |
| 3300005554|Ga0066661_10039304 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
| 3300005558|Ga0066698_10125404 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300005561|Ga0066699_10297471 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005566|Ga0066693_10403960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300005568|Ga0066703_10293456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 984 | Open in IMG/M |
| 3300005569|Ga0066705_10202386 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300005880|Ga0075298_1032641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300006031|Ga0066651_10104599 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300006034|Ga0066656_11092511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300006791|Ga0066653_10735221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300006797|Ga0066659_11384853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300006853|Ga0075420_100097396 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300006853|Ga0075420_100564079 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006871|Ga0075434_100191881 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300007255|Ga0099791_10514325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
| 3300007258|Ga0099793_10006706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4259 | Open in IMG/M |
| 3300007788|Ga0099795_10278719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 729 | Open in IMG/M |
| 3300009012|Ga0066710_102810580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 688 | Open in IMG/M |
| 3300009089|Ga0099828_10373916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1284 | Open in IMG/M |
| 3300009137|Ga0066709_103074546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300009137|Ga0066709_103187021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 598 | Open in IMG/M |
| 3300009137|Ga0066709_103924092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300009147|Ga0114129_10482918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1621 | Open in IMG/M |
| 3300009597|Ga0105259_1032680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1124 | Open in IMG/M |
| 3300010301|Ga0134070_10131563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
| 3300010320|Ga0134109_10227928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
| 3300010323|Ga0134086_10366927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300010323|Ga0134086_10411487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300010333|Ga0134080_10006813 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
| 3300010399|Ga0134127_13430991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300011120|Ga0150983_12935883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300011430|Ga0137423_1029318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1685 | Open in IMG/M |
| 3300012035|Ga0137445_1136068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300012201|Ga0137365_10694712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
| 3300012202|Ga0137363_10727938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 840 | Open in IMG/M |
| 3300012203|Ga0137399_10734057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
| 3300012206|Ga0137380_10233485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1661 | Open in IMG/M |
| 3300012207|Ga0137381_10387748 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1218 | Open in IMG/M |
| 3300012208|Ga0137376_10334785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1314 | Open in IMG/M |
| 3300012208|Ga0137376_10847690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 786 | Open in IMG/M |
| 3300012211|Ga0137377_10004816 | All Organisms → cellular organisms → Bacteria | 10683 | Open in IMG/M |
| 3300012226|Ga0137447_1105332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
| 3300012285|Ga0137370_10007552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5054 | Open in IMG/M |
| 3300012349|Ga0137387_10009349 | All Organisms → cellular organisms → Bacteria | 5688 | Open in IMG/M |
| 3300012357|Ga0137384_10033175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4246 | Open in IMG/M |
| 3300012358|Ga0137368_10222560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1324 | Open in IMG/M |
| 3300012363|Ga0137390_11286578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 677 | Open in IMG/M |
| 3300012532|Ga0137373_11285824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300012918|Ga0137396_10401582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1016 | Open in IMG/M |
| 3300012929|Ga0137404_10639776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 959 | Open in IMG/M |
| 3300012976|Ga0134076_10324972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
| 3300014326|Ga0157380_11338178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
| 3300015254|Ga0180089_1033291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 979 | Open in IMG/M |
| 3300015356|Ga0134073_10014405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1815 | Open in IMG/M |
| 3300017656|Ga0134112_10466631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300017659|Ga0134083_10382422 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300017997|Ga0184610_1186589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300018056|Ga0184623_10356387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300018071|Ga0184618_10046031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1568 | Open in IMG/M |
| 3300018076|Ga0184609_10578850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300018077|Ga0184633_10104241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1466 | Open in IMG/M |
| 3300018081|Ga0184625_10411888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
| 3300018433|Ga0066667_10031088 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
| 3300018433|Ga0066667_10411193 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1096 | Open in IMG/M |
| 3300018482|Ga0066669_10659007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 921 | Open in IMG/M |
| 3300019882|Ga0193713_1021042 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1935 | Open in IMG/M |
| 3300021073|Ga0210378_10321623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
| 3300021080|Ga0210382_10009648 | All Organisms → cellular organisms → Bacteria | 3247 | Open in IMG/M |
| 3300021086|Ga0179596_10443538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 656 | Open in IMG/M |
| 3300024330|Ga0137417_1082193 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 903 | Open in IMG/M |
| 3300024330|Ga0137417_1295464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300025885|Ga0207653_10042202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1500 | Open in IMG/M |
| 3300025910|Ga0207684_10637427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 908 | Open in IMG/M |
| 3300025910|Ga0207684_11682369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300025921|Ga0207652_11008282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 732 | Open in IMG/M |
| 3300026285|Ga0209438_1122188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300026297|Ga0209237_1042584 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300026297|Ga0209237_1128005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1049 | Open in IMG/M |
| 3300026308|Ga0209265_1033786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1582 | Open in IMG/M |
| 3300026317|Ga0209154_1304578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300026327|Ga0209266_1173378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
| 3300026334|Ga0209377_1123814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1033 | Open in IMG/M |
| 3300026523|Ga0209808_1191658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300026528|Ga0209378_1021350 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300026530|Ga0209807_1098788 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1263 | Open in IMG/M |
| 3300026536|Ga0209058_1008898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 7344 | Open in IMG/M |
| 3300026536|Ga0209058_1144248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1133 | Open in IMG/M |
| 3300026540|Ga0209376_1131684 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1225 | Open in IMG/M |
| 3300026551|Ga0209648_10252133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1306 | Open in IMG/M |
| 3300027643|Ga0209076_1211076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300027882|Ga0209590_10024417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3101 | Open in IMG/M |
| 3300027909|Ga0209382_11308659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 734 | Open in IMG/M |
| 3300027961|Ga0209853_1172263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10629912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
| 3300028536|Ga0137415_11492499 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300028784|Ga0307282_10148438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1109 | Open in IMG/M |
| 3300028803|Ga0307281_10376500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300028814|Ga0307302_10310153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 776 | Open in IMG/M |
| 3300028878|Ga0307278_10492736 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300031114|Ga0308187_10265049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
| 3300031740|Ga0307468_100114592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1642 | Open in IMG/M |
| 3300031740|Ga0307468_102569364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300031908|Ga0310900_10859964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 737 | Open in IMG/M |
| 3300032180|Ga0307471_100020791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4801 | Open in IMG/M |
| 3300032180|Ga0307471_101249742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 906 | Open in IMG/M |
| 3300032180|Ga0307471_102300076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300032205|Ga0307472_101914198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300034164|Ga0364940_0128992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300034165|Ga0364942_0047845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1372 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101816821 | 3300001356 | Peatlands Soil | VTRRTWATIIFVVWAGSLGWLAKRELFRSTSDRLAAAALAVPPGTDFYRLDLGGQQVGM |
| JGI25385J37094_101196611 | 3300002558 | Grasslands Soil | VSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQMGYSSTT |
| JGI25383J37093_100742853 | 3300002560 | Grasslands Soil | VTRRGWAGTILVAWAASLGWLARREFFRSTGTRVTEAALSVP |
| JGI25382J37095_100645153 | 3300002562 | Grasslands Soil | VTRRGWATAILVXWVAALGWLVRREFFQSTGARLAEAALSVPPGAV |
| JGI25382J43887_103919412 | 3300002908 | Grasslands Soil | VNRRTWVIAVLTAWTLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQ |
| JGI25387J43893_10773501 | 3300002915 | Grasslands Soil | VSRRTLTAVILGAWIVSLGWLVKREVFRPTGARLAEAALRVPP |
| Ga0066680_100248044 | 3300005174 | Soil | VSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQ |
| Ga0066680_104312371 | 3300005174 | Soil | MTRRTWAVAILGAWAVSLGWLVKREFFRPTGARLAEAALSVPPGAV |
| Ga0066673_104365403 | 3300005175 | Soil | MTRRTWAIAILGAWAGSLGWLVKREFFRPTGTRLAEAALSVP |
| Ga0066679_101697811 | 3300005176 | Soil | VTRRGWAALILVAWAGSLGWLARRELFRSTGARLAEAALSV |
| Ga0070691_105650362 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRQWVVAIFIAWVLSLGWLVKREVFRSTGARLASAALAVPPGALFYRLDVGG |
| Ga0070710_113805782 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYYR |
| Ga0070694_1017340042 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRRWVVAILIAWVLSLGWLVKREVFRSTGARLAAAALAVPPGALFYRLDVGGQQVG |
| Ga0066686_103102951 | 3300005446 | Soil | VNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAAMAVAPGGLFYRLEVGGQQVG |
| Ga0066686_109107921 | 3300005446 | Soil | MTRRGWTALIFVAWAVALGWLARRELFRSMGARLAEAALSVPPG |
| Ga0070698_1007500852 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYYRL* |
| Ga0066697_101662633 | 3300005540 | Soil | MTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEA |
| Ga0070695_1009159051 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRRHWASAVLAVWLLSLGWLVKRELFRSTGARLADAALSVPPGALFYRLDLGAQQVG |
| Ga0070693_1008213471 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRRQWVVAILIAWVLSLGWLVKREVFRPTGARLASAALAVPPGALFYRLD |
| Ga0066661_100393041 | 3300005554 | Soil | MTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAE |
| Ga0066698_101254041 | 3300005558 | Soil | VSRRTLATVILGAWIVSLGWLVKREVFQPTGARLAEAALRVPPGA |
| Ga0066699_102974713 | 3300005561 | Soil | VTRRHWGIAILAAWGLSLGWLVKREMFRPTAARLAEAA |
| Ga0066693_104039602 | 3300005566 | Soil | VTRRGWTTAVMVAWAASLGWLVKREFFLTTAARLAEAARS |
| Ga0066703_102934563 | 3300005568 | Soil | VSRRTLAAVIIGAWIVSLGWLVKREVFPPTGARLAEAALRV |
| Ga0066705_102023861 | 3300005569 | Soil | VTRRGWAALIFVTWAASLGWLARRELFRSTGARLAD |
| Ga0075298_10326412 | 3300005880 | Rice Paddy Soil | VTRRTWAIAIFAIWAASLGWLVKRTYFRSTGAKLAEAALSVPPGAMFYR |
| Ga0066651_101045991 | 3300006031 | Soil | MTRRTWAVAILGAWAASLGWLVKREFFRPTGTRLAEAA |
| Ga0066656_110925111 | 3300006034 | Soil | VTRRGWAAAILAAWAVSLGWLLRRELFQSTGARLAEAALSVPPGAVYYR |
| Ga0066653_107352212 | 3300006791 | Soil | VRRRGWAIAILAAWGLSLGWLIKRTYFRSTGQRLAEAALAVP |
| Ga0066659_113848531 | 3300006797 | Soil | MTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVPPGA |
| Ga0075420_1000973961 | 3300006853 | Populus Rhizosphere | VTRKRWMVAILAIWALSLGWLVKREVFRTTGARLAE |
| Ga0075420_1005640791 | 3300006853 | Populus Rhizosphere | MTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDMG |
| Ga0075434_1001918814 | 3300006871 | Populus Rhizosphere | MSRRTWVVAILIAWALSLGWLVKREVFRPTGARLAEAALAVPP |
| Ga0099791_105143252 | 3300007255 | Vadose Zone Soil | MNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAAMAVAPGGLFYRLEV |
| Ga0099793_100067061 | 3300007258 | Vadose Zone Soil | VNRRRWVIAILTAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGMFYRLAVGGQQVGYSST |
| Ga0099795_102787193 | 3300007788 | Vadose Zone Soil | VNRRTWVIAVLAAWALSLGWLVKREVFRPTGARLAEAAMAVAP |
| Ga0066710_1028105802 | 3300009012 | Grasslands Soil | VTRRGWAVVILAAWAASLGWLVKREFFRTTGERLAEAALAVPPGTQF |
| Ga0099828_103739163 | 3300009089 | Vadose Zone Soil | VTRRGWAIAIFAVWGASLGWLVKREFFRTTGARLAEA |
| Ga0066709_1030745461 | 3300009137 | Grasslands Soil | VTRRHWGIAILAAWGLSLGWLVKREIFRPTGARLAEA |
| Ga0066709_1031870212 | 3300009137 | Grasslands Soil | VTRRGWVVTIFAAWAAALGWLVKREFFRTTGERLADAALAVPPGTEF* |
| Ga0066709_1039240922 | 3300009137 | Grasslands Soil | VTRRGWAVAILGAWAVSLGWLVKRTYFQSTAARLADAALAVPPGATFYL |
| Ga0114129_104829184 | 3300009147 | Populus Rhizosphere | VTRRHWAIAVLTAWLLSLGWLVKREVFRSTGARLADA |
| Ga0105259_10326801 | 3300009597 | Soil | MSRRHWVIAIIAAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLF |
| Ga0134070_101315633 | 3300010301 | Grasslands Soil | VTRRGWAIAIFAAWSASLGWLVKREFFRTTGARLAEAALSVP |
| Ga0134109_102279283 | 3300010320 | Grasslands Soil | VTRRSWAAGILAAWVLSLGWLVKRELFRSTGARLA |
| Ga0134086_103669272 | 3300010323 | Grasslands Soil | VSRRGWALAILAAWILSLGWLIKRTYFRSTGQRLAEA |
| Ga0134086_104114872 | 3300010323 | Grasslands Soil | MTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAAL |
| Ga0134080_100068131 | 3300010333 | Grasslands Soil | VTRRGWALAILAAWILSLGWLIKRTYFRSTGQRLAEAALAVPP |
| Ga0134127_134309912 | 3300010399 | Terrestrial Soil | VTRRHWAIAVLAAWVLSLGWLVKRELFRSTGARLAEAALSV |
| Ga0150983_129358832 | 3300011120 | Forest Soil | VTRRHWAVAILIAWGVSVGLLVKREFFRTTGERLVEAALAVPPGTVFFRIDMAGHQVG |
| Ga0137423_10293181 | 3300011430 | Soil | VSRRRWVVVILTAWALSVAWLVKREFFRTTGERLA |
| Ga0137445_11360682 | 3300012035 | Soil | MTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDLGATQVGWV |
| Ga0137365_106947123 | 3300012201 | Vadose Zone Soil | VNRRRWVIAILAAWVLSLGWLVKREVFRPTGARLAAA |
| Ga0137363_107279383 | 3300012202 | Vadose Zone Soil | MTRRGWAIVIVSAWAVSLGWLFKRTYFRSTGAKLAEAALAVPPGAMFYRLAVGAQQLGYASTT |
| Ga0137399_107340571 | 3300012203 | Vadose Zone Soil | VNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAA |
| Ga0137380_102334851 | 3300012206 | Vadose Zone Soil | MTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAEAALS |
| Ga0137381_103877483 | 3300012207 | Vadose Zone Soil | VTRRGWAVVILAAWAASLGWLVKREFFRTTGERLAEAALAVPP |
| Ga0137376_103347853 | 3300012208 | Vadose Zone Soil | VNRRTWVIAVLAAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVGYS |
| Ga0137376_108476901 | 3300012208 | Vadose Zone Soil | VTRRGWAIAIFAAWGASLGWLVKREFFRPTGTRLAEAALSVPPGA |
| Ga0137377_100048161 | 3300012211 | Vadose Zone Soil | VTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAAL |
| Ga0137447_11053322 | 3300012226 | Soil | MTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDLGATQVGWVSATMDTLPDSI |
| Ga0137370_100075521 | 3300012285 | Vadose Zone Soil | MNRRRWAGAIFAVWALSLAWLVKREVFRPTGARLAEAALAVAPG |
| Ga0137387_100093491 | 3300012349 | Vadose Zone Soil | VTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAALS |
| Ga0137384_100331754 | 3300012357 | Vadose Zone Soil | VSRRGWVIAILTAWVLSLGWLVKRELFRPTGARLAEAALAVP* |
| Ga0137368_102225603 | 3300012358 | Vadose Zone Soil | VTRRYWAAGILAAWVLSVGWLVKRELFRSTGARLAEAAMSVSPGAMFYRLDLGGQQL |
| Ga0137390_112865782 | 3300012363 | Vadose Zone Soil | VSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRL |
| Ga0137373_112858242 | 3300012532 | Vadose Zone Soil | LNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVG |
| Ga0137396_104015821 | 3300012918 | Vadose Zone Soil | VIAVLAAWAASLVWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVGYSSTT |
| Ga0137404_106397763 | 3300012929 | Vadose Zone Soil | VNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLFYRL |
| Ga0134076_103249721 | 3300012976 | Grasslands Soil | VSRRRWVIAILTAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQ* |
| Ga0157380_113381781 | 3300014326 | Switchgrass Rhizosphere | MSRRRWVVAILIAWVLSVGWLVKREVFRSTGARLAAAAL |
| Ga0180089_10332913 | 3300015254 | Soil | MSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALA |
| Ga0134073_100144051 | 3300015356 | Grasslands Soil | MTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVP |
| Ga0134112_104666312 | 3300017656 | Grasslands Soil | VNRRTWVIAVLAAWALSLAWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVG |
| Ga0134083_103824221 | 3300017659 | Grasslands Soil | MTRRGWAIVIVSAWAVSLGWLFKRTYFRSTGAKLAEAALAVPPGAMFYRLAVGAQQLGYASTTVDTL |
| Ga0184610_11865892 | 3300017997 | Groundwater Sediment | MSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQVGFS |
| Ga0184623_103563872 | 3300018056 | Groundwater Sediment | VSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAV |
| Ga0184618_100460311 | 3300018071 | Groundwater Sediment | VNRRRWVIAVLAAWAASLGWLVEREVFRPTGARLAAAAMAVAPGGLFY |
| Ga0184609_105788502 | 3300018076 | Groundwater Sediment | MTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLAEAALSVPPGA |
| Ga0184633_101042413 | 3300018077 | Groundwater Sediment | VSRRHWTIAILAAWALSLGWLVKREVFRSTGARLAEAALAVPPGALFYRL |
| Ga0184625_104118882 | 3300018081 | Groundwater Sediment | VTRRHWAIGILSVWLLSVGWLVKRELFRSTGARLADAALSVPPGSMFYRLDLGS |
| Ga0066667_100310881 | 3300018433 | Grasslands Soil | MTRRGWAIAILGAWAASLGWLVKREFFRPTGTRLAEA |
| Ga0066667_104111933 | 3300018433 | Grasslands Soil | MTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAEAALSV |
| Ga0066669_106590073 | 3300018482 | Grasslands Soil | VSRRTWVIAILVAWALSLGWLVKREVFRPTGARLAEA |
| Ga0193713_10210421 | 3300019882 | Soil | VNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGL |
| Ga0210378_103216232 | 3300021073 | Groundwater Sediment | MSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGG |
| Ga0210382_100096485 | 3300021080 | Groundwater Sediment | MTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSV |
| Ga0179596_104435381 | 3300021086 | Vadose Zone Soil | MTRRTWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVPP |
| Ga0137417_10821931 | 3300024330 | Vadose Zone Soil | VNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLF |
| Ga0137417_12954643 | 3300024330 | Vadose Zone Soil | VNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRL |
| Ga0207653_100422024 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYY |
| Ga0207684_106374271 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRRRWALAIFAAWAVALGWLVKREYFRSTGAKLAEAALAV |
| Ga0207684_116823692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVP |
| Ga0207652_110082822 | 3300025921 | Corn Rhizosphere | MSRRQWVVAIFIAWVLSLGWLVKREVFRSTVARLASAALAVPPGALFYRLDV |
| Ga0209438_11221881 | 3300026285 | Grasslands Soil | VTRRHWAIGILAVWLLSIGWLVKRELFRSTGARLADAALSVPPGSMFYRL |
| Ga0209237_10425841 | 3300026297 | Grasslands Soil | VSRRTLTALILGAWIVSLGWLVKREVFRPTGARLAEAALR |
| Ga0209237_11280053 | 3300026297 | Grasslands Soil | VTRRGWAGAILVAWAASLGWLARREFFRSTGTRVTEAALSVPPGAV |
| Ga0209265_10337861 | 3300026308 | Soil | VTRRGWAALIFVTWAASLGWLARRELFRSTGARLADAALSVPP |
| Ga0209154_13045782 | 3300026317 | Soil | VTRRGWAALIFVTWAASLGWLARRELFRSTGARLADAALSVPPGAV |
| Ga0209266_11733783 | 3300026327 | Soil | VNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAA |
| Ga0209377_11238143 | 3300026334 | Soil | MMRRHWMIAALGAWALSLGWLVKRQFFQSTGARLAEAALAVPPGAIFYRLDVGG |
| Ga0209808_11916582 | 3300026523 | Soil | VSRRTLATVIVGAWIVSLGWLVKREVFQPTGARLAEAALRVPPGAAYYR |
| Ga0209378_10213501 | 3300026528 | Soil | VTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAALSVPPGA |
| Ga0209807_10987881 | 3300026530 | Soil | VTRRGWAALIFVAWAGSLGWLARRELFRSTGARLAEAALSVPPGA |
| Ga0209058_10088981 | 3300026536 | Soil | VSRRGWVIAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDV |
| Ga0209058_11442483 | 3300026536 | Soil | VNRRTWVIAVLAAWALSLAWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQGG |
| Ga0209376_11316841 | 3300026540 | Soil | VSRRGWVIAILTAWVLSLGWLVKREVFRPTGARLAEAALAVPPGT |
| Ga0209648_102521333 | 3300026551 | Grasslands Soil | VNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPP |
| Ga0209076_12110761 | 3300027643 | Vadose Zone Soil | VNRRRWVIAILTAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGMFYRLAVGGQQVGY |
| Ga0209590_100244174 | 3300027882 | Vadose Zone Soil | VNRRRWVIAILAAWTLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQV |
| Ga0209382_113086591 | 3300027909 | Populus Rhizosphere | VTRRHWAIGILAVWVLSVGWLVKRELFRSTGARLADAALS |
| Ga0209853_11722631 | 3300027961 | Groundwater Sand | VSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAA |
| (restricted) Ga0233417_106299121 | 3300028043 | Sediment | VTRRQWGAAIIGVWVASLAWLVKREYFRPTGARLAEAAL |
| Ga0137415_114924991 | 3300028536 | Vadose Zone Soil | VNRRTWVIAVLAAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQV |
| Ga0307282_101484383 | 3300028784 | Soil | VNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLEVGGQQVGYSSTT |
| Ga0307281_103765001 | 3300028803 | Soil | VNRRRWVIAVLAAWALSLGWLVKREVFRPTGARLAEAAMAVAPGGLFYRLAVGG |
| Ga0307302_103101533 | 3300028814 | Soil | MTRRAWALAILGAWTVSLGWLVTRQLFRPAGARLAEAALSVPPGSAYYRLD |
| Ga0307278_104927361 | 3300028878 | Soil | MTRRAWALAILGAWTVSLGWLVTRQLFRPAGARLAEAALSVPPGSA |
| Ga0308187_102650491 | 3300031114 | Soil | VTRRHWAIGILAVWLLSIGWLVKRELFRSTGARLADAALSVPPGSMFYRLDLGAQQVG |
| Ga0307468_1001145924 | 3300031740 | Hardwood Forest Soil | VTRRRWVAAIFAAWALCLGLLVKRVFFRTTGERLAEAARSVPPGT |
| Ga0307468_1025693642 | 3300031740 | Hardwood Forest Soil | MTRRHWTLAILAVWLLSLGWLVKREVFRSTGARLAEAALAVPPGALFYR |
| Ga0310900_108599641 | 3300031908 | Soil | VSRRQWVVAILIAWVLSLGWLVKREVFRPTGARLASAALA |
| Ga0307471_1000207915 | 3300032180 | Hardwood Forest Soil | VTRRSLTMAILAAWVLSLGWLVKRQVFRPAGARLAEAALSVPPG |
| Ga0307471_1012497421 | 3300032180 | Hardwood Forest Soil | VSRRNWVIAILSAWVLSLGWLVKREVFRPTGARLAEA |
| Ga0307471_1023000761 | 3300032180 | Hardwood Forest Soil | MSRRHWVIAILVAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLFYRLDV |
| Ga0307472_1019141982 | 3300032205 | Hardwood Forest Soil | VTRKRWLIVILAIWVLSLGWLVKREVFRPTGARLAEAALAIPPGALFYR |
| Ga0364940_0128992_1_153 | 3300034164 | Sediment | MSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLD |
| Ga0364942_0047845_1_156 | 3300034165 | Sediment | MTRRDWAIGLLALWGLSLGWLVKREFFRSTGARLAEAALSVPPGALYYRLDL |
| ⦗Top⦘ |