| Basic Information | |
|---|---|
| Family ID | F064534 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 48 residues |
| Representative Sequence | IDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.67 % |
| % of genes near scaffold ends (potentially truncated) | 90.62 % |
| % of genes from short scaffolds (< 2000 bps) | 85.94 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.188 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (11.719 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 0.00% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01553 | Acyltransferase | 56.25 |
| PF02824 | TGS | 2.34 |
| PF01401 | Peptidase_M2 | 2.34 |
| PF07973 | tRNA_SAD | 1.56 |
| PF04326 | AlbA_2 | 0.78 |
| PF07730 | HisKA_3 | 0.78 |
| PF13751 | DDE_Tnp_1_6 | 0.78 |
| PF04978 | DUF664 | 0.78 |
| PF00080 | Sod_Cu | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.78 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.78 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.78 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.78 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.19 % |
| Unclassified | root | N/A | 7.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1018458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100590679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300002561|JGI25384J37096_10112338 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10371273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300004080|Ga0062385_10854055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 600 | Open in IMG/M |
| 3300004152|Ga0062386_100070734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2651 | Open in IMG/M |
| 3300005166|Ga0066674_10533207 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005180|Ga0066685_11017129 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005332|Ga0066388_103302515 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005439|Ga0070711_101112387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300005536|Ga0070697_100344735 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300005546|Ga0070696_102011201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 502 | Open in IMG/M |
| 3300005552|Ga0066701_10880178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 531 | Open in IMG/M |
| 3300005555|Ga0066692_11027060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005558|Ga0066698_11074206 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005569|Ga0066705_10257085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300005575|Ga0066702_10534762 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005921|Ga0070766_10663142 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300006028|Ga0070717_11954237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300006052|Ga0075029_100382456 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006797|Ga0066659_11421190 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006800|Ga0066660_11305233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300009137|Ga0066709_103373458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009137|Ga0066709_103741766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009640|Ga0116126_1124561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300009640|Ga0116126_1139274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300009683|Ga0116224_10068592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
| 3300009698|Ga0116216_10136459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1508 | Open in IMG/M |
| 3300009824|Ga0116219_10630150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 588 | Open in IMG/M |
| 3300009839|Ga0116223_10624295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 621 | Open in IMG/M |
| 3300010336|Ga0134071_10365110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300010341|Ga0074045_10617340 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300010343|Ga0074044_10239104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1201 | Open in IMG/M |
| 3300010379|Ga0136449_100398215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2445 | Open in IMG/M |
| 3300011271|Ga0137393_11024306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300011271|Ga0137393_11056418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012004|Ga0120134_1085781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012096|Ga0137389_10171809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1789 | Open in IMG/M |
| 3300012349|Ga0137387_10575586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 817 | Open in IMG/M |
| 3300014158|Ga0181521_10236840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300015245|Ga0137409_10211227 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300016702|Ga0181511_1386773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1088 | Open in IMG/M |
| 3300016730|Ga0181515_1013802 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
| 3300016750|Ga0181505_10429910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300017927|Ga0187824_10043769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300017929|Ga0187849_1030402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2793 | Open in IMG/M |
| 3300017939|Ga0187775_10055026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1226 | Open in IMG/M |
| 3300017940|Ga0187853_10152721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300017946|Ga0187879_10308528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300017995|Ga0187816_10119417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300018004|Ga0187865_1155048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300018009|Ga0187884_10080566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 1449 | Open in IMG/M |
| 3300018012|Ga0187810_10456076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300018016|Ga0187880_1484665 | Not Available | 507 | Open in IMG/M |
| 3300018018|Ga0187886_1376153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300018023|Ga0187889_10378984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 615 | Open in IMG/M |
| 3300018028|Ga0184608_10493547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018037|Ga0187883_10543246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 601 | Open in IMG/M |
| 3300018038|Ga0187855_10283502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300018040|Ga0187862_10477380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300018047|Ga0187859_10126208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300018086|Ga0187769_10473146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300018088|Ga0187771_11525559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 567 | Open in IMG/M |
| 3300018090|Ga0187770_10779013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300018468|Ga0066662_11681160 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300019879|Ga0193723_1012482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2688 | Open in IMG/M |
| 3300020022|Ga0193733_1051520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300020581|Ga0210399_11565362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 509 | Open in IMG/M |
| 3300021377|Ga0213874_10357831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300021405|Ga0210387_10684733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300022557|Ga0212123_10610554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300022557|Ga0212123_10868660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300025439|Ga0208323_1029579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1100 | Open in IMG/M |
| 3300025527|Ga0208714_1065330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300025576|Ga0208820_1080731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300025915|Ga0207693_10997501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300025928|Ga0207700_11271075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300026322|Ga0209687_1215859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300026376|Ga0257167_1048469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300027521|Ga0209524_1052272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. JS623 | 861 | Open in IMG/M |
| 3300027795|Ga0209139_10101998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1010 | Open in IMG/M |
| 3300027803|Ga0209910_10037737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 550 | Open in IMG/M |
| 3300027824|Ga0209040_10155664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300027855|Ga0209693_10043580 | Not Available | 2206 | Open in IMG/M |
| 3300027867|Ga0209167_10243162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300027875|Ga0209283_10086891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2034 | Open in IMG/M |
| 3300027889|Ga0209380_10652041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300027894|Ga0209068_10295525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 908 | Open in IMG/M |
| 3300027895|Ga0209624_10436728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300027910|Ga0209583_10216238 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027911|Ga0209698_10076555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2846 | Open in IMG/M |
| 3300027911|Ga0209698_10668200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 793 | Open in IMG/M |
| 3300027915|Ga0209069_10275808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300027915|Ga0209069_10984933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300028808|Ga0302228_10393161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300029903|Ga0247271_112141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300030047|Ga0302286_10655539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300030399|Ga0311353_10936611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300030494|Ga0310037_10095443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300030659|Ga0316363_10320059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 616 | Open in IMG/M |
| 3300030879|Ga0265765_1025379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300031057|Ga0170834_109765385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300031128|Ga0170823_16987109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300031231|Ga0170824_122938613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300031521|Ga0311364_10035242 | All Organisms → cellular organisms → Bacteria | 5428 | Open in IMG/M |
| 3300031754|Ga0307475_11198814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300031754|Ga0307475_11495419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031942|Ga0310916_10176603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1777 | Open in IMG/M |
| 3300031962|Ga0307479_11007451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300032160|Ga0311301_10089339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6184 | Open in IMG/M |
| 3300032205|Ga0307472_101206070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300032205|Ga0307472_101810329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300032205|Ga0307472_102726931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300032782|Ga0335082_11309378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300032805|Ga0335078_10715853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300032829|Ga0335070_10462784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1206 | Open in IMG/M |
| 3300033402|Ga0326728_11041901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300033412|Ga0310810_10873315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300033807|Ga0314866_005628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1514 | Open in IMG/M |
| 3300033890|Ga0334810_064001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.91% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.34% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.56% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033890 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10184581 | 3300000651 | Forest Soil | DIDQASDVPSALAQAHAIAATRGLVVVTGSIYIVGEAMRTLGARIE* |
| JGIcombinedJ26739_1005906791 | 3300002245 | Forest Soil | INIEEAEDVASALDQARKLAGKEGLIVVTGSIYVVGEAMRMLDIRI* |
| JGI25384J37096_101123381 | 3300002561 | Grasslands Soil | QIETAPDVAAALAQARASAGSSGVAVVTGSIYVVGEAMRRLGARI* |
| JGIcombinedJ51221_103712732 | 3300003505 | Forest Soil | EIDEAPDLTSALAKASVAAGTKGLVVVTGSIYIVGEAMRSIGVRIG* |
| Ga0062385_108540551 | 3300004080 | Bog Forest Soil | ISASTEIKTTADVALALDRARAVTGQHGVVVITGSIYVVGEAMRILGVRI* |
| Ga0062386_1000707344 | 3300004152 | Bog Forest Soil | VEISEAENVAGAIEEAERLAGPNGLVVVCGSIYIVGEAMRVMGIGI* |
| Ga0066674_105332071 | 3300005166 | Soil | QIETAPDVAAALAQARASAGSSGVVVVTGSIYVVGEAMRRLGARI* |
| Ga0066685_110171292 | 3300005180 | Soil | QIETAPDVAAALAQARASAGSSGVVVVTGSIYVVGEAMRLLGARI* |
| Ga0066388_1033025152 | 3300005332 | Tropical Forest Soil | AEIETAPDVAAALAQARRLAGSEEIVVVTGSIYVVGEAMRLLGARI* |
| Ga0070711_1011123871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ASEIREASKRVSVDIDETPDVASALARARVVAGTRGLVVVTGSIYIVGEAMRSLGARIG* |
| Ga0070735_108069872 | 3300005534 | Surface Soil | EDVASALGRARSLAGSSGIVVVTGSIYIVGEAMHALGVKV* |
| Ga0070697_1003447351 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGVDIDEAEDVASALERARKVAGAGGLVVVTGSIYVVGEAMRMLGVRI* |
| Ga0070696_1020112011 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EIREAAAHTSVVMEEAADVAKALERARISAGSNGIVVVTGSIYIVGEAMQALGIRI* |
| Ga0066701_108801781 | 3300005552 | Soil | EIREAAAHTSVAIEEALDVAAALERARIPAGTNGVVVVTGSIYIVGEAMQALGIRI* |
| Ga0066692_110270601 | 3300005555 | Soil | PDVASALARARVVAGTRGLVVVTGSIYIVGEAMRSLGARIG* |
| Ga0066698_110742062 | 3300005558 | Soil | PDVAAALAQAGALAGSDGVVVVTGSIYVVGEAMRLLGARI* |
| Ga0066705_102570851 | 3300005569 | Soil | MDEAPDVPSALAKARSAAGTRGLVVVTGSIYIVGEAMLALGARIE* |
| Ga0066702_105347621 | 3300005575 | Soil | AAHISVAIEEAPDVTAALERARIPAGTTGVVVVTGSIYIVGEAMQALGIRI* |
| Ga0070766_106631421 | 3300005921 | Soil | EEARDVAAALRRARDVAGSRGLVVVTGSIYIVGEATRILGVRI* |
| Ga0070717_119542372 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDIDEAPDVASALARARVVAGTRGLVVVTGSIYIVGEAMRSLGARIG* |
| Ga0075029_1003824561 | 3300006052 | Watersheds | GEIGEAESVGAALEQAEEAAGANGLVVATGSIYIVGEAMRALGVRI* |
| Ga0066659_114211902 | 3300006797 | Soil | AQIETAPDVAAALAQAGALAGSDGVVVVTGSIYVVGEAMRLLGARI* |
| Ga0066660_113052331 | 3300006800 | Soil | IDEAPDVPSALAKARAAAGARGLVVVTGSIYIVGEAMLALGARIE* |
| Ga0066709_1033734581 | 3300009137 | Grasslands Soil | AQIETAPDVAAALAQARASAGSSGVVVVTGSIYVVGEAMRRLGARI* |
| Ga0066709_1037417661 | 3300009137 | Grasslands Soil | AQIETAPDVAAALAQARASAGSSGVVVVTGSIYVVGEAMRLLGARI* |
| Ga0116126_11245612 | 3300009640 | Peatland | IDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRMLGVRI* |
| Ga0116126_11392742 | 3300009640 | Peatland | IDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI* |
| Ga0116224_100685921 | 3300009683 | Peatlands Soil | SPNEIRQAATRVAAGIDIEEAENVAAALARARAVAGPTIAGSRGLVVVTGSIYIVGEAMRMLGIRI* |
| Ga0116216_101364593 | 3300009698 | Peatlands Soil | AEIREAAARVAAGIDIEEAEDVASALDRAREVAGSGGLVAVTGSIYIVGEAMRMLGVRI* |
| Ga0116219_106301502 | 3300009824 | Peatlands Soil | ARVAAGIDIEEAEDVASALERVREVAGSGGLVVVTGSIYIVGEAMRMLGVRI* |
| Ga0116223_106242952 | 3300009839 | Peatlands Soil | RSASPAEIRQAAARVAAGVDIEEAEDVASALDRVREVAGSGGLVIVTGSIYIVGEAMRMLGVRI* |
| Ga0134071_103651101 | 3300010336 | Grasslands Soil | IETAPDVAAALAQARASAGSSGVVVVTGSIYVVGEAMRRLGARI* |
| Ga0074045_106173401 | 3300010341 | Bog Forest Soil | IDIEDARDVASALGRARALAGAQGIVVITGSIYIVGEAMRILGVRL* |
| Ga0074044_102391041 | 3300010343 | Bog Forest Soil | ARVAAGIDIEEAENVADALDRARKLAGSRGLVVVTGSIYIVGEAMPMLGVRI* |
| Ga0136449_1003982151 | 3300010379 | Peatlands Soil | AAGIDIEEAENVAAALARARAVAGPTIAGSRGLVVVTGSIYIVGEAMRMLGIRI* |
| Ga0126383_124380332 | 3300010398 | Tropical Forest Soil | ARTGSDIEDAADVPNAVERARSLAGSQGVVVVTGSIYIVGEAMRVLGVRV* |
| Ga0137393_110243062 | 3300011271 | Vadose Zone Soil | IDLEEAPDVASALARARALAGREGLVVVTGSIYIVGAAMRLLGARI* |
| Ga0137393_110564182 | 3300011271 | Vadose Zone Soil | IDIEEAPDVAAALARARALAPPKGVVVVTGSIYIVGEAMRLLGAGI* |
| Ga0120134_10857812 | 3300012004 | Permafrost | EEAVDVPAALERARISAGTDGVVVVTGSIYIVGEAMQALGIRI* |
| Ga0137389_101718091 | 3300012096 | Vadose Zone Soil | TGIDIEDAEDVSSALDRARKLAGAGGLVVVSGSIYIAGVAMRMLGVRI* |
| Ga0137399_100044441 | 3300012203 | Vadose Zone Soil | QAPNVAAALERARVLAGSNGVVVVTGSIYIVGEAMQSLGIKI* |
| Ga0137387_105755861 | 3300012349 | Vadose Zone Soil | DVAAALAQARTSAGSSEVVVVTGSIYVVGEAMRLLGVRI* |
| Ga0181521_102368402 | 3300014158 | Bog | GIDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRALGVRI* |
| Ga0137409_102112274 | 3300015245 | Vadose Zone Soil | TVDIDEAPDVPGALAQARAVAGTHGLVVVTGSIYIVGEAMRALGVRIE* |
| Ga0181511_13867731 | 3300016702 | Peatland | DVASALSRVREVAGSGGLVVVTGSIYIVGEAMRTLRVRI |
| Ga0181515_10138023 | 3300016730 | Peatland | AAGIDIEEAEDVALALERVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0181505_104299102 | 3300016750 | Peatland | AGTDIDEAEDVALALDRARQLAQPKIARPKIAGAGGLVVVTGSIYVVGEAMRTLGLRI |
| Ga0187818_102174521 | 3300017823 | Freshwater Sediment | NVPSALADAGRIAGREVLVVVTGSIYIVGDAMRRLGLRI |
| Ga0187824_100437691 | 3300017927 | Freshwater Sediment | RVAVDIEDAPDVPSALLQARAAAGTRGLVVVTGSIYIVGEAMRSLGARIE |
| Ga0187849_10304024 | 3300017929 | Peatland | VASDTDIEEYEDVASALERARKVAGPKIAGSGGLVVVTGSIYIVGEAMRTLGIGI |
| Ga0187775_100550261 | 3300017939 | Tropical Peatland | RLEQSPDVHSALVRAKSLVGSKGLVVVTGSIYIVGEAMRLLGARI |
| Ga0187853_101527211 | 3300017940 | Peatland | IDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRMLGVRI |
| Ga0187879_103085281 | 3300017946 | Peatland | NPRSASPGEIRQAAARVVAGTDIDEAEDVALALDRARQLAQPKIARPKIAGAGGLVVVTGSIYVVGEAMRTLGLRI |
| Ga0187816_101194172 | 3300017995 | Freshwater Sediment | EEAEDVAMALDRACKLAGGCGLVVVTGSIYIVGEAMRTLGIRI |
| Ga0187865_11550481 | 3300018004 | Peatland | IEETEDVASALDRARKVAGSGGLVVVTGSIYIVGEAMRTLGIGI |
| Ga0187884_100805662 | 3300018009 | Peatland | EIREAAARVAAGIDFEEAEDVSSALERARKVARSRGLVVVTGSIYIVGEAMRTLGIRI |
| Ga0187810_104560762 | 3300018012 | Freshwater Sediment | VAAGIDIAEAEDVALALEQARKVAGPKIAGPRGLVVVTGSIYIVGEAMRTLGASK |
| Ga0187880_14846652 | 3300018016 | Peatland | IDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0187886_13761532 | 3300018018 | Peatland | MDIEETEDVASALSRGREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0187889_103789841 | 3300018023 | Peatland | IRQAAARVTAGIDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0184608_104935472 | 3300018028 | Groundwater Sediment | AAAHTSVTIEEAHDVPAALERARILAGSNGVVVVTGSIYIVGEAMQALGIRI |
| Ga0187883_105432461 | 3300018037 | Peatland | RQAAARVAAGIDIEEAEDVASTLERVREVTGSRGLVVVTGSIYIVGEAMRMLGVRI |
| Ga0187855_102835022 | 3300018038 | Peatland | DIEEAEDVARALDRARQVAGSAGLVVVTGSIYIVGEAMRTLGMRI |
| Ga0187862_104773801 | 3300018040 | Peatland | EDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRMLGVRI |
| Ga0187859_101262081 | 3300018047 | Peatland | QAAARVMSCGDIEIEGAESVESALSRARQVAGQDGLIVVTGSIYIVGEAMRMLGIRI |
| Ga0187769_104731462 | 3300018086 | Tropical Peatland | ASTEIEDAETVALALGSALEIAGAEGLVVVTGSIYIVGEAMQALGVGI |
| Ga0187771_115255591 | 3300018088 | Tropical Peatland | EISEADSVATALEQARKAAGPDGLVVVTGSIYIVGEAMRALGMRI |
| Ga0187771_119283361 | 3300018088 | Tropical Peatland | NVAAALEQANAAAGPGGLVAVTGSIYIVGEAMRTLGVRI |
| Ga0187770_107790131 | 3300018090 | Tropical Peatland | RVADEISEADSVAAALEQARKAAGPDGLVVVTGSIYIVGEAMRTLGACI |
| Ga0066662_116811601 | 3300018468 | Grasslands Soil | STEILEAAEVASALVRARTLAGPKGLVVVTGSIYIVGEAMRQLGTRI |
| Ga0193723_10124821 | 3300019879 | Soil | VAIEEAPDVVAALERARIAAGTNGVVVVTGSIYIVGEAMQALGIRI |
| Ga0193733_10515203 | 3300020022 | Soil | EIREAAAHTSVAIEDAPNVAAALERAQTLAGLTGVVVVTGSIYIVGEAMQALGIRI |
| Ga0210399_115653622 | 3300020581 | Soil | DEIREAAARVASDIEIDEAEDVASALNRAKKIAGADGLVVVTGSIYAVGEAMRILSVRI |
| Ga0213874_103578311 | 3300021377 | Plant Roots | IELAPDVASALDRARELAQPDTIVVVTGSIYIVGEAMRNLSIGGQGEAAA |
| Ga0210387_106847331 | 3300021405 | Soil | TEIETAADIALALDRARAVAGRAGLVVITGSIYVVGEAMRMLGLRI |
| Ga0212123_104581322 | 3300022557 | Iron-Sulfur Acid Spring | DVPSAMERAREVAGAGGLVVATGSIYIVGEAMRMLGVRI |
| Ga0212123_106105541 | 3300022557 | Iron-Sulfur Acid Spring | DIEDATVVASALGRARSLAGSHGIVVITGSIYIVGEAMRSLGVKV |
| Ga0212123_108686601 | 3300022557 | Iron-Sulfur Acid Spring | IEDAEDVPSAMERAREVAGAGGLVVATGSIYIVGEAMRTLGVRI |
| Ga0208323_10295791 | 3300025439 | Peatland | EDVASALERARKVAGPKIAGSGGLVVVTGSIYIVGEAMRTLGIGI |
| Ga0208714_10653302 | 3300025527 | Arctic Peat Soil | IEEAEDVASALTRARTIAGQGGLIVVTGSIYVVGEAMRTLGVRI |
| Ga0208820_10807311 | 3300025576 | Peatland | AGIDIEEAEDVASALDRVREVAGSGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0207693_109975012 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VDMESSANVASALDRASALAPKGHLVVVTGSIYIVGEAMRLLGVRV |
| Ga0207663_102341893 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VASALDRASALAPKGHLVVVTGSIYIVGEAMRLLGVRV |
| Ga0207700_112710752 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IESRPDVASAVAHGREVAGADGILVITGSIYIVGEAMSSLGVPVE |
| Ga0209687_12158591 | 3300026322 | Soil | TSAEIETAPDVAAALAQARASAGSDRIVVVTGSIYVVGEAMRLLGARI |
| Ga0257167_10484692 | 3300026376 | Soil | IEEADDVASALERARKIGGAGALVVVTGSIYIVGEAMRMLDVRI |
| Ga0257168_10667562 | 3300026514 | Soil | EDVASALERARKVAGAGGLVVVTGSIYIVGETMRILGVRI |
| Ga0209524_10522721 | 3300027521 | Forest Soil | VAASTAIEGAEDVASALERARTIAGPKTAGAAGLVVVTGSIYIVGETMRILGVRI |
| Ga0209139_101019981 | 3300027795 | Bog Forest Soil | EEAPDVASALEQAKNLAGENGVVVVTGSIYIVGEAMRLLGVRI |
| Ga0209910_100377372 | 3300027803 | Thawing Permafrost | EIRQAAARVTSGAGIEDAENVATALTRARMLAGPNGLIVVTGSIYIVGEAMRTLAIRI |
| Ga0209040_101556641 | 3300027824 | Bog Forest Soil | VEISEAENVAGAIEEAERLAGPNGLVVVCGSIYIVGEAMRVMGIGI |
| Ga0209693_100435801 | 3300027855 | Soil | RVEVEIDEAANVAAALEKAREAAGARGLVVVTGSIYIVGEAMRVLGARIE |
| Ga0209167_102431621 | 3300027867 | Surface Soil | TDIEDAVDVASALDRARSLAGSRGIVVITGSIYIVGEAMRALAVKV |
| Ga0209283_100868911 | 3300027875 | Vadose Zone Soil | LEEAPDVASALARARALAGREGLVVVTGSIYIVGAAMRLLGARI |
| Ga0209380_106520412 | 3300027889 | Soil | EEARDVAAALRRARDVAGSRGLVVVTGSIYIVGEATRILGVRI |
| Ga0209068_102955251 | 3300027894 | Watersheds | DVVHALQRAREIAPSNGLVVVTGSIYIVGEAMRTLEVRIEQDSLA |
| Ga0209624_104367282 | 3300027895 | Forest Soil | STEIEEAPEVSSALDRARAHAGPQGLVVVTGSIYIVGEAMRALGVRI |
| Ga0209583_102162382 | 3300027910 | Watersheds | VKQNVFQARARRYPSALEAAGKIAGRGGLVVVTGSIYIVGEAMRLLGARI |
| Ga0209698_100765553 | 3300027911 | Watersheds | FEDATDVAHALRRARETAPPSGLVVVTGSIYIVGEAMRTLGVRIEQDSLA |
| Ga0209698_106682002 | 3300027911 | Watersheds | IEAAEDVAMALERARKAAGRGGLVVVTGSIYIVGEAMRTLGVRI |
| Ga0209069_102758082 | 3300027915 | Watersheds | DVEHALQRARAITPKHGLVVVTGSIYIVGEAMRALGVRIEQESLA |
| Ga0209069_109849331 | 3300027915 | Watersheds | AASRVPVAIDDACDVPTAIGQARAAAGTRGLVVVTGSIYIVGEAMRTLGARIE |
| Ga0302228_103931611 | 3300028808 | Palsa | TSTNIEDAEDVAGALNQARKLTRSGGLVVITGSIYIVGEAMRTLGVRI |
| Ga0247271_1121411 | 3300029903 | Soil | VISGSDIDVEDAESVESALDRASEVAGRGGLIVVTGSIYIVGEAMRMLGIRI |
| Ga0302286_106555392 | 3300030047 | Fen | AARVAPGSDIENAEDVASALDRARKIAGRTGLIVVTGSIYIVGEAMRTLGVSI |
| Ga0311353_109366112 | 3300030399 | Palsa | ATSTNIEDAEDVAGALNQARKLTRSGGLVVITGSIYIVGEAMRTLGVRI |
| Ga0310037_100954431 | 3300030494 | Peatlands Soil | RVAAGIDIEEAEDVASALDRAREVAGSGGLVAVTGSIYIVGEAMRMLGVRI |
| Ga0316363_103200591 | 3300030659 | Peatlands Soil | PRSASPAEIRQAAARVAAGVDIEEAEDVASALDRVREVAGSGGLVIVTGSIYIVGEAMRMLGVRI |
| Ga0265765_10253791 | 3300030879 | Soil | DIEDAIDVSSALDRAGSLAGPQGVVVITGSIYIVGEAMRALRIKV |
| Ga0170834_1097653852 | 3300031057 | Forest Soil | AEDVASALERARQLAGSKIAGAGGLVVVTGSIYIVGEAMRMLGIRI |
| Ga0170823_169871092 | 3300031128 | Forest Soil | EDVASALERARQLAGSKIAGAGGLVVVTGSIYIVGEAMRMLGVRI |
| Ga0170824_1229386132 | 3300031231 | Forest Soil | EIRQAAGRIAGSTNIEEAVDVVSAMARAREIAGIGGLIVITGSIYIVGEAMRMLGVRI |
| Ga0311364_100352421 | 3300031521 | Fen | AARVATDVEEAGDVASALKAARRIAGATGLVVVTGSIYIVGEAMRLLGARI |
| Ga0307475_111988141 | 3300031754 | Hardwood Forest Soil | EAARRVAVEIDEAPDVPAALAKARSFAGTGSLVVVTGSIYIVGEAMRVLGARIL |
| Ga0307475_114954192 | 3300031754 | Hardwood Forest Soil | KRVSIDIDEAPDVASALARARVVAGTRGLVVVTGSIYIVGEAMRSLGVRIG |
| Ga0310916_101766033 | 3300031942 | Soil | LEDAPDVSSALGKARAAAGTRGLVVVTGSIYIVGEAMRSLGARIE |
| Ga0307479_110074512 | 3300031962 | Hardwood Forest Soil | IDIEDAEDVPSALERARKLAGSKIAGAGGLVVVTGSIYIVGEAMRMLGVRI |
| Ga0311301_100893395 | 3300032160 | Peatlands Soil | AAGIDIEEAENVAAALARARAVAGPTIAGSRGLVVVTGSIYIVGEAMRMLGIRI |
| Ga0307472_1012060701 | 3300032205 | Hardwood Forest Soil | EIRQAAGRIADSTNIEEAVDVVSAMARAREIAGIGGLIVVTGSIYIVGEAMRMLGVRI |
| Ga0307472_1018103292 | 3300032205 | Hardwood Forest Soil | REAASHTSVALEEAPDVVAALERARMLAGSSGVVVVTGSIYIVGEAMQALGIRI |
| Ga0307472_1027269311 | 3300032205 | Hardwood Forest Soil | VAVEIDNAPDVPSALAQARAAAGTRGLVVVTGSIYIVGEAMRALGARIE |
| Ga0335082_113093782 | 3300032782 | Soil | ADDVAAALAEVRRIAGGGGLVVITGSIYIVGEAMLALDVGI |
| Ga0335078_107158532 | 3300032805 | Soil | TEDAEDVVSALDKARERAGVNGLVVVTGSIYIVGEAMRALAVRI |
| Ga0335070_104627842 | 3300032829 | Soil | ETADVASAMAEARKQAGPKGLVVVTGSIYVVGEAMRLTGARI |
| Ga0326728_110419012 | 3300033402 | Peat Soil | ARVAGEVDEAQTVAEALELAGKAAGADGLVVVTGSIYIVGEAMRALGVRI |
| Ga0310810_108733151 | 3300033412 | Soil | CAPDVSCAISKARAAAGAQGIVVVTGSIYIVGEAMRALGVSVR |
| Ga0314866_005628_1_147 | 3300033807 | Peatland | TATAIEEAGSVGAALDRAKAVAGPKGVIVVTGSIYIVGEAMRALGMRV |
| Ga0334810_064001_59_211 | 3300033890 | Soil | VATGIDIEEAEDVASAMERSRKVAGRTGLVVVTGSIYVVGEAMRILAVRI |
| ⦗Top⦘ |