Metagenome / Metatranscriptome Family F064519

Overview

Basic Information

• Family ID: F064519
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 128
• Average Sequence Length: 37 residues
• Representative Sequence: MAKAKKEGKPKRNRANLVKRLKTIERNVQLLNEYK
• Number of Associated Samples: 83
• Number of Associated Scaffolds: 128

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 15.74 %
• % of genes near scaffold ends (potentially truncated): 8.59 %
• % of genes from short scaffolds (< 2000 bps): 61.72 %
• Associated GOLD sequencing projects: 80
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (54.688 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.531 % of family members)
• Environment Ontology (ENVO): Unclassified (45.312 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (57.812 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 33.33%
  β-sheet: 3.17%
  Coil/Unstructured: 63.49%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF12705	PDDEXK_1	18.75
PF04984	Phage_sheath_1	3.12
PF00534	Glycos_transf_1	2.34
PF06841	Phage_T4_gp19	1.56
PF01329	Pterin_4a	1.56
PF00210	Ferritin	1.56
PF05721	PhyH	0.78
PF07453	NUMOD1	0.78
PF00574	CLP_protease	0.78
PF04023	FeoA	0.78
PF03819	MazG	0.78
PF13426	PAS_9	0.78
PF00075	RNase_H	0.78
PF14743	DNA_ligase_OB_2	0.78
PF07484	Collar	0.78
PF00254	FKBP_C	0.78
PF00535	Glycos_transf_2	0.78
PF00550	PP-binding	0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG3497	Phage tail sheath protein FI	Mobilome: prophages, transposons [X]	3.12
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.56
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.56
COG2154	Pterin-4a-carbinolamine dehydratase	Coenzyme transport and metabolism [H]	1.56
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.78
COG1918	Fe2+ transport protein FeoA	Inorganic ion transport and metabolism [P]	0.78
COG5285	Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.78

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
All Organisms	root	All Organisms	45.31 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
Viruses	superkingdom	All Organisms → Viruses	32.03 %
cellular organisms	root	All Organisms → cellular organisms	13.28 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	21.09 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.38 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	21.09 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	7.81 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	21.09 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	7.81 %
Candidatus Woesearchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	21.09 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	7.81 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	21.09 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	7.81 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.69 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.09 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	7.81 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	3.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.56 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002408|B570J29032_109773443	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1275
3300003277|JGI25908J49247_10077762	Not Available	822
3300004240|Ga0007787_10495898	Not Available	611
3300005527|Ga0068876_10452885	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	710
3300005527|Ga0068876_10713247	Not Available	535
3300005528|Ga0068872_10736449	Not Available	516
3300005565|Ga0068885_1723397	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	933
3300005565|Ga0068885_1966006	All Organisms → Viruses	1720
3300005580|Ga0049083_10213463	Not Available	654
3300005662|Ga0078894_10043945	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	3754
3300006802|Ga0070749_10074940	Not Available	2025
3300006802|Ga0070749_10226096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1065
3300006802|Ga0070749_10371381	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	792
3300006802|Ga0070749_10433004	All Organisms → cellular organisms → Bacteria	722
3300007165|Ga0079302_1016931	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1877
3300007171|Ga0102977_1218570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1338
3300007177|Ga0102978_1023210	Not Available	1998
3300007538|Ga0099851_1143759	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	891
3300007541|Ga0099848_1029599	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	2286
3300007541|Ga0099848_1035312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2065
3300007541|Ga0099848_1043852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1822
3300007541|Ga0099848_1208000	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700
3300007542|Ga0099846_1271494	Not Available	585
3300007593|Ga0102918_1213714	Not Available	587
3300007960|Ga0099850_1136113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	996
3300008114|Ga0114347_1002567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14520
3300008266|Ga0114363_1001461	Not Available	27287
3300008266|Ga0114363_1005223	Not Available	6681
3300008266|Ga0114363_1015700	Not Available	3778
3300008266|Ga0114363_1103660	Not Available	1019
3300008266|Ga0114363_1120965	Not Available	1548
3300008267|Ga0114364_1000512	Not Available	23502
3300008267|Ga0114364_1001789	Not Available	12581
3300008267|Ga0114364_1003204	Not Available	10836
3300008267|Ga0114364_1004104	Not Available	9993
3300008267|Ga0114364_1038524	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1805
3300008267|Ga0114364_1042663	All Organisms → Viruses	1680
3300008267|Ga0114364_1175733	Not Available	553
3300008267|Ga0114364_1189526	Not Available	517
3300008448|Ga0114876_1027982	All Organisms → Viruses	2801
3300008448|Ga0114876_1264586	Not Available	520
3300008450|Ga0114880_1269601	Not Available	517
3300008459|Ga0114865_1002116	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12187
3300008510|Ga0110928_1020201	Not Available	740
3300009085|Ga0105103_10037277	Not Available	2431
3300009687|Ga0116144_10617280	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	525
3300010354|Ga0129333_10743498	Not Available	840
3300012013|Ga0153805_1059070	Not Available	649
3300012970|Ga0129338_1376660	Not Available	602
3300013004|Ga0164293_10708329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	645
(restricted) 3300013127|Ga0172365_10016010	Not Available	5406
(restricted) 3300013127|Ga0172365_10485870	Not Available	715
(restricted) 3300013129|Ga0172364_10497910	Not Available	771
3300017747|Ga0181352_1149987	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	617
3300017754|Ga0181344_1013303	All Organisms → cellular organisms → Bacteria	2612
3300017766|Ga0181343_1102447	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	812
3300017785|Ga0181355_1170477	All Organisms → Viruses	870
3300017788|Ga0169931_10199291	All Organisms → Viruses → Predicted Viral	1709
3300017788|Ga0169931_10488890	Not Available	873
3300018416|Ga0181553_10092990	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1879
3300019784|Ga0181359_1024623	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2297
3300019784|Ga0181359_1036249	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1911
3300019784|Ga0181359_1080720	Not Available	1219
3300020159|Ga0211734_10730367	Not Available	3927
3300020160|Ga0211733_11102877	All Organisms → Viruses	1793
3300020179|Ga0194134_10150601	All Organisms → Viruses → Predicted Viral	1057
3300020183|Ga0194115_10001816	Not Available	26384
3300020183|Ga0194115_10209774	All Organisms → Viruses	953
3300020562|Ga0208597_1067193	Not Available	638
3300021424|Ga0194117_10029440	All Organisms → Viruses	3446
3300021961|Ga0222714_10657813	Not Available	516
3300021962|Ga0222713_10463249	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	766
3300021963|Ga0222712_10123162	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1783
3300021963|Ga0222712_10273610	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1070
3300021963|Ga0222712_10740433	All Organisms → Viruses	549
3300022179|Ga0181353_1013983	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	2065
3300022179|Ga0181353_1055177	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1034
3300022179|Ga0181353_1094538	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	741
3300022213|Ga0224500_10121187	Not Available	988
3300022407|Ga0181351_1030043	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2310
3300023174|Ga0214921_10284896	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	935
3300024480|Ga0255223_1027885	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	937
3300025646|Ga0208161_1063699	All Organisms → Viruses	1122
3300025889|Ga0208644_1056858	All Organisms → Viruses	2130
3300026415|Ga0256298_1023880	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	812
3300026425|Ga0256300_1019243	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	939
3300027125|Ga0255106_1000372	Not Available	10250
3300027499|Ga0208788_1047311	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1166
3300027593|Ga0255118_1002617	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4212
3300027777|Ga0209829_10094220	Not Available	1464
3300027798|Ga0209353_10092388	Not Available	1369
3300027899|Ga0209668_11104814	Not Available	534
3300031746|Ga0315293_10354131	Not Available	1165
3300031758|Ga0315907_10270768	Not Available	1403
3300031758|Ga0315907_10311695	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1290
3300031758|Ga0315907_10343068	Not Available	1217
3300031787|Ga0315900_10007550	Not Available	14243
3300031787|Ga0315900_10962535	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	566
3300031857|Ga0315909_10068032	All Organisms → Viruses	3200
3300031857|Ga0315909_10343843	All Organisms → Viruses	1094
3300031951|Ga0315904_10085229	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	3369
3300031963|Ga0315901_10561158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	876
3300031963|Ga0315901_10689647	Not Available	759
3300032116|Ga0315903_11144535	Not Available	530
3300033978|Ga0334977_0533661	Not Available	531
3300033981|Ga0334982_0107610	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1463
3300034022|Ga0335005_0748603	Not Available	511
3300034061|Ga0334987_0183958	Not Available	1489

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.22%
Engineered	Engineered	0.78%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.88%
Terrestrial	Environmental → Terrestrial	2.34%
Wastewater	Engineered → Wastewater	0.78%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	76.56%
Marine	Environmental → Aquatic → Marine	20.31%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.34%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.78%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	33.59%
Lentic	Environmental → Aquatic → Freshwater → Lentic	25.78%
Coastal	Environmental → Aquatic → Marine → Coastal	11.72%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	10.16%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.25%
River	Environmental → Aquatic → Freshwater → River	3.91%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.34%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.56%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.56%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.78%
Ice	Environmental → Aquatic → Freshwater → Ice	0.78%
Sediment	Environmental → Aquatic → Marine → Sediment	0.78%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.78%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	30.47%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	23.44%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	11.72%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	10.16%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.25%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	3.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.12%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.34%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.56%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.56%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.78%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.78%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.78%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.78%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.78%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.78%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.78%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	19.53%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	11.72%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	10.94%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	9.38%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.59%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	7.03%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	6.25%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	3.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.12%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.34%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.34%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.56%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.56%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.56%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.78%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.78%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.78%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.78%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.78%
Water Bodies	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies	0.78%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.78%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.78%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.78%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.78%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.78%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.78%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.78%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental
3300004240	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN	Environmental
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental
3300005565	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)	Environmental
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental
3300007177	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects	Environmental
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental
3300007593	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3	Environmental
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental
3300008459	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs	Environmental
3300008510	Microbial Communities in Water bodies, Singapore - Site RA	Environmental
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental
3300009687	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG	Engineered
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental
3300012970	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental
3300013127 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm	Environmental
3300013129 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm	Environmental
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental
3300020562	Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)	Environmental
3300021424	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface	Environmental
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental
3300022213	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1	Environmental
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental
3300024480	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental
3300025646	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)	Environmental
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental
3300026415	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300026425	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300027125	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h	Environmental
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental
3300027593	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h	Environmental
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental
3300027777	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)	Environmental
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental
3300034280	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1097734434	3300002408	Freshwater	MAKARKEGKAKRNRANLVKRLKLIQKNQEIINQLTR*
JGI25908J49247_100777621	3300003277	Freshwater Lake	MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQSETH*
Ga0007787_104958981	3300004240	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIKRNEQILNEYKKTAGPFASYS
Ga0068876_100402151	3300005527	Freshwater Lake	MAKARKEGKPKRNRQNLVKNLMRMKKNYDLIKRIEKEL*
Ga0068876_100586462	3300005527	Freshwater Lake	MARARKEGKPKRNRANLVKKMNMIQSNQEKLQKFFEKKN*
Ga0068876_104528852	3300005527	Freshwater Lake	MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEENL*
Ga0068876_107132472	3300005527	Freshwater Lake	MAKARKEGKPKRNRVNLTKRLGIIKRNEELLKQYNQNNN*
Ga0068872_107364491	3300005528	Freshwater Lake	MAKAKKEGKPKKNRGNLVKRLKMIARNQELLKQYENK*
Ga0068885_17233972	3300005565	Freshwater Lake	MAKARKEGKPKRNRGNLVKRLNMIARNQQLLKQYENE*
Ga0068885_19660065	3300005565	Freshwater Lake	MSKAKKEGKQKRNRGNLAKRLKLIEKNTQLLNKFQETA*
Ga0049083_100046754	3300005580	Freshwater Lentic	MAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ*
Ga0049083_102134632	3300005580	Freshwater Lentic	MAKAKKEGKPKRNRENLVKKLQRIERNAELIKQFE
Ga0049081_101593691	3300005581	Freshwater Lentic	ITMAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ*
Ga0078894_100439456	3300005662	Freshwater Lake	MAKARKEGKPKRNRANLVKRLKMIQKNQELINQLTK*
Ga0078894_106300652	3300005662	Freshwater Lake	MAKARKEGKPKRNRANLVKRLKLIKQNEEVLKSLRAQ*
Ga0070749_100749402	3300006802	Aqueous	MARARKEGSKNRNRKNLSKQLKRITRNQQLLKQYE*
Ga0070749_102260963	3300006802	Aqueous	MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKTK*
Ga0070749_103713811	3300006802	Aqueous	MAKAKKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA*
Ga0070749_104330042	3300006802	Aqueous	MAKARKEGKPKRNRANLAKRLAMINRNEELLKQYNQNNN*
Ga0079302_10169315	3300007165	Deep Subsurface	MAKARKEGKPKRNRVNLTKRLAIIKHNEELLKQYNQNNK*
Ga0102977_12185701	3300007171	Freshwater Lake	MAKARKEGKPKRNRANLVKRLKMIEKNSQLLKAYE*
Ga0102978_10232104	3300007177	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIEHNEKILNEYKKTA*
Ga0099851_11437593	3300007538	Aqueous	MAKARKEGKPKRNRGNLVKRLKVIEHNEKILNEYKKTA*
Ga0099848_10295998	3300007541	Aqueous	MAKARKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA*
Ga0099848_10353127	3300007541	Aqueous	MAKARKEDKPKRNRANLVKRLKTIKRNIQLLNEYSK*
Ga0099848_10438527	3300007541	Aqueous	MAKARKEGKPKRNRANLAKRLKMIEKNNQLLNQYK*
Ga0099848_12080003	3300007541	Aqueous	MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKKTA*
Ga0099846_12714941	3300007542	Aqueous	MAKAKKEGKPKRNRANLAKRLKMIEKNNQLLNQYK*
Ga0102918_12137142	3300007593	Estuarine	MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEETL*
Ga0099850_11361133	3300007960	Aqueous	MAKARKEGKPKRNRANLVKRLKTIKRNIQLLNEYSK*
Ga0114347_10025679	3300008114	Freshwater, Plankton	MAKARKEGKPKKNRGNLVKRLNMIAKNQELIKEYENK*
Ga0114363_10014612	3300008266	Freshwater, Plankton	MAKARKEGKPKRNRANLVKRLKTMERNQQLLEQYK*
Ga0114363_100522310	3300008266	Freshwater, Plankton	MAKARKEGKQKRNRANLAKRIKLIDKNTQLLNKFKETA*
Ga0114363_10157004	3300008266	Freshwater, Plankton	MAKARKEGKPKRNRANLVKRLKTIERNIQLINEYSK*
Ga0114363_11036602	3300008266	Freshwater, Plankton	MAKARKEGKPKRNQANLVKRLKMIERNQQLLEKYK*
Ga0114363_11209652	3300008266	Freshwater, Plankton	MAKARKEGKPKRNRANLAKRLKMIERNNQLLNEYK*
Ga0114364_100051240	3300008267	Freshwater, Plankton	MAKAKKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK*
Ga0114364_10017896	3300008267	Freshwater, Plankton	MAKAKKEGKPKKNRGNLVKRLNMIAKNQELLKQYENK*
Ga0114364_10028257	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRTNLAKHLNRIARNQQLLKQYENG*
Ga0114364_100320413	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRTNLVKRLKTIEKNTQLLKQYES*
Ga0114364_10041046	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRRNLVKKLRLIDKNHELLKQYEENL*
Ga0114364_10385246	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRANLVKRLKTIERNIQLINEYK*
Ga0114364_10426632	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRANLVKRLKTIERNQQLLEKYK*
Ga0114364_11757332	3300008267	Freshwater, Plankton	MAKARKEGKPKRNRANLVKRLKTIERNIQLLESYK*
Ga0114364_11895261	3300008267	Freshwater, Plankton	MAKAKKEGKPKRNRANLVKRLRVIKNNEELISKYMKTLED*
Ga0114876_10279827	3300008448	Freshwater Lake	MAKAKKEGKPKRNRANLVKRLKTIERNIQLLNEYSK*
Ga0114876_12645862	3300008448	Freshwater Lake	MAKARKEGKPKRNRGNLVKRLNMIARNQQLLEQYK*
Ga0114880_12696012	3300008450	Freshwater Lake	KKEGKPKRNRGNLAKRLKLIEHNEKIINEYKKSKND*
Ga0114865_100211612	3300008459	Freshwater Lake	MAKARKEGKPKRNRVNLAKRAKIIARNQALLKQYENEK*
Ga0110928_10202011	3300008510	Water Bodies	MAKARKEGKPKRNRANLVKRLAIIKHNEELLKQYNQNNN*
Ga0105103_100372773	3300009085	Freshwater Sediment	MAKAKKEGKPKRNRGNLVKRLKVIERNNQLLNEFKETA*
Ga0105102_105077471	3300009165	Freshwater Sediment	MAKAKKEGKPKGNRGNILKNMRRIEENLRILKELSSKK*
Ga0116144_106172802	3300009687	Anaerobic Digestor Sludge	MAKAKKEGKPKRNRANLVKKLRLIEKNQILIKQYEENL*
Ga0129333_107434981	3300010354	Freshwater To Marine Saline Gradient	MAKAKKEGKPKKNRGNLVKRLNMIAKNQELIKQYENK*
Ga0153805_10590702	3300012013	Surface Ice	MAKAKKEGKPKRNRGNLVKRLRMIERNTQLLNKYSK*
Ga0157210_100046420	3300012665	Freshwater	MAKARKEGKAKRNRVNLLKRLKMIQKNNEILKSLTAQ*
Ga0129338_13766602	3300012970	Aqueous	MAKAKKEGKPKRNRANLVKRLKVIKHNEKILNEYKTK*
Ga0164293_107083292	3300013004	Freshwater	MAKARKEGKPKRNRANLVKRLRMIQQNHEILNKLKEENL*
(restricted) Ga0172365_100160109	3300013127	Sediment	MAKARKEGKPKRNRANLVKHLNRIARNQQLLEQYK*
(restricted) Ga0172365_104858702	3300013127	Sediment	MAKARKEGKPKRNRRNLVKTLKMILKNQELLKKYQS*
(restricted) Ga0172364_104979102	3300013129	Sediment	MAKARKEGKQKRNRGNLAKRIKLIDKNTQLLNKFKETA*
Ga0181352_11499873	3300017747	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKMIEKNVQLLNEYSK
Ga0181344_10133033	3300017754	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLRLIENNQKLIKEYQSNL
Ga0181343_11024473	3300017766	Freshwater Lake	MAKAKKEGKPKRNRGNLAKRLKVIERNEQILNELNKK
Ga0181355_11704772	3300017785	Freshwater Lake	MAKAKKEGKPKRNRANLVKRLKTIERNVQLLNEYK
Ga0169931_101992912	3300017788	Freshwater	MAKARKEGKPKRNRANLAKRLGIIKHNEELLKQYNQNNN
Ga0169931_104888902	3300017788	Freshwater	MAKARKEGKPKRNRRNLVKTLKMILKNQELLKKYQS
Ga0181553_100929903	3300018416	Salt Marsh	MAKAKKEGKAKKNRGNLVKRLNMIKKNEEILKQYTSNL
Ga0181359_10246232	3300019784	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIERNEQILNEYKKTA
Ga0181359_10362492	3300019784	Freshwater Lake	MAKARKEGKPKRNRANLVKRLKTIERNIQLLNEYSK
Ga0181359_10807201	3300019784	Freshwater Lake	MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQSETH
Ga0181359_11996242	3300019784	Freshwater Lake	MAKSQKNGKPTRNRTNLAKRLAMIKNNEQLLNQYNKIQNNK
Ga0211734_107303675	3300020159	Freshwater	MAKARKEGKSKRNRGNLVKRLKVITRNQQLLEQYK
Ga0211733_111028772	3300020160	Freshwater	MAKARKEGKQKRNRANLVKRIKLIDKNTQLINKFKETA
Ga0211726_101182963	3300020161	Freshwater	MAKARKEGKKKRNRANLVKNLKRIQKTEEIIAKFKQL
Ga0194134_101506014	3300020179	Freshwater Lake	MAKARKEGKPKRNRGNLAKRAKILARNEVFLKQYEDEK
Ga0194115_1000181635	3300020183	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIERNEQILNEYKKK
Ga0194115_102097743	3300020183	Freshwater Lake	VARAKKEGKQKRNRSNLAKRLKLIEKNNQLLNEFKIK
Ga0208597_10671932	3300020562	Freshwater	MAKARKEGKAKRNRANLVKRLKLIQKNQEIINQLTR
Ga0194117_100294402	3300021424	Freshwater Lake	VARAKKEGKQKRNRSNLAKRLKLIEKNNQLLNKFKETA
Ga0222714_106578132	3300021961	Estuarine Water	MAKAKKEGKPKRNRKNLSIKLKRIMRNQELLNEYKLD
Ga0222713_103404951	3300021962	Estuarine Water	TMAKAKKEGKPKRNRGNLVKNLKRIKHNEEVLKSLSQK
Ga0222713_104632492	3300021962	Estuarine Water	MAKARKEGKPKRNRANLVKRLKLIKQNEEILKRIKNQ
Ga0222712_100206263	3300021963	Estuarine Water	MAKARKEGKAKRNRANLVKRLKLIKQNEEVLKSLRAQ
Ga0222712_100232168	3300021963	Estuarine Water	MAKAKKEGKPKRNRGNLVKNLKRIKHNEEVLKSLSQK
Ga0222712_101231624	3300021963	Estuarine Water	MAKARKEGKPKRNRANLVKRLKLIKQNEELLKNLKAQ
Ga0222712_102736103	3300021963	Estuarine Water	MAKARKEGKPKRNRANLVKRLKMIQKNQEIINQLTK
Ga0222712_107404332	3300021963	Estuarine Water	MAKARKEGKQKRNRANLAKRIKLIDKNTQLLNKFKETA
Ga0181353_10139836	3300022179	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIKRNEQILNEYKKTA
Ga0181353_10551773	3300022179	Freshwater Lake	MAKAKKEGKPKRNRANLVKRLKTIERNIQLLNEYSK
Ga0181353_10875571	3300022179	Freshwater Lake	MAKARKEGKQKRNRTNLVKRLKIIAENERLINQYKTA
Ga0181353_10945381	3300022179	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKVIKRNNQLLNEFEKK
Ga0224500_101211872	3300022213	Sediment	MAKSRKEGKPKRNRRNLAKKLARIENNMVLLKKYENK
Ga0181351_10300431	3300022407	Freshwater Lake	MAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ
Ga0214921_102848962	3300023174	Freshwater	MAKARKEGKAKRNRANLLKRLKMIQKNNEILKSLTA
Ga0255223_10278851	3300024480	Freshwater	MAKAKKEGKPKRNRANLVKRLRVIERNEQILNEYKKTA
Ga0208161_10636992	3300025646	Aqueous	MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKKTA
Ga0208644_10568582	3300025889	Aqueous	MAKAKKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA
Ga0256298_10238803	3300026415	Freshwater	MAKAKKEGKPKRNRANLVKRLKVIEHNEKILNEYKKT
Ga0256300_10192433	3300026425	Freshwater	MAKAKKEGKPKRNRANLVKRLKVIEHNEKILNEYKKTA
Ga0255106_10003722	3300027125	Freshwater	MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQTETH
Ga0208788_10473113	3300027499	Deep Subsurface	MAKARKEGKPKRNRVNLTKRLAIIKHNEELLKQYN
Ga0255118_100261718	3300027593	Freshwater	TMAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQTETH
(restricted) Ga0247833_11132702	3300027730	Freshwater	MAKAKKEGKPKRNRENLLKKLRRIEANSEILKRLSESN
Ga0209829_100942202	3300027777	Freshwater Lake	MAKAKKEGKPKRNRGNLVKRLKMINANHEILAAFAKQQNAE
Ga0209353_100923882	3300027798	Freshwater Lake	MAKAKKEGKPKRNRENLVKKLQRIERNAELIKQFEK
Ga0209777_101744782	3300027896	Freshwater Lake Sediment	MAKAKKEGKPKRNRGNLVKNLKRIFRNHDLISKMEEK
Ga0209668_111048142	3300027899	Freshwater Lake Sediment	MAKAKKEGKQKRNRGNLAKRLKLIEKNNQLLNEFKKTA
Ga0315293_103541311	3300031746	Sediment	MAKARKEGSSKGNRANLVKRLKVMEKNRELIKQYE
Ga0315907_102707683	3300031758	Freshwater	MSKAKKEGKQKRNRGNLAKRLKLIEKNTQLLNKFQETA
Ga0315907_103116954	3300031758	Freshwater	MAKARKEGKPKRNRGNLVKRLNMIARNQQLLKQYENE
Ga0315907_103430684	3300031758	Freshwater	MAKARKEGKPKRNRANLVKKLKLIEKNRELLAKYEK
Ga0315900_1000755016	3300031787	Freshwater	MAKARKEGKPKRNRANLAKRLKMIERNNQLLNEYK
Ga0315900_109625352	3300031787	Freshwater	MAKAKKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK
Ga0315909_100680321	3300031857	Freshwater	MAKARKEGKPKRNRGNLVKRLNMIARNQQLLEQYK
Ga0315909_103438432	3300031857	Freshwater	MAKARKEGKPKRNRANLVKRLKTMERNQQLLEQYK
Ga0315904_100852295	3300031951	Freshwater	MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEENL
Ga0315901_105611582	3300031963	Freshwater	MAKARKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK
Ga0315901_106896472	3300031963	Freshwater	MAKAQKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN
Ga0315903_111445352	3300032116	Freshwater	KIMAKAQKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN
Ga0315903_112056732	3300032116	Freshwater	MAKAKKEGKPKKNRGNLVKRLNMIAKNQELIKQYENK
Ga0334977_0533661_330_449	3300033978	Freshwater	MAKAKKEGKPKRNRANLIKSLKRIKNNEELIKKYQSETH
Ga0334982_0107610_30_149	3300033981	Freshwater	MAKARKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN
Ga0335005_0748603_31_138	3300034022	Freshwater	MAKARKEGKPKRNRGNVFKRLKRIQEVEKALESFK
Ga0334987_0183958_688_804	3300034061	Freshwater	MAKAKKEGKPKRNRGNLVKRLKVIKRNNQLLNEFKKTA
Ga0335000_0082694_383_499	3300034063	Freshwater	MAKARKEGKTKRNRINLTKKLNRIKRNVELIKEYEMNL
Ga0310130_0005033_2334_2447	3300034073	Fracking Water	MAKAKKEGKPKRNRRNLAKKLARIENNMVLLKKYENK
Ga0334997_0176101_1_105	3300034280	Freshwater	MAKARKEGKTKRNRINLTKKLNRIKRNVELIKEYE