NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064548

Metagenome / Metatranscriptome Family F064548

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064548
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 43 residues
Representative Sequence MKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTW
Number of Associated Samples 116
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.79 %
% of genes near scaffold ends (potentially truncated) 98.44 %
% of genes from short scaffolds (< 2000 bps) 96.09 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.375 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.969 % of family members)
Environment Ontology (ENVO) Unclassified
(29.688 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.188 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.58%    β-sheet: 0.00%    Coil/Unstructured: 53.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00462Glutaredoxin 66.41
PF05532CsbD 6.25
PF01797Y1_Tnp 3.91
PF08281Sigma70_r4_2 2.34
PF02308MgtC 0.78
PF13847Methyltransf_31 0.78
PF09424YqeY 0.78
PF03734YkuD 0.78
PF01408GFO_IDH_MocA 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 6.25
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 3.91
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 0.78
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.78
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.78
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.38 %
UnclassifiedrootN/A15.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459006|GBPF9FW01EYBTAAll Organisms → cellular organisms → Bacteria514Open in IMG/M
2170459009|GA8DASG02JQP15All Organisms → cellular organisms → Bacteria520Open in IMG/M
2170459012|GOYVCMS02GWHRIAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium523Open in IMG/M
3300000956|JGI10216J12902_106708222All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1840Open in IMG/M
3300002126|JGI24035J26624_1014519Not Available804Open in IMG/M
3300005179|Ga0066684_11100149All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300005180|Ga0066685_10380302Not Available980Open in IMG/M
3300005187|Ga0066675_10377221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1043Open in IMG/M
3300005328|Ga0070676_11164742Not Available585Open in IMG/M
3300005330|Ga0070690_101547082All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300005343|Ga0070687_100565980Not Available776Open in IMG/M
3300005354|Ga0070675_102066881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300005444|Ga0070694_101070304Not Available672Open in IMG/M
3300005446|Ga0066686_11054918All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300005450|Ga0066682_10837665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium553Open in IMG/M
3300005553|Ga0066695_10022141All Organisms → cellular organisms → Bacteria → Proteobacteria3568Open in IMG/M
3300005558|Ga0066698_10937280All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300005561|Ga0066699_11292634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300005719|Ga0068861_101324831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium701Open in IMG/M
3300005764|Ga0066903_104445920Not Available748Open in IMG/M
3300005764|Ga0066903_109081119All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300006032|Ga0066696_10469992Not Available825Open in IMG/M
3300006032|Ga0066696_10885259All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium568Open in IMG/M
3300006796|Ga0066665_11146077All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006871|Ga0075434_102008316Not Available583Open in IMG/M
3300006904|Ga0075424_101993829Not Available613Open in IMG/M
3300007255|Ga0099791_10223702All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300007255|Ga0099791_10477744All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300007258|Ga0099793_10154895All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300007265|Ga0099794_10344212All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300009012|Ga0066710_100351569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2179Open in IMG/M
3300009143|Ga0099792_10183803All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300009792|Ga0126374_11704519Not Available524Open in IMG/M
3300010043|Ga0126380_10594898All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300010301|Ga0134070_10305049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium608Open in IMG/M
3300010323|Ga0134086_10040835All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300010333|Ga0134080_10407304All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300010335|Ga0134063_10237098All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300010335|Ga0134063_10434308All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300010360|Ga0126372_11286481All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300010362|Ga0126377_10367894Not Available1439Open in IMG/M
3300010403|Ga0134123_13045736All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300012199|Ga0137383_10737663Not Available719Open in IMG/M
3300012200|Ga0137382_10316654All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300012207|Ga0137381_11060089All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium698Open in IMG/M
3300012207|Ga0137381_11081292All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300012207|Ga0137381_11611212Not Available540Open in IMG/M
3300012208|Ga0137376_10726463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria856Open in IMG/M
3300012208|Ga0137376_11340024Not Available606Open in IMG/M
3300012212|Ga0150985_117223688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium534Open in IMG/M
3300012285|Ga0137370_10938169All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium534Open in IMG/M
3300012351|Ga0137386_10336572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1086Open in IMG/M
3300012354|Ga0137366_10129477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1905Open in IMG/M
3300012357|Ga0137384_10437004All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300012359|Ga0137385_10522618All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus1003Open in IMG/M
3300012469|Ga0150984_100195469All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300012891|Ga0157305_10036208All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia989Open in IMG/M
3300012895|Ga0157309_10041892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1104Open in IMG/M
3300012902|Ga0157291_10023878All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1250Open in IMG/M
3300012908|Ga0157286_10296680Not Available590Open in IMG/M
3300012923|Ga0137359_10357343All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300012925|Ga0137419_10577437All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae901Open in IMG/M
3300012929|Ga0137404_10878097All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia817Open in IMG/M
3300012948|Ga0126375_10295568All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1122Open in IMG/M
3300012951|Ga0164300_10777827All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium590Open in IMG/M
3300012986|Ga0164304_11440305Not Available567Open in IMG/M
3300013308|Ga0157375_11545530Not Available784Open in IMG/M
3300014968|Ga0157379_12073311All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium563Open in IMG/M
3300015372|Ga0132256_103489747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium529Open in IMG/M
3300015374|Ga0132255_103014965All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300016270|Ga0182036_10219331All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1406Open in IMG/M
3300016270|Ga0182036_11182942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium635Open in IMG/M
3300016294|Ga0182041_10212308All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1549Open in IMG/M
3300017654|Ga0134069_1132887All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium825Open in IMG/M
3300018433|Ga0066667_10662987All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300019356|Ga0173481_10869192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium505Open in IMG/M
3300019361|Ga0173482_10131612All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300019362|Ga0173479_10206034All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia834Open in IMG/M
3300019885|Ga0193747_1025691All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1457Open in IMG/M
3300020000|Ga0193692_1020343All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1587Open in IMG/M
3300020010|Ga0193749_1100850All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium515Open in IMG/M
3300020022|Ga0193733_1164708All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
3300021411|Ga0193709_1110311All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300021415|Ga0193694_1056861All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300021560|Ga0126371_11049771All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia955Open in IMG/M
3300022534|Ga0224452_1153721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium708Open in IMG/M
3300022756|Ga0222622_10508920All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus861Open in IMG/M
3300022756|Ga0222622_11191853All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M
3300024286|Ga0247687_1068653All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium542Open in IMG/M
3300024288|Ga0179589_10534171All Organisms → cellular organisms → Bacteria → PVC group546Open in IMG/M
3300025290|Ga0207673_1041782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium644Open in IMG/M
3300025910|Ga0207684_11533305All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300025915|Ga0207693_11301010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300025926|Ga0207659_11829712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium515Open in IMG/M
3300025929|Ga0207664_11743218All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300025933|Ga0207706_11316122Not Available596Open in IMG/M
3300025939|Ga0207665_10293261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1214Open in IMG/M
3300025939|Ga0207665_10804867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia743Open in IMG/M
3300025944|Ga0207661_10052753All Organisms → cellular organisms → Bacteria3250Open in IMG/M
3300025981|Ga0207640_11269691All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium657Open in IMG/M
3300026067|Ga0207678_10227436All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300026095|Ga0207676_10467755All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae1192Open in IMG/M
3300026310|Ga0209239_1051168All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1863Open in IMG/M
3300026325|Ga0209152_10164156All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300026328|Ga0209802_1058375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1874Open in IMG/M
3300026351|Ga0257170_1043757All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300026537|Ga0209157_1055324All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2075Open in IMG/M
3300026944|Ga0207570_1022002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300027903|Ga0209488_10340475All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300028047|Ga0209526_10590512All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300028799|Ga0307284_10087900All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae1147Open in IMG/M
3300030945|Ga0075373_11538773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium516Open in IMG/M
3300030990|Ga0308178_1108996All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031184|Ga0307499_10074641All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031446|Ga0170820_15378531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia938Open in IMG/M
3300031469|Ga0170819_10815623All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300031469|Ga0170819_13441160All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium637Open in IMG/M
3300031474|Ga0170818_100286140All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium535Open in IMG/M
3300031720|Ga0307469_10953876All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300031720|Ga0307469_12126479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium546Open in IMG/M
3300031744|Ga0306918_11210629All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium583Open in IMG/M
3300031941|Ga0310912_10840922All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031947|Ga0310909_10491481All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300032017|Ga0310899_10535802All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium579Open in IMG/M
3300032180|Ga0307471_101540148All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300032205|Ga0307472_100804743Not Available859Open in IMG/M
3300033475|Ga0310811_10404826All Organisms → cellular organisms → Bacteria1491Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.12%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.12%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.34%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.56%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026944Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L01_005871202170459006Grass SoilMKLLARLRSRKNKGGSRLFRYGWKVTLLILIGGAGFAFLFYGTWASTFDMK
F47_004434102170459009Grass SoilMKLLARLRSRKKKVGSRLFRYGWKVTLLILLAGAGFAVFLFYGT
N56_084293502170459012Grass SoilMKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYGTWAQ
JGI10216J12902_10670822213300000956SoilMKFFARLRSRRKKSGNILFRYGWKITLLLLLAGAAF
JGI24035J26624_101451933300002126Corn, Switchgrass And Miscanthus RhizosphereLAERFNEMKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGT
Ga0066684_1110014923300005179SoilMKFFARLRSGRKSVTRLFRYGWKSTLLAAVAAVGLAVFLFYGAWAQT
Ga0066685_1038030233300005180SoilMKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYG
Ga0066675_1037722133300005187SoilMKLFVRLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYG
Ga0070676_1116474213300005328Miscanthus RhizosphereMKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQT
Ga0070690_10154708213300005330Switchgrass RhizosphereMKVFARLRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFY
Ga0070687_10056598033300005343Switchgrass RhizosphereMKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYG
Ga0070675_10206688113300005354Miscanthus RhizosphereMQFFARLRSRKKKGGNRLFRYGWKVTLLILIAGAGFAVFLFYGTWASSFDMKNVGEM
Ga0070694_10107030413300005444Corn, Switchgrass And Miscanthus RhizosphereMKVFARVRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFYGTWA
Ga0066686_1105491813300005446SoilMQFFARLRSRKKKGGSRLFRYGWKVTLLILIAGAGFAVFLF
Ga0066682_1083766513300005450SoilMKFFALLRSRKRSGSRLFRYGWKVSLLVLLAAAGFAVFLFYGTWAQT
Ga0066695_1002214113300005553SoilMKFFARLRSGRKSVTRLFRYGWKSTLLAAVAAVGLAVFLFYGAWAQ
Ga0066698_1093728013300005558SoilMQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYG
Ga0066699_1129263413300005561SoilMKFFARLRSRKRSGSRLFRYGWKVTLLVLLAAAGFAVFLFYGTWA
Ga0068861_10132483133300005719Switchgrass RhizosphereMKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFL
Ga0066903_10444592013300005764Tropical Forest SoilMKFFARLRRSKKARGNILFRYGWKITLLLLLAGAVFAVFLFYGTW
Ga0066903_10908111913300005764Tropical Forest SoilMKFFARLRRSKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTWAQTF
Ga0066696_1046999213300006032SoilMKLFARLRRPKKARRNILFRYGWKITLFLLLAGAAFAVFLFYGTW
Ga0066696_1088525923300006032SoilMKFFARLRSRKKTRGNVLFRYGWKITLFILLAGACFAVFLFYGTW
Ga0066665_1114607723300006796SoilMKFFACLRSRKRSGSRLFRYGWKVTLLLLLAAAGFAVFLFYGTWAQ
Ga0075434_10200831623300006871Populus RhizosphereMKRFARLRRPNKPRGNILFRYGWKITLVVLLVGAVLATFLFYGTWAQTFD
Ga0075424_10199382913300006904Populus RhizosphereMKRFARLRRPNKPRGNIVFRYGWKITLVVLLVGAVLAT
Ga0099791_1022370233300007255Vadose Zone SoilMQFFARLRSRKKKGGSLLFRYGWKATLIILLAGAGFALFLFYGTCAQTFDM
Ga0099791_1047774413300007255Vadose Zone SoilMKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAVFAVF
Ga0099793_1015489533300007258Vadose Zone SoilMKFFARLRSRKKGGILFRYGWKITLLILLLGAGFAVFLFY
Ga0099794_1034421223300007265Vadose Zone SoilMKFFARLRSRKKGGILFRYGWKITLLILLLGAGFAVF
Ga0066710_10035156913300009012Grasslands SoilMKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYGT
Ga0099792_1018380333300009143Vadose Zone SoilMKVFARVRRPKKARGNILFRYGWKVTLLLLLAGGVFAVFLFYGTWAQ
Ga0126374_1170451913300009792Tropical Forest SoilMKFFARLRRSKKARGNIFFRYGWKITLLLLLAGAVFAVFL
Ga0126380_1059489833300010043Tropical Forest SoilMQFLARLRSRKRKGGSRLFRYGWKVSLLILLAGAGFAVFLFYGTWASTFDM
Ga0134070_1030504913300010301Grasslands SoilMKFFARLRRPKKARGNILFRYGWKVTLLILAAGAGFAVFLFYG
Ga0134086_1004083543300010323Grasslands SoilMQFFARLRSRKKKSGSILFRYGWKITLLILLLGAGFAVFLFYGTWA
Ga0134080_1040730423300010333Grasslands SoilMKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYGAW
Ga0134063_1023709833300010335Grasslands SoilMQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYGT
Ga0134063_1043430813300010335Grasslands SoilMNFFARLRSRKKGGSILFRYGWKITLFILLLGAGFAVFLFYGTWAQT
Ga0126372_1128648113300010360Tropical Forest SoilMQFFARLRSRKKKGGSRLFRYGWKITLLILLAGAGFAVFLFYGT
Ga0126377_1036789413300010362Tropical Forest SoilMKLLARLRSRKKKRGSRLLRYGWKITLLILLAGAGFAVFLFYGAWASSFDMKN
Ga0134123_1304573613300010403Terrestrial SoilMKVFARVQRPKKTRANILFRHGWKVTLLLLVAGAVFAVF
Ga0137383_1073766323300012199Vadose Zone SoilMKFFARLRSGRKSVTRLFRYGWKITLLAVVAAGGLAVFLFYGAW
Ga0137382_1031665443300012200Vadose Zone SoilMKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFL
Ga0137381_1106008933300012207Vadose Zone SoilMKLFARLRRPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYGTWAQTF
Ga0137381_1108129223300012207Vadose Zone SoilMKLFARLRCPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYGTWAQTF
Ga0137381_1161121213300012207Vadose Zone SoilMKIFGRSGSREKRRSRLFRYGWKITLLVFIVAAALAVILFYGAWAA
Ga0137376_1072646313300012208Vadose Zone SoilMKLFARLRRPKKARGNILFRYGWKVALLLLLAGAAFAVFLFYG
Ga0137376_1134002423300012208Vadose Zone SoilMKLFARLRRPNKARGNILFRYGWKVALLLLLGGAAFAVFLFYAT
Ga0150985_11722368813300012212Avena Fatua RhizosphereMKFFARLRRPKKARGNILFGYSWKITLLLLLAGAVFAIFLFYGTWAQTFN
Ga0137370_1093816913300012285Vadose Zone SoilMKFFARLRRSKKARGNILFRYGWKITLLLLLAGAVFAVF
Ga0137386_1033657233300012351Vadose Zone SoilMKLFARLRHPKKARGNILFRYGWKVALLLLLAGVAFAVFLFYGTWAQTF
Ga0137366_1012947753300012354Vadose Zone SoilMKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFL
Ga0137384_1043700413300012357Vadose Zone SoilMEFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAGF
Ga0137385_1052261833300012359Vadose Zone SoilMIFFARLRSWKKKSGSRLFRYGWKITLLAAIAAGGLAVFLFYGAWAQ
Ga0150984_10019546913300012469Avena Fatua RhizosphereMKVFARVRRPKKARANIFFRYGWKVTLLLLLAAGVFAIFLFYGTR
Ga0157305_1003620833300012891SoilLAERFNEMKYFARLRQKKARGNILFRYGWKVTLLLLLA
Ga0157309_1004189213300012895SoilMKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAVFAIFLFY
Ga0157291_1002387813300012902SoilLAERFNEMKYFARLRQKKARGNILFRYGWKITLLLLLAGG
Ga0157286_1029668013300012908SoilMKLFARLRRPNKSRGNILFRYGWKVTLLLLLAGAVFAVFLF
Ga0137359_1035734353300012923Vadose Zone SoilMKFFALLRSRKRSGSRLFRYGWKVSLLLLLAAAGFAVFLFYGT
Ga0137419_1057743713300012925Vadose Zone SoilMKLFARLRHPKKARGNILFRYSWKVALLLLLAGAAFAVFLF
Ga0137404_1087809723300012929Vadose Zone SoilMKFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAVFAVFLFYGTWAQHST*
Ga0126375_1029556813300012948Tropical Forest SoilMKFFVRLRRPNKPRGNILFRYGWKIALLALLVGAGIAV
Ga0164300_1077782713300012951SoilMKLFARLRRRNKPLGNTLFRYGWKITLLVLLVGAVLALFLFYGTWEHTFDIKNVVEVP
Ga0164304_1144030523300012986SoilMKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAVFAIFLF
Ga0157375_1154553023300013308Miscanthus RhizosphereLAERFNEMKYFARLRQKKPRGNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQTF
Ga0157379_1207331113300014968Switchgrass RhizosphereMKVFARVRRPKKTRGNILFRYGWKVTLLLLLAGAVFAV
Ga0132256_10348974723300015372Arabidopsis RhizosphereMKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFLFYGTWAQ
Ga0132255_10301496523300015374Arabidopsis RhizosphereMKVFARVRRPKKTRANILFRYGWKVTLLLLLAGAVFAVFLFYGTW
Ga0182036_1021933133300016270SoilMKLFARLRRPNKPRGHILFRYGWKITLVVLLVGALLSVFLFYGTWAQTFD
Ga0182036_1118294213300016270SoilMKLFARLRRPNKPRGHILFRYGWKITLVVLLVGALLSVFLFYGTWAQTF
Ga0182041_1021230813300016294SoilMKLFARFRSRKQKSGNILFRYGWKVTLLILAVGAGFAVFLF
Ga0134069_113288713300017654Grasslands SoilMKLFARLRSRKQKSGNILFRYGWKVALLILAAGAGFAV
Ga0066667_1066298713300018433Grasslands SoilMQFFARLQRSKKSGSALFRYGWKVTLLILLAAAGFAVFLFYGPWAQPF
Ga0173481_1086919213300019356SoilMKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFLFYGTWA
Ga0173482_1013161233300019361SoilMQLLVRLRSRKKKSGSRLFRYGWKITLLILIAGAGFAVFLFYGTWAS
Ga0173479_1020603433300019362SoilMQLLARLRSRKKKGGSRLFRYGWKITLLILLAGAGFAVFLFYGTW
Ga0193747_102569133300019885SoilMQFFARLRSRKKKGGSRLFRYGWKVTLLILIAGAGFAVFLFYGT
Ga0193692_102034313300020000SoilMKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAV
Ga0193749_110085023300020010SoilMKLFARLRSRRQKSGNILFRYGWKITLLILLAAAGFAVFLFYGTW
Ga0193733_116470813300020022SoilMQFFARFRSRKRKGGSRLFRYGWKVTLLILIAGGGFAVFLFYGTWASSFDMKNVGEM
Ga0193709_111031123300021411SoilMKLFARLRSRKQKNGNILFRYGWKITLLILLAGAG
Ga0193694_105686113300021415SoilMKLFALRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTWAQ
Ga0126371_1104977133300021560Tropical Forest SoilMKLFARLRRPRKARGNILFRYGWKITLLALLVGAVVAVFLFYG
Ga0224452_115372113300022534Groundwater SedimentMKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAAF
Ga0222622_1050892013300022756Groundwater SedimentMKLFARLRSRNSGSRLFRYGWKITLLALIAASGLAVFLFY
Ga0222622_1119185313300022756Groundwater SedimentMKLFARLRRPKKARGNILFRYGWRVTLLLLLAGSAFAVFLFYGTWAQSLD
Ga0247687_106865313300024286SoilMKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLFYGAWA
Ga0179589_1053417123300024288Vadose Zone SoilMKLFARLRRPKKARGNILFRYGWKVTLLLLLAGAAFAVFLFY
Ga0207673_104178213300025290Corn, Switchgrass And Miscanthus RhizosphereMKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLF
Ga0207684_1153330523300025910Corn, Switchgrass And Miscanthus RhizosphereMKFFARLRRSKKARGNIFFRYGWKITLLLLLAGAVFAVFLFYG
Ga0207693_1130101013300025915Corn, Switchgrass And Miscanthus RhizosphereMKVFARVRRPKKARANILFRYGWKLTLLLLLAAGVFAIFLF
Ga0207659_1182971213300025926Miscanthus RhizosphereMQFFARLRSRKKKGGNRLFRYGWKVTLLILIAGAGFAVFLFYGTWASSFDMKNVGEMP
Ga0207664_1174321823300025929Agricultural SoilMKFFARLRPGKKKSGNRLFRYGWKITLLAVVVAGGFAVFLF
Ga0207706_1131612213300025933Corn RhizosphereMKVFARVRRPKKARTNILFRYGWKVTLLLLLAGAAFAVFLFYGTWAQT
Ga0207665_1029326113300025939Corn, Switchgrass And Miscanthus RhizosphereMKLFARLRRTKKARGNILFRYGWKITLLLLLAGAVFAVFLFYGTWAQSFDM
Ga0207665_1080486713300025939Corn, Switchgrass And Miscanthus RhizosphereMKFFARLRSRKSGSRLFRYGWKVTLLLLLAGAGFAVFLFY
Ga0207661_1005275313300025944Corn RhizosphereMKVFARVRRPKKARANVLFRYGWKVTLLVLLAGAV
Ga0207640_1126969113300025981Corn RhizosphereMKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLFY
Ga0207678_1022743633300026067Corn RhizosphereMKVFARVRRPKKARANILFRYGWKVTLLLLLAGAVFAVFL
Ga0207676_1046775533300026095Switchgrass RhizosphereMKYFARLRQKNARGNILFRYGWKITLLLLLAGAVFAV
Ga0209239_105116813300026310Grasslands SoilMKLFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAVFLFYG
Ga0209152_1016415613300026325SoilMKFFARLRRPKKARGNILFGYGWKITLLLLLAGAVFA
Ga0209802_105837513300026328SoilMQFFARLRSRKKKSGSILFRYGWKITLLILLLGPGFAVFLFYGTW
Ga0257170_104375713300026351SoilMKLFARLRSRKKKSGNRLFRYGWKVALLVVVAASGL
Ga0209157_105532413300026537SoilMQFFARLRSRKKQSGNILFRYGWKITLLILLAAAGFAV
Ga0207570_102200223300026944SoilMKLFARLRSRSRGSRLFRYGWKITLLAFIAAGGLAVFLFYGAWAQT
Ga0209701_1020788343300027862Vadose Zone SoilMKFFARARKSKLFRYGWKFTLLALVAAAGLAVFLFYAGWATTFDT
Ga0209488_1034047513300027903Vadose Zone SoilMKFFARLRSRKRSGSSLFRYGWKASLLLLLAAAGF
Ga0209526_1059051223300028047Forest SoilMQLFARLRSRKQKSGNILFRYGWKITLLILLAAAVFAVFLFYG
Ga0307284_1008790033300028799SoilMKVFARVRRPKKARGNILFRYGWKVALLLLLAGAMFAVFLFYG
Ga0075373_1153877323300030945SoilMKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYGTWA
Ga0308178_110899613300030990SoilMKVFTRVRRPKKARANILFRYGWKLTLLLLLAGGAFAVFLFYGTW
Ga0307499_1007464133300031184SoilMKLFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAVFLFYGTW
Ga0170820_1537853133300031446Forest SoilMKVFARLRRPKKARGNILFRYGWKITLLLLLFGAAFAVF
Ga0170819_1081562333300031469Forest SoilMKLFARLRRPKKARGNILFRYGWKVALLLLLAGAV
Ga0170819_1344116013300031469Forest SoilMKLFVRLRRPKKARGNILFRYGWKLTLLLLLAGAVFAVFLFYGTW
Ga0170818_10028614013300031474Forest SoilMKVFARVRRPKKARANILFRYGWKITLLLLLAAGVFAIFLFYG
Ga0307469_1095387633300031720Hardwood Forest SoilMKLFARLRSRKQKSGNILFRYGWKVTLLILAAGAGFAVFLFYGTW
Ga0307469_1212647923300031720Hardwood Forest SoilMKVFARLRRPKKARGNILFRYGWKITLLLLLAGAAFAV
Ga0306918_1121062923300031744SoilMKVFARVRRPKKTRANILFRYGWKVTLLLLVVGAAVAVFLVYGTWAQ
Ga0310912_1084092213300031941SoilMKFFARLRSRKKSGSRLFRYGWKVSLLVLLGAAGFA
Ga0310909_1049148133300031947SoilMKLFARLRRPNKPRGHILFRYGWKITLLVLLVGAVL
Ga0310899_1053580223300032017SoilMKVFARVRRPKKTRGNILFRYGWKVTLLLLLAGAVFAVFLFYGTWAQTF
Ga0307471_10154014813300032180Hardwood Forest SoilMKFFARLRSRKRSGSRLFRYGWKITLLVLLGAAGFAVFLFYGT
Ga0307472_10080474333300032205Hardwood Forest SoilMKLFVRLRRPKKARGNILFRYGWKVTLLLLLAGAAFAVFL
Ga0310811_1040482613300033475SoilMKFFARLRSRKKKGGSRLFRYGWKVTLLILLAGAGFAVFLFYGTWAQT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.