| Basic Information | |
|---|---|
| Family ID | F064548 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTW |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 96.09 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.969 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.188 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 66.41 |
| PF05532 | CsbD | 6.25 |
| PF01797 | Y1_Tnp | 3.91 |
| PF08281 | Sigma70_r4_2 | 2.34 |
| PF02308 | MgtC | 0.78 |
| PF13847 | Methyltransf_31 | 0.78 |
| PF09424 | YqeY | 0.78 |
| PF03734 | YkuD | 0.78 |
| PF01408 | GFO_IDH_MocA | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 6.25 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 3.91 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.38 % |
| Unclassified | root | N/A | 15.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459006|GBPF9FW01EYBTA | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 2170459009|GA8DASG02JQP15 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 2170459012|GOYVCMS02GWHRI | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300000956|JGI10216J12902_106708222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1840 | Open in IMG/M |
| 3300002126|JGI24035J26624_1014519 | Not Available | 804 | Open in IMG/M |
| 3300005179|Ga0066684_11100149 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300005180|Ga0066685_10380302 | Not Available | 980 | Open in IMG/M |
| 3300005187|Ga0066675_10377221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1043 | Open in IMG/M |
| 3300005328|Ga0070676_11164742 | Not Available | 585 | Open in IMG/M |
| 3300005330|Ga0070690_101547082 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300005343|Ga0070687_100565980 | Not Available | 776 | Open in IMG/M |
| 3300005354|Ga0070675_102066881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300005444|Ga0070694_101070304 | Not Available | 672 | Open in IMG/M |
| 3300005446|Ga0066686_11054918 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300005450|Ga0066682_10837665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300005553|Ga0066695_10022141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3568 | Open in IMG/M |
| 3300005558|Ga0066698_10937280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300005561|Ga0066699_11292634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300005719|Ga0068861_101324831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 701 | Open in IMG/M |
| 3300005764|Ga0066903_104445920 | Not Available | 748 | Open in IMG/M |
| 3300005764|Ga0066903_109081119 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300006032|Ga0066696_10469992 | Not Available | 825 | Open in IMG/M |
| 3300006032|Ga0066696_10885259 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
| 3300006796|Ga0066665_11146077 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006871|Ga0075434_102008316 | Not Available | 583 | Open in IMG/M |
| 3300006904|Ga0075424_101993829 | Not Available | 613 | Open in IMG/M |
| 3300007255|Ga0099791_10223702 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300007255|Ga0099791_10477744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300007258|Ga0099793_10154895 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300007265|Ga0099794_10344212 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300009012|Ga0066710_100351569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2179 | Open in IMG/M |
| 3300009143|Ga0099792_10183803 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300009792|Ga0126374_11704519 | Not Available | 524 | Open in IMG/M |
| 3300010043|Ga0126380_10594898 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300010301|Ga0134070_10305049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 608 | Open in IMG/M |
| 3300010323|Ga0134086_10040835 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300010333|Ga0134080_10407304 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010335|Ga0134063_10237098 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300010335|Ga0134063_10434308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
| 3300010360|Ga0126372_11286481 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300010362|Ga0126377_10367894 | Not Available | 1439 | Open in IMG/M |
| 3300010403|Ga0134123_13045736 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300012199|Ga0137383_10737663 | Not Available | 719 | Open in IMG/M |
| 3300012200|Ga0137382_10316654 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300012207|Ga0137381_11060089 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300012207|Ga0137381_11081292 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012207|Ga0137381_11611212 | Not Available | 540 | Open in IMG/M |
| 3300012208|Ga0137376_10726463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 856 | Open in IMG/M |
| 3300012208|Ga0137376_11340024 | Not Available | 606 | Open in IMG/M |
| 3300012212|Ga0150985_117223688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
| 3300012285|Ga0137370_10938169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
| 3300012351|Ga0137386_10336572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1086 | Open in IMG/M |
| 3300012354|Ga0137366_10129477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1905 | Open in IMG/M |
| 3300012357|Ga0137384_10437004 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012359|Ga0137385_10522618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1003 | Open in IMG/M |
| 3300012469|Ga0150984_100195469 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012891|Ga0157305_10036208 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 989 | Open in IMG/M |
| 3300012895|Ga0157309_10041892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1104 | Open in IMG/M |
| 3300012902|Ga0157291_10023878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1250 | Open in IMG/M |
| 3300012908|Ga0157286_10296680 | Not Available | 590 | Open in IMG/M |
| 3300012923|Ga0137359_10357343 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300012925|Ga0137419_10577437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 901 | Open in IMG/M |
| 3300012929|Ga0137404_10878097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 817 | Open in IMG/M |
| 3300012948|Ga0126375_10295568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1122 | Open in IMG/M |
| 3300012951|Ga0164300_10777827 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 590 | Open in IMG/M |
| 3300012986|Ga0164304_11440305 | Not Available | 567 | Open in IMG/M |
| 3300013308|Ga0157375_11545530 | Not Available | 784 | Open in IMG/M |
| 3300014968|Ga0157379_12073311 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300015372|Ga0132256_103489747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
| 3300015374|Ga0132255_103014965 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300016270|Ga0182036_10219331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1406 | Open in IMG/M |
| 3300016270|Ga0182036_11182942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300016294|Ga0182041_10212308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1549 | Open in IMG/M |
| 3300017654|Ga0134069_1132887 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 825 | Open in IMG/M |
| 3300018433|Ga0066667_10662987 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300019356|Ga0173481_10869192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300019361|Ga0173482_10131612 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300019362|Ga0173479_10206034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 834 | Open in IMG/M |
| 3300019885|Ga0193747_1025691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1457 | Open in IMG/M |
| 3300020000|Ga0193692_1020343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1587 | Open in IMG/M |
| 3300020010|Ga0193749_1100850 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300020022|Ga0193733_1164708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300021411|Ga0193709_1110311 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300021415|Ga0193694_1056861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300021560|Ga0126371_11049771 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 955 | Open in IMG/M |
| 3300022534|Ga0224452_1153721 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 708 | Open in IMG/M |
| 3300022756|Ga0222622_10508920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 861 | Open in IMG/M |
| 3300022756|Ga0222622_11191853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 560 | Open in IMG/M |
| 3300024286|Ga0247687_1068653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300024288|Ga0179589_10534171 | All Organisms → cellular organisms → Bacteria → PVC group | 546 | Open in IMG/M |
| 3300025290|Ga0207673_1041782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
| 3300025910|Ga0207684_11533305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300025915|Ga0207693_11301010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300025926|Ga0207659_11829712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300025929|Ga0207664_11743218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300025933|Ga0207706_11316122 | Not Available | 596 | Open in IMG/M |
| 3300025939|Ga0207665_10293261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1214 | Open in IMG/M |
| 3300025939|Ga0207665_10804867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 743 | Open in IMG/M |
| 3300025944|Ga0207661_10052753 | All Organisms → cellular organisms → Bacteria | 3250 | Open in IMG/M |
| 3300025981|Ga0207640_11269691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 657 | Open in IMG/M |
| 3300026067|Ga0207678_10227436 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300026095|Ga0207676_10467755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1192 | Open in IMG/M |
| 3300026310|Ga0209239_1051168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1863 | Open in IMG/M |
| 3300026325|Ga0209152_10164156 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300026328|Ga0209802_1058375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1874 | Open in IMG/M |
| 3300026351|Ga0257170_1043757 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026537|Ga0209157_1055324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2075 | Open in IMG/M |
| 3300026944|Ga0207570_1022002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300027903|Ga0209488_10340475 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300028047|Ga0209526_10590512 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300028799|Ga0307284_10087900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1147 | Open in IMG/M |
| 3300030945|Ga0075373_11538773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300030990|Ga0308178_1108996 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031184|Ga0307499_10074641 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300031446|Ga0170820_15378531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 938 | Open in IMG/M |
| 3300031469|Ga0170819_10815623 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300031469|Ga0170819_13441160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
| 3300031474|Ga0170818_100286140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300031720|Ga0307469_10953876 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031720|Ga0307469_12126479 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300031744|Ga0306918_11210629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300031941|Ga0310912_10840922 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031947|Ga0310909_10491481 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300032017|Ga0310899_10535802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 579 | Open in IMG/M |
| 3300032180|Ga0307471_101540148 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300032205|Ga0307472_100804743 | Not Available | 859 | Open in IMG/M |
| 3300033475|Ga0310811_10404826 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L01_00587120 | 2170459006 | Grass Soil | MKLLARLRSRKNKGGSRLFRYGWKVTLLILIGGAGFAFLFYGTWASTFDMK |
| F47_00443410 | 2170459009 | Grass Soil | MKLLARLRSRKKKVGSRLFRYGWKVTLLILLAGAGFAVFLFYGT |
| N56_08429350 | 2170459012 | Grass Soil | MKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYGTWAQ |
| JGI10216J12902_1067082221 | 3300000956 | Soil | MKFFARLRSRRKKSGNILFRYGWKITLLLLLAGAAF |
| JGI24035J26624_10145193 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | LAERFNEMKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGT |
| Ga0066684_111001492 | 3300005179 | Soil | MKFFARLRSGRKSVTRLFRYGWKSTLLAAVAAVGLAVFLFYGAWAQT |
| Ga0066685_103803023 | 3300005180 | Soil | MKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYG |
| Ga0066675_103772213 | 3300005187 | Soil | MKLFVRLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYG |
| Ga0070676_111647421 | 3300005328 | Miscanthus Rhizosphere | MKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQT |
| Ga0070690_1015470821 | 3300005330 | Switchgrass Rhizosphere | MKVFARLRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFY |
| Ga0070687_1005659803 | 3300005343 | Switchgrass Rhizosphere | MKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYG |
| Ga0070675_1020668811 | 3300005354 | Miscanthus Rhizosphere | MQFFARLRSRKKKGGNRLFRYGWKVTLLILIAGAGFAVFLFYGTWASSFDMKNVGEM |
| Ga0070694_1010703041 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVFARVRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFYGTWA |
| Ga0066686_110549181 | 3300005446 | Soil | MQFFARLRSRKKKGGSRLFRYGWKVTLLILIAGAGFAVFLF |
| Ga0066682_108376651 | 3300005450 | Soil | MKFFALLRSRKRSGSRLFRYGWKVSLLVLLAAAGFAVFLFYGTWAQT |
| Ga0066695_100221411 | 3300005553 | Soil | MKFFARLRSGRKSVTRLFRYGWKSTLLAAVAAVGLAVFLFYGAWAQ |
| Ga0066698_109372801 | 3300005558 | Soil | MQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYG |
| Ga0066699_112926341 | 3300005561 | Soil | MKFFARLRSRKRSGSRLFRYGWKVTLLVLLAAAGFAVFLFYGTWA |
| Ga0068861_1013248313 | 3300005719 | Switchgrass Rhizosphere | MKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFL |
| Ga0066903_1044459201 | 3300005764 | Tropical Forest Soil | MKFFARLRRSKKARGNILFRYGWKITLLLLLAGAVFAVFLFYGTW |
| Ga0066903_1090811191 | 3300005764 | Tropical Forest Soil | MKFFARLRRSKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTWAQTF |
| Ga0066696_104699921 | 3300006032 | Soil | MKLFARLRRPKKARRNILFRYGWKITLFLLLAGAAFAVFLFYGTW |
| Ga0066696_108852592 | 3300006032 | Soil | MKFFARLRSRKKTRGNVLFRYGWKITLFILLAGACFAVFLFYGTW |
| Ga0066665_111460772 | 3300006796 | Soil | MKFFACLRSRKRSGSRLFRYGWKVTLLLLLAAAGFAVFLFYGTWAQ |
| Ga0075434_1020083162 | 3300006871 | Populus Rhizosphere | MKRFARLRRPNKPRGNILFRYGWKITLVVLLVGAVLATFLFYGTWAQTFD |
| Ga0075424_1019938291 | 3300006904 | Populus Rhizosphere | MKRFARLRRPNKPRGNIVFRYGWKITLVVLLVGAVLAT |
| Ga0099791_102237023 | 3300007255 | Vadose Zone Soil | MQFFARLRSRKKKGGSLLFRYGWKATLIILLAGAGFALFLFYGTCAQTFDM |
| Ga0099791_104777441 | 3300007255 | Vadose Zone Soil | MKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAVFAVF |
| Ga0099793_101548953 | 3300007258 | Vadose Zone Soil | MKFFARLRSRKKGGILFRYGWKITLLILLLGAGFAVFLFY |
| Ga0099794_103442122 | 3300007265 | Vadose Zone Soil | MKFFARLRSRKKGGILFRYGWKITLLILLLGAGFAVF |
| Ga0066710_1003515691 | 3300009012 | Grasslands Soil | MKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYGT |
| Ga0099792_101838033 | 3300009143 | Vadose Zone Soil | MKVFARVRRPKKARGNILFRYGWKVTLLLLLAGGVFAVFLFYGTWAQ |
| Ga0126374_117045191 | 3300009792 | Tropical Forest Soil | MKFFARLRRSKKARGNIFFRYGWKITLLLLLAGAVFAVFL |
| Ga0126380_105948983 | 3300010043 | Tropical Forest Soil | MQFLARLRSRKRKGGSRLFRYGWKVSLLILLAGAGFAVFLFYGTWASTFDM |
| Ga0134070_103050491 | 3300010301 | Grasslands Soil | MKFFARLRRPKKARGNILFRYGWKVTLLILAAGAGFAVFLFYG |
| Ga0134086_100408354 | 3300010323 | Grasslands Soil | MQFFARLRSRKKKSGSILFRYGWKITLLILLLGAGFAVFLFYGTWA |
| Ga0134080_104073042 | 3300010333 | Grasslands Soil | MKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYGAW |
| Ga0134063_102370983 | 3300010335 | Grasslands Soil | MQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYGT |
| Ga0134063_104343081 | 3300010335 | Grasslands Soil | MNFFARLRSRKKGGSILFRYGWKITLFILLLGAGFAVFLFYGTWAQT |
| Ga0126372_112864811 | 3300010360 | Tropical Forest Soil | MQFFARLRSRKKKGGSRLFRYGWKITLLILLAGAGFAVFLFYGT |
| Ga0126377_103678941 | 3300010362 | Tropical Forest Soil | MKLLARLRSRKKKRGSRLLRYGWKITLLILLAGAGFAVFLFYGAWASSFDMKN |
| Ga0134123_130457361 | 3300010403 | Terrestrial Soil | MKVFARVQRPKKTRANILFRHGWKVTLLLLVAGAVFAVF |
| Ga0137383_107376632 | 3300012199 | Vadose Zone Soil | MKFFARLRSGRKSVTRLFRYGWKITLLAVVAAGGLAVFLFYGAW |
| Ga0137382_103166544 | 3300012200 | Vadose Zone Soil | MKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFL |
| Ga0137381_110600893 | 3300012207 | Vadose Zone Soil | MKLFARLRRPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYGTWAQTF |
| Ga0137381_110812922 | 3300012207 | Vadose Zone Soil | MKLFARLRCPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYGTWAQTF |
| Ga0137381_116112121 | 3300012207 | Vadose Zone Soil | MKIFGRSGSREKRRSRLFRYGWKITLLVFIVAAALAVILFYGAWAA |
| Ga0137376_107264631 | 3300012208 | Vadose Zone Soil | MKLFARLRRPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYG |
| Ga0137376_113400242 | 3300012208 | Vadose Zone Soil | MKLFARLRRPNKARGNILFRYGWKVALLLLLGGAAFAVFLFYAT |
| Ga0150985_1172236881 | 3300012212 | Avena Fatua Rhizosphere | MKFFARLRRPKKARGNILFGYSWKITLLLLLAGAVFAIFLFYGTWAQTFN |
| Ga0137370_109381691 | 3300012285 | Vadose Zone Soil | MKFFARLRRSKKARGNILFRYGWKITLLLLLAGAVFAVF |
| Ga0137386_103365723 | 3300012351 | Vadose Zone Soil | MKLFARLRHPKKARGNILFRYGWKVALLLLLAGVAFAVFLFYGTWAQTF |
| Ga0137366_101294775 | 3300012354 | Vadose Zone Soil | MKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFL |
| Ga0137384_104370041 | 3300012357 | Vadose Zone Soil | MEFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAGF |
| Ga0137385_105226183 | 3300012359 | Vadose Zone Soil | MIFFARLRSWKKKSGSRLFRYGWKITLLAAIAAGGLAVFLFYGAWAQ |
| Ga0150984_1001954691 | 3300012469 | Avena Fatua Rhizosphere | MKVFARVRRPKKARANIFFRYGWKVTLLLLLAAGVFAIFLFYGTR |
| Ga0157305_100362083 | 3300012891 | Soil | LAERFNEMKYFARLRQKKARGNILFRYGWKVTLLLLLA |
| Ga0157309_100418921 | 3300012895 | Soil | MKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAVFAIFLFY |
| Ga0157291_100238781 | 3300012902 | Soil | LAERFNEMKYFARLRQKKARGNILFRYGWKITLLLLLAGG |
| Ga0157286_102966801 | 3300012908 | Soil | MKLFARLRRPNKSRGNILFRYGWKVTLLLLLAGAVFAVFLF |
| Ga0137359_103573435 | 3300012923 | Vadose Zone Soil | MKFFALLRSRKRSGSRLFRYGWKVSLLLLLAAAGFAVFLFYGT |
| Ga0137419_105774371 | 3300012925 | Vadose Zone Soil | MKLFARLRHPKKARGNILFRYSWKVALLLLLAGAAFAVFLF |
| Ga0137404_108780972 | 3300012929 | Vadose Zone Soil | MKFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAVFAVFLFYGTWAQHST* |
| Ga0126375_102955681 | 3300012948 | Tropical Forest Soil | MKFFVRLRRPNKPRGNILFRYGWKIALLALLVGAGIAV |
| Ga0164300_107778271 | 3300012951 | Soil | MKLFARLRRRNKPLGNTLFRYGWKITLLVLLVGAVLALFLFYGTWEHTFDIKNVVEVP |
| Ga0164304_114403052 | 3300012986 | Soil | MKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAVFAIFLF |
| Ga0157375_115455302 | 3300013308 | Miscanthus Rhizosphere | LAERFNEMKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQTF |
| Ga0157379_120733111 | 3300014968 | Switchgrass Rhizosphere | MKVFARVRRPKKTRGNILFRYGWKVTLLLLLAGAVFAV |
| Ga0132256_1034897472 | 3300015372 | Arabidopsis Rhizosphere | MKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFLFYGTWAQ |
| Ga0132255_1030149652 | 3300015374 | Arabidopsis Rhizosphere | MKVFARVRRPKKTRANILFRYGWKVTLLLLLAGAVFAVFLFYGTW |
| Ga0182036_102193313 | 3300016270 | Soil | MKLFARLRRPNKPRGHILFRYGWKITLVVLLVGALLSVFLFYGTWAQTFD |
| Ga0182036_111829421 | 3300016270 | Soil | MKLFARLRRPNKPRGHILFRYGWKITLVVLLVGALLSVFLFYGTWAQTF |
| Ga0182041_102123081 | 3300016294 | Soil | MKLFARFRSRKQKSGNILFRYGWKVTLLILAVGAGFAVFLF |
| Ga0134069_11328871 | 3300017654 | Grasslands Soil | MKLFARLRSRKQKSGNILFRYGWKVALLILAAGAGFAV |
| Ga0066667_106629871 | 3300018433 | Grasslands Soil | MQFFARLQRSKKSGSALFRYGWKVTLLILLAAAGFAVFLFYGPWAQPF |
| Ga0173481_108691921 | 3300019356 | Soil | MKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFLFYGTWA |
| Ga0173482_101316123 | 3300019361 | Soil | MQLLVRLRSRKKKSGSRLFRYGWKITLLILIAGAGFAVFLFYGTWAS |
| Ga0173479_102060343 | 3300019362 | Soil | MQLLARLRSRKKKGGSRLFRYGWKITLLILLAGAGFAVFLFYGTW |
| Ga0193747_10256913 | 3300019885 | Soil | MQFFARLRSRKKKGGSRLFRYGWKVTLLILIAGAGFAVFLFYGT |
| Ga0193692_10203431 | 3300020000 | Soil | MKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAV |
| Ga0193749_11008502 | 3300020010 | Soil | MKLFARLRSRRQKSGNILFRYGWKITLLILLAAAGFAVFLFYGTW |
| Ga0193733_11647081 | 3300020022 | Soil | MQFFARFRSRKRKGGSRLFRYGWKVTLLILIAGGGFAVFLFYGTWASSFDMKNVGEM |
| Ga0193709_11103112 | 3300021411 | Soil | MKLFARLRSRKQKNGNILFRYGWKITLLILLAGAG |
| Ga0193694_10568611 | 3300021415 | Soil | MKLFALRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTWAQ |
| Ga0126371_110497713 | 3300021560 | Tropical Forest Soil | MKLFARLRRPRKARGNILFRYGWKITLLALLVGAVVAVFLFYG |
| Ga0224452_11537211 | 3300022534 | Groundwater Sediment | MKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAAF |
| Ga0222622_105089201 | 3300022756 | Groundwater Sediment | MKLFARLRSRNSGSRLFRYGWKITLLALIAASGLAVFLFY |
| Ga0222622_111918531 | 3300022756 | Groundwater Sediment | MKLFARLRRPKKARGNILFRYGWRVTLLLLLAGSAFAVFLFYGTWAQSLD |
| Ga0247687_10686531 | 3300024286 | Soil | MKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYGAWA |
| Ga0179589_105341712 | 3300024288 | Vadose Zone Soil | MKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAAFAVFLFY |
| Ga0207673_10417821 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLF |
| Ga0207684_115333052 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFFARLRRSKKARGNIFFRYGWKITLLLLLAGAVFAVFLFYG |
| Ga0207693_113010101 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVFARVRRPKKARANILFRYGWKLTLLLLLAAGVFAIFLF |
| Ga0207659_118297121 | 3300025926 | Miscanthus Rhizosphere | MQFFARLRSRKKKGGNRLFRYGWKVTLLILIAGAGFAVFLFYGTWASSFDMKNVGEMP |
| Ga0207664_117432182 | 3300025929 | Agricultural Soil | MKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLF |
| Ga0207706_113161221 | 3300025933 | Corn Rhizosphere | MKVFARVRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQT |
| Ga0207665_102932611 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLFARLRRTKKARGNILFRYGWKITLLLLLAGAVFAVFLFYGTWAQSFDM |
| Ga0207665_108048671 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFFARLRSRKSGSRLFRYGWKVTLLLLLAGAGFAVFLFY |
| Ga0207661_100527531 | 3300025944 | Corn Rhizosphere | MKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAV |
| Ga0207640_112696911 | 3300025981 | Corn Rhizosphere | MKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLFY |
| Ga0207678_102274363 | 3300026067 | Corn Rhizosphere | MKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFL |
| Ga0207676_104677553 | 3300026095 | Switchgrass Rhizosphere | MKYFARLRQKNARGNILFRYGWKITLLLLLAGAVFAV |
| Ga0209239_10511681 | 3300026310 | Grasslands Soil | MKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYG |
| Ga0209152_101641561 | 3300026325 | Soil | MKFFARLRRPKKARGNILFGYGWKITLLLLLAGAVFA |
| Ga0209802_10583751 | 3300026328 | Soil | MQFFARLRSRKKKSGSILFRYGWKITLLILLLGPGFAVFLFYGTW |
| Ga0257170_10437571 | 3300026351 | Soil | MKLFARLRSRKKKSGNRLFRYGWKVALLVVVAASGL |
| Ga0209157_10553241 | 3300026537 | Soil | MQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAV |
| Ga0207570_10220022 | 3300026944 | Soil | MKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLFYGAWAQT |
| Ga0209701_102078834 | 3300027862 | Vadose Zone Soil | MKFFARARKSKLFRYGWKFTLLALVAAAGLAVFLFYAGWATTFDT |
| Ga0209488_103404751 | 3300027903 | Vadose Zone Soil | MKFFARLRSRKRSGSSLFRYGWKASLLLLLAAAGF |
| Ga0209526_105905122 | 3300028047 | Forest Soil | MQLFARLRSRKQKSGNILFRYGWKITLLILLAAAVFAVFLFYG |
| Ga0307284_100879003 | 3300028799 | Soil | MKVFARVRRPKKARGNILFRYGWKVALLLLLAGAMFAVFLFYG |
| Ga0075373_115387732 | 3300030945 | Soil | MKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYGTWA |
| Ga0308178_11089961 | 3300030990 | Soil | MKVFTRVRRPKKARANILFRYGWKLTLLLLLAGGAFAVFLFYGTW |
| Ga0307499_100746413 | 3300031184 | Soil | MKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTW |
| Ga0170820_153785313 | 3300031446 | Forest Soil | MKVFARLRRPKKARGNILFRYGWKITLLLLLFGAAFAVF |
| Ga0170819_108156233 | 3300031469 | Forest Soil | MKLFARLRRPKKARGNILFRYGWKVALLLLLAGAV |
| Ga0170819_134411601 | 3300031469 | Forest Soil | MKLFVRLRRPKKARGNILFRYGWKLTLLLLLAGAVFAVFLFYGTW |
| Ga0170818_1002861401 | 3300031474 | Forest Soil | MKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYG |
| Ga0307469_109538763 | 3300031720 | Hardwood Forest Soil | MKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYGTW |
| Ga0307469_121264792 | 3300031720 | Hardwood Forest Soil | MKVFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAV |
| Ga0306918_112106292 | 3300031744 | Soil | MKVFARVRRPKKTRANILFRYGWKVTLLLLVVGAAVAVFLVYGTWAQ |
| Ga0310912_108409221 | 3300031941 | Soil | MKFFARLRSRKKSGSRLFRYGWKVSLLVLLGAAGFA |
| Ga0310909_104914813 | 3300031947 | Soil | MKLFARLRRPNKPRGHILFRYGWKITLLVLLVGAVL |
| Ga0310899_105358022 | 3300032017 | Soil | MKVFARVRRPKKTRGNILFRYGWKVTLLLLLAGAVFAVFLFYGTWAQTF |
| Ga0307471_1015401481 | 3300032180 | Hardwood Forest Soil | MKFFARLRSRKRSGSRLFRYGWKITLLVLLGAAGFAVFLFYGT |
| Ga0307472_1008047433 | 3300032205 | Hardwood Forest Soil | MKLFVRLRRPKKARGNILFRYGWKVTLLLLLAGAAFAVFL |
| Ga0310811_104048261 | 3300033475 | Soil | MKFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAGFAVFLFYGTWAQT |
| ⦗Top⦘ |