NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064528

Metagenome / Metatranscriptome Family F064528

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064528
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 45 residues
Representative Sequence MDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGE
Number of Associated Samples 95
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.03 %
% of genes near scaffold ends (potentially truncated) 98.44 %
% of genes from short scaffolds (< 2000 bps) 95.31 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.531 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.062 % of family members)
Environment Ontology (ENVO) Unclassified
(62.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.375 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.28%    β-sheet: 0.00%    Coil/Unstructured: 84.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF04392ABC_sub_bind 3.91
PF04430DUF498 1.56
PF00550PP-binding 0.78
PF07883Cupin_2 0.78
PF08279HTH_11 0.78
PF07690MFS_1 0.78
PF01266DAO 0.78
PF08042PqqA 0.78
PF06904Extensin-like_C 0.78
PF10686YAcAr 0.78
PF01527HTH_Tnp_1 0.78
PF12833HTH_18 0.78
PF01220DHquinase_II 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.91
COG1504Uncharacterized conserved protein, DUF498 domainFunction unknown [S] 1.56
COG3737Uncharacterized protein, contains Mth938-like domainFunction unknown [S] 1.56
COG07573-dehydroquinate dehydrataseAmino acid transport and metabolism [E] 0.78
COG3921Uncharacterized conserved protein, contains Extensin-like_C domainFunction unknown [S] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.53 %
UnclassifiedrootN/A5.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E02JX5A1All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10032603All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300000787|JGI11643J11755_11178815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300004268|Ga0066398_10151531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300005163|Ga0066823_10049444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300005181|Ga0066678_11134444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300005332|Ga0066388_102518889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300005332|Ga0066388_102603756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300005558|Ga0066698_10378529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium976Open in IMG/M
3300005713|Ga0066905_101407840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300005764|Ga0066903_102545508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium991Open in IMG/M
3300005764|Ga0066903_107299094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300005764|Ga0066903_108806076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300006032|Ga0066696_10533844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium768Open in IMG/M
3300006800|Ga0066660_10858336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300009137|Ga0066709_100488724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1731Open in IMG/M
3300009137|Ga0066709_100685382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1472Open in IMG/M
3300010043|Ga0126380_12277589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300010048|Ga0126373_10768763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1024Open in IMG/M
3300010303|Ga0134082_10182701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300010360|Ga0126372_10940435All Organisms → cellular organisms → Bacteria → Proteobacteria871Open in IMG/M
3300010361|Ga0126378_10059097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3617Open in IMG/M
3300010366|Ga0126379_11455005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300010366|Ga0126379_12607833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300010376|Ga0126381_104651723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300010398|Ga0126383_10521225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1250Open in IMG/M
3300010403|Ga0134123_11149515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium803Open in IMG/M
3300012201|Ga0137365_10518980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium875Open in IMG/M
3300012948|Ga0126375_11534122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300012948|Ga0126375_11639507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300012951|Ga0164300_11025700All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300012971|Ga0126369_10820807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1013Open in IMG/M
3300012971|Ga0126369_12201969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300012971|Ga0126369_12886793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300015372|Ga0132256_102981703Not Available569Open in IMG/M
3300016270|Ga0182036_10273219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1275Open in IMG/M
3300016270|Ga0182036_10847483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium747Open in IMG/M
3300016270|Ga0182036_11568147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300016294|Ga0182041_10362814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1221Open in IMG/M
3300016294|Ga0182041_11019339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300016294|Ga0182041_11527869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium615Open in IMG/M
3300016319|Ga0182033_10692144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300016319|Ga0182033_10984806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium750Open in IMG/M
3300016319|Ga0182033_12061821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300016341|Ga0182035_11131460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300016357|Ga0182032_10467378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1032Open in IMG/M
3300016357|Ga0182032_12002673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300016371|Ga0182034_11298442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300016404|Ga0182037_10623812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium917Open in IMG/M
3300016404|Ga0182037_11786453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300016422|Ga0182039_10735179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium872Open in IMG/M
3300016445|Ga0182038_10276115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1363Open in IMG/M
3300021178|Ga0210408_10080726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2549Open in IMG/M
3300021403|Ga0210397_10949066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300021560|Ga0126371_10499375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1365Open in IMG/M
3300025898|Ga0207692_10359493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium899Open in IMG/M
3300025916|Ga0207663_10427706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1017Open in IMG/M
3300025916|Ga0207663_10711894All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300026296|Ga0209235_1147681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria941Open in IMG/M
3300026540|Ga0209376_1096027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1531Open in IMG/M
3300026547|Ga0209156_10074847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1728Open in IMG/M
3300026872|Ga0207785_1021566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300027087|Ga0208605_101574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300027174|Ga0207948_1013824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium936Open in IMG/M
3300029636|Ga0222749_10463767All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300031545|Ga0318541_10676560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031561|Ga0318528_10554925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300031573|Ga0310915_10180206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1471Open in IMG/M
3300031573|Ga0310915_11095173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300031573|Ga0310915_11144667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300031668|Ga0318542_10084812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1507Open in IMG/M
3300031681|Ga0318572_10293303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium960Open in IMG/M
3300031681|Ga0318572_10356390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium868Open in IMG/M
3300031682|Ga0318560_10123754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1355Open in IMG/M
3300031682|Ga0318560_10204870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1054Open in IMG/M
3300031723|Ga0318493_10830504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300031747|Ga0318502_10613398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300031769|Ga0318526_10297397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300031770|Ga0318521_10985919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300031782|Ga0318552_10629912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031792|Ga0318529_10210911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria901Open in IMG/M
3300031795|Ga0318557_10377924Not Available651Open in IMG/M
3300031798|Ga0318523_10599642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031799|Ga0318565_10316977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300031805|Ga0318497_10408827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031831|Ga0318564_10266329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031833|Ga0310917_10101954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1848Open in IMG/M
3300031835|Ga0318517_10116385All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300031846|Ga0318512_10448609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300031859|Ga0318527_10193921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium859Open in IMG/M
3300031860|Ga0318495_10289568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium730Open in IMG/M
3300031879|Ga0306919_10335072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1153Open in IMG/M
3300031879|Ga0306919_10399499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1054Open in IMG/M
3300031890|Ga0306925_10891703All Organisms → cellular organisms → Bacteria → Acidobacteria915Open in IMG/M
3300031890|Ga0306925_11866244Not Available573Open in IMG/M
3300031894|Ga0318522_10157192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium857Open in IMG/M
3300031896|Ga0318551_10413936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300031912|Ga0306921_10860270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1032Open in IMG/M
3300031941|Ga0310912_10094057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2196Open in IMG/M
3300031942|Ga0310916_11534438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031945|Ga0310913_10260884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1218Open in IMG/M
3300031945|Ga0310913_10877383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300031946|Ga0310910_10592649Not Available879Open in IMG/M
3300031954|Ga0306926_11507970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium775Open in IMG/M
3300031954|Ga0306926_11830569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium688Open in IMG/M
3300031954|Ga0306926_12164143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium620Open in IMG/M
3300031959|Ga0318530_10047364All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300031981|Ga0318531_10048412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1798Open in IMG/M
3300032001|Ga0306922_10055251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4117Open in IMG/M
3300032035|Ga0310911_10872912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300032041|Ga0318549_10101171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300032041|Ga0318549_10452068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300032042|Ga0318545_10125147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium908Open in IMG/M
3300032060|Ga0318505_10451725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300032066|Ga0318514_10402672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300032076|Ga0306924_10117468Not Available3023Open in IMG/M
3300032076|Ga0306924_10638458All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1201Open in IMG/M
3300032076|Ga0306924_11467643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS96.2725Open in IMG/M
3300032076|Ga0306924_11871188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300032076|Ga0306924_11904037Not Available616Open in IMG/M
3300032076|Ga0306924_12590901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300032089|Ga0318525_10245739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium920Open in IMG/M
3300032091|Ga0318577_10233724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium880Open in IMG/M
3300032094|Ga0318540_10053623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1816Open in IMG/M
3300032094|Ga0318540_10102780All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300032261|Ga0306920_100201205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2972Open in IMG/M
3300033289|Ga0310914_10538722Not Available1055Open in IMG/M
3300033290|Ga0318519_10185182All Organisms → cellular organisms → Bacteria1181Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026872Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)EnvironmentalOpen in IMG/M
3300027087Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF017 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_079717302189573000Grass SoilMEIYEVELCHRGRWEQQEARFVAARDADEAAYKVTGKQLRSEGE
AF_2010_repII_A1DRAFT_1003260333300000597Forest SoilMNIYEVELCRRGRWEQQDTRFVAARDADEAAYKVTGEHLHSEGERRKVRLRVR
JGI11643J11755_1117881523300000787SoilMDIYEVELCRRGRWEQQXARFXAAXDXDEAAYKVAGGHLHSEGDP
Ga0066398_1015153113300004268Tropical Forest SoilMDIYEVELCHRGRWEQQDARFVAATDADEAAYKVIGEHLHSEGERKKVRLRVRRL
Ga0066823_1004944413300005163SoilMDIYEVELCHRGRWEQQEARFVAARDADEAAYKVTGRQLRSEGERRKVRLRVRR
Ga0066678_1113444413300005181SoilMGIMDIYEVELCRRARWEQHDARFVAAGDADEAAYKVTGEHLHSEGEHRKV
Ga0066388_10251888913300005332Tropical Forest SoilMGIMDIYEVELCRRGRWEQQDARFVAAGDADEAAYKVTGEHLHSEGERRKVRLRVR
Ga0066388_10260375613300005332Tropical Forest SoilMDIYEVELCRRGRWEQQNARFVAAGDADEAAYKVTGEHLHSEGERRR
Ga0066698_1037852913300005558SoilMGIMDIYEVELCRRGRWEQHDARFVAAGDADEAAY*
Ga0066905_10140784013300005713Tropical Forest SoilMDIYEVELCRRGRWEQQDVRFVAARDADEAAYKVTGEHLHSEGER
Ga0066903_10254550813300005764Tropical Forest SoilMGILDIYEVDLCRRGRWQDQDARFVAAGDAAEAAYKV
Ga0066903_10729909413300005764Tropical Forest SoilMVMDIYEIELCRRGRWEQQDARFVAARDADEAAYRVTGEHLHSEGER
Ga0066903_10880607623300005764Tropical Forest SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYRVTGEHL
Ga0066696_1053384423300006032SoilMGIMDIYEVELCRRGRWEQHYARFVAAGDGAITRVC
Ga0066660_1085833613300006800SoilMDIYEVELCRRGRWEQQDARFVAAGDAGEAAYKVARAHLHSEGDRRRIRLRVRRL
Ga0066709_10048872433300009137Grasslands SoilMDIYEVELCRRGRWEQQDGRFVAAGDADEAAYKVTGEHLR
Ga0066709_10068538223300009137Grasslands SoilMGIMDIYEVELCRRGRWEQQDGRFVAAGDADEAAY
Ga0126380_1227758913300010043Tropical Forest SoilAKACRGQIYEVELCHRGRRERQDARFVAAGDADEAAYKVVG*
Ga0126373_1076876323300010048Tropical Forest SoilMGIMDIYEVELCRRGRWEQQDARFVAAVNADEAAYKVTGEHLQSEGERRKVR
Ga0134082_1018270113300010303Grasslands SoilMGIMDIYEVELCRRGRWEQHDARFVAAGDADEAAYKVTGEHLHSEGEHRKVRLRVRR
Ga0126372_1094043513300010360Tropical Forest SoilMGIMDIYEVELWCRGRWDQQVARFVAAGDADEAAYKVTGEHLHSEGERRK
Ga0126378_1005909713300010361Tropical Forest SoilMDIYEVELCRGGRWEQQDARFVAATDADEAAYKVTREHLHSEGE
Ga0126379_1145500513300010366Tropical Forest SoilMDIYEVELCRRGRWEQQEVRFVAARDADEAAYKVTGEHLHSEGERGKVRLRVRR
Ga0126379_1260783313300010366Tropical Forest SoilMGSMDIYEVELCRRGRWEEQDARFVAARDADEAACKVTR
Ga0126381_10465172323300010376Tropical Forest SoilMEIYEVELCQYGRWEQQHARFVAAKDADEAAYKVTGEHLRSEGDRRSVRLRVRRL
Ga0126383_1052122533300010398Tropical Forest SoilMVMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLH
Ga0134123_1114951513300010403Terrestrial SoilMDIYEVELCRRGRWEQQDARFIAAGDADEAAYKVTGEHLHSEGGRRKV
Ga0137365_1051898033300012201Vadose Zone SoilMGIMDIYEVELCRRGRWEQQDARFVAAGDADEAAYKVTGEHLHSDGERR
Ga0126375_1153412213300012948Tropical Forest SoilMGAIDIYEVELCSRGRCEDARFVAAGDADEAAYKVVG*
Ga0126375_1163950713300012948Tropical Forest SoilMGITDIYEVELCRRGRWEQHDARFVAAGDADEAAYRVTGEHLHSEGEG
Ga0164300_1102570013300012951SoilMEIYEVELCHRGRWEQQEARFVAARDADEAAYKVTGEQLRSEGERRKVRLRVRRL
Ga0126369_1082080713300012971Tropical Forest SoilMDIYEVELCRRGRSEQQDARFVAARDADEAAYKVTGEHLHSEGERRKVRLRVRR
Ga0126369_1220196923300012971Tropical Forest SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGEHLHSEGER
Ga0126369_1288679323300012971Tropical Forest SoilMDIYEVELCRRGRWEQQEVRFVAARDADEAAYKVTGEHLHSEGERGKVRL
Ga0132256_10298170313300015372Arabidopsis RhizosphereMEMYEVQVVPHGRWERQQTRIVAARNEDEAAYKVT
Ga0182036_1027321913300016270SoilMGIMDIYEVELCRRGRWEKQDARFVAARDADEAAYKVTGEHLHSEGE
Ga0182036_1084748313300016270SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHS
Ga0182036_1156814713300016270SoilMDIYEVELCRRGRWEQQDARFVAAVNADEAAYKVTGEHLQSEGERRKVR
Ga0182041_1036281423300016294SoilMEIYEVALCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVK
Ga0182041_1101933913300016294SoilMNIYEVELCRRGRWEQQDVRFVAARDADEAAYKVTGEHLHSEGERRKVRLRV
Ga0182041_1152786913300016294SoilMDIYEVELCRRGHWEQQDARFVAAGDADEAAYKVTGE
Ga0182033_1069214413300016319SoilMNIYEVELCRRGRWEQQDARFVAARDADEAAYKVT
Ga0182033_1098480613300016319SoilMDIYEVELCRRGRWEQQDARFIAAGDADEAAYKVTGEHLHSEGERRKVRLRVRR
Ga0182033_1206182113300016319SoilMDIYEVELCQRGRWEQQHARFSAARDADEAAYKVTGEHLRSEGERKKLRLRV
Ga0182035_1113146033300016341SoilMEIYEVELCQHGRWEQQYARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVK
Ga0182032_1046737833300016357SoilMDIYEVEFCRRGRWEQQDARFVAARDADEAAYKVAGEH
Ga0182032_1200267323300016357SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTG
Ga0182034_1129844223300016371SoilMEIYEIELCKRGRWEQQHARVVAAQDADEAAYKVTGEHLRSEGE
Ga0182037_1062381233300016404SoilMDIYEVELCRRGRWEPQDARFVAASDAAEAAYKVTGEHLHSEG
Ga0182037_1178645313300016404SoilMEIYEVELCQHGRWERQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRL
Ga0182039_1073517913300016422SoilMDIYEVELYRRGRWEHQEAHVVAARDADEAAYRVTGKHLRSEGERRKM
Ga0182038_1027611533300016445SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGE
Ga0210408_1008072613300021178SoilMEIYEVELCHRGRWEQQDARFVAARNADEAAYKVTGIQLRSEGE
Ga0210397_1094906623300021403SoilMDIYEVELCHRGRWGQQDARFVAARDANEAAYNVTGE
Ga0126371_1049937513300021560Tropical Forest SoilMGIMDIYKVELCRRGHWEQQDARFVAAGDADEAAYK
Ga0207692_1035949313300025898Corn, Switchgrass And Miscanthus RhizosphereMDIYEVELCRRGRWEQQDARFIAAGDADEAAYKVTGEHLHSEGGRRKVRL
Ga0207663_1042770613300025916Corn, Switchgrass And Miscanthus RhizosphereMDIYEVELCRRGEHQPARFVAAGDADEAAYKVTGEHLRSEGERRKIRLRVR
Ga0207663_1071189413300025916Corn, Switchgrass And Miscanthus RhizosphereMEIYEVELCHRGRWEQQEARFVAARDADEAAYKVTGEQLRSEGERR
Ga0209235_114768113300026296Grasslands SoilMDIYEVELCRRGRWEQQDGRFVAAGDADEAAYKVTGEHLRS
Ga0209376_109602713300026540SoilMGIMDIYEVELCRRGRWEQQDGRFVAAGDADEAAYKVTGEHLRSEGE
Ga0209156_1007484723300026547SoilMVMDIYEVELCRRGRWEQQDGRFVAAGDADEAAYKVTGEHLRS
Ga0207785_102156623300026872Tropical Forest SoilMDIYEVEFYRRGRWEHQEAHVIAARDADEAAYRVTGKHLRSEGERR
Ga0208605_10157413300027087Forest SoilMDIYEVELCHRGRWEQQDARFVAARNADEAAYKVTGIQLRSEGE
Ga0207948_101382413300027174Forest SoilMEIYEVELCHRGRWEQQEARFVAARDADEAAHKVTGRQLR
Ga0222749_1046376713300029636SoilMEIYEVKLCHRGRWEQQEARFVAARDADEAAYKVTGEQLRSEGERR
Ga0318541_1067656023300031545SoilMDIYEVELCRRGRWEQQDARFVAARDADEVAYKVTGEHL
Ga0318528_1055492513300031561SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRSYG
Ga0310915_1018020623300031573SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGE
Ga0310915_1109517323300031573SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGE
Ga0310915_1114466713300031573SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTG
Ga0318542_1008481213300031668SoilMEIYEVALCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKL
Ga0318572_1029330333300031681SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGERLHSEGERGKVR
Ga0318572_1035639023300031681SoilMEIYEVALCQHGRWEQQHARFVAARDADEAAYKVTGKYLRSEGERGKVR
Ga0318560_1012375413300031682SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKV
Ga0318560_1020487033300031682SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGEHLHSEGERGKVRLRV
Ga0318493_1083050413300031723SoilMEIYEVALCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKLR
Ga0318502_1061339823300031747SoilMSTLDIYEVEPCRCGRCDEQDARFVAAGDADEAACKVTGE
Ga0318526_1029739713300031769SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGEHLH
Ga0318521_1098591923300031770SoilMGIMDIYEVELCRRGRWEKQDARFVAARDADEAAYKVTGE
Ga0318552_1062991213300031782SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGKHLHSEGERSKVRLR
Ga0318529_1021091113300031792SoilMDIYEVELCRRGRWEQQDARFVAARDADEVAYKVTREHLHS
Ga0318557_1037792413300031795SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGE
Ga0318523_1059964213300031798SoilMGIMDIYEVELCRRGRWEKQDARFVAARDADEAAYKVTGEHLH
Ga0318565_1031697713300031799SoilMSTLDIYEVEPCRRGRCDEQDARFVAAGDADEAACKVTGEHLH
Ga0318497_1040882713300031805SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGERLHSEGEQRKVR
Ga0318564_1026632913300031831SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGEHLHSEGERGKVRL
Ga0310917_1010195463300031833SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEG
Ga0318517_1011638513300031835SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGERRQVRLRI
Ga0318512_1044860923300031846SoilMVMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHS
Ga0318527_1019392133300031859SoilMSTLDIYEVEPCRCGRCDEQDARFVAAGDADEAACKVTGEHLHSEGERRK
Ga0318495_1028956833300031860SoilMVMDIYEVELCRRGRWEQQDARFVAARDADEAAYKV
Ga0306919_1033507213300031879SoilMEIYEVELCQHGRWEQQPARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRL
Ga0306919_1039949923300031879SoilMEIYEIELCKRGRWEQLHARFVAAQDADEAAYKVT
Ga0306925_1089170333300031890SoilMVMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVT
Ga0306925_1186624413300031890SoilMDIYEVEFYRRGRWDHQEARDVAAGDADEAAYRVIGKHLRSQGER
Ga0318522_1015719223300031894SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHGEGERRQVRL
Ga0318551_1041393613300031896SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGER
Ga0306921_1086027033300031912SoilMSTLDIYEVEPCRRGRCEEQDARFVAAGDADEAAY
Ga0310912_1009405743300031941SoilMDIYEVEFCRRGRWEQQDARFVAARDADEAAYKVAGE
Ga0310916_1153443813300031942SoilMDIYEVELCRRGRWEQQDARFVAAIDADEAAYRVAGQHLH
Ga0310913_1026088413300031945SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHL
Ga0310913_1087738313300031945SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSDGER
Ga0310910_1059264913300031946SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKVRLRVKR
Ga0306926_1150797013300031954SoilMVMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGE
Ga0306926_1183056913300031954SoilMEIYEVELCQRGRWEQQHARFVAARDADEAAYKVTGEHLRSEGNRRNVRLRVRRL
Ga0306926_1216414323300031954SoilMDIYEVELCRRGHWEQQDARFVAAGDADEAAYKVTGEY
Ga0318530_1004736443300031959SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGE
Ga0318531_1004841253300031981SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHS
Ga0306922_1005525113300032001SoilMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLH
Ga0310911_1087291213300032035SoilMDIYEVELCRCGRWEQRDARVVAARDAEEAAYNVTGKHLRNEGEPR
Ga0318549_1010117143300032041SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGERRQARLR
Ga0318549_1045206813300032041SoilMGIMDIYEVELCRRGRWELQDARFVAARDADEAAYKVTGEHLHSEGERGKVRLR
Ga0318545_1012514723300032042SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERKKLRLR
Ga0318505_1045172513300032060SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRV
Ga0318514_1040267223300032066SoilMSTLDIYEVEPCRCGRCDEQDARFVAAGDADEAACKVTGEHLHSEGERRKVR
Ga0306924_1011746853300032076SoilMEIYEVELCQRGRWEQQHARFVAASDADEAAYKVTGEHLRSEGDRR
Ga0306924_1063845813300032076SoilMDIYEVERCRRGRWEQQDARFVAARDADEAAYRVTGGHLHSEGERRKV
Ga0306924_1146764313300032076SoilMEIYEVELCQRGRWEQQYARFVAAKDADEAAYKVTGEHLRSEGNRRNVR
Ga0306924_1187118813300032076SoilMDIYEVELCRRGRWEQQDARFVAAGDADEAAYKATG
Ga0306924_1190403723300032076SoilMDIYEVELCRRGHWEQQDARFVAAGDADEAAYKVTGEYLHSDGERRKV
Ga0306924_1259090123300032076SoilMSSLDIYEVELCRRGRCEQQDARFVAAGDADEAAYKVTG
Ga0318525_1024573923300032089SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEGERRQVRLR
Ga0318577_1023372423300032091SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEH
Ga0318540_1005362363300032094SoilMGIMDIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLH
Ga0318540_1010278023300032094SoilMEIYEVELCQHGRWEQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKR
Ga0306920_10020120513300032261SoilMNIYEVELCRRGRWEQQDARFVAARDADEAAYKVTGEHLHSEG
Ga0310914_1053872213300033289SoilMDMYEVQLYRQGRWEQQRWRVVAARDEDEAAYKVTGE
Ga0318519_1018518213300033290SoilMDIYEVELCRRGRGEQQDARFVAAIDADEAASRRVT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.